F340045

General Info

Members Datasets Scaffolds Average Seq Length
227 145 221 181

Family's Representative Sequence

Representative Sequence 3300026089|Ga0207648_10362709|Ga0207648_103627092
Length 197
Sequence MTTLREIQKPKKDEYPPYSRVYMELLKDDGLVLQHMKDNLTAIKKFVYSLPEEKLYFRYAEDKWSIKEILVHIVDDERIFAYRALRYARFDKTELHGFEQDDYTFYSDADERSLASIFEEYQAVRDSTIAMFNGFPEEAFMRSGAAVGNINNRTVRALAYHIAGHELRHLNIIKERYLPNSSTPMKSSHSRNAGDQT

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
3 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
4 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
5 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
6 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
103 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
104 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
105 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
106 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
109 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
110 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
113 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
114 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
115 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
116 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
117 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
118 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
119 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
120 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
121 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
122 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
123 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
124 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
125 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
126 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
127 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
128 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
129 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
130 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
131 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
132 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
133 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
134 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
138 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
139 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
140 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
141 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
142 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
143 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
144 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
145 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.04
Metatranscriptomes 1.32
Isolates 2.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.44
Nodule 0
Rhizoplane 1.76
Rhizosphere 93.39
Stem 0
Stem Tuber 0
Unclassified 4.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1088460 2162886007 Bacteria 1054
2 rootL2_10140194 3300003322 Unclassified 2277
3 Ga0065704_10001591 3300005289 Bacteria 7196
4 Ga0065704_10090255 3300005289 Bacteria 2801
5 Ga0065704_10191970 3300005289 Bacteria 1184
6 Ga0065712_10008179 3300005290 Unclassified 3438
7 Ga0065715_10000568 3300005293 Bacteria 13907
8 Ga0065715_10489009 3300005293 Unclassified 790
9 Ga0065707_10013553 3300005295 Bacteria 1604
10 Ga0070658_10000059 3300005327 Bacteria 112781
11 Ga0070690_100900831 3300005330 Bacteria 692
12 Ga0070670_100096487 3300005331 Bacteria 2543
13 Ga0070670_100140569 3300005331 Bacteria 2087
14 Ga0070682_100002797 3300005337 Bacteria 9668
15 Ga0070689_100005177 3300005340 Bacteria 8874
16 Ga0070689_100477626 3300005340 Bacteria 1064
17 Ga0070668_100399649 3300005347 Unclassified 1173
18 Ga0070668_101441617 3300005347 Unclassified 628
19 Ga0070669_100793239 3300005353 Unclassified 805
20 Ga0070675_100097542 3300005354 Bacteria 2471
21 Ga0070675_100890096 3300005354 Unclassified 816
22 Ga0070674_100342220 3300005356 Unclassified 1205
23 Ga0070673_100162657 3300005364 Bacteria 1899
24 Ga0070673_100177066 3300005364 Bacteria 1823
25 Ga0070688_100002851 3300005365 Bacteria 8811
26 Ga0070688_100130068 3300005365 Bacteria 1697
27 Ga0070667_100638910 3300005367 Bacteria 982
28 Ga0070703_10314668 3300005406 Unclassified 657
29 Ga0070700_100136307 3300005441 Bacteria 1662
30 Ga0070700_100327620 3300005441 Bacteria 1127
31 Ga0070694_100002499 3300005444 Bacteria 10855
32 Ga0070662_100023154 3300005457 Bacteria 4264
33 Ga0068867_100391253 3300005459 Bacteria 1170
34 Ga0070685_10001964 3300005466 Bacteria 10675
35 Ga0070685_10007021 3300005466 Bacteria 5747
36 Ga0070706_100000031 3300005467 Bacteria 153504
37 Ga0070698_100465490 3300005471 Unclassified 1200
38 Ga0068853_100240352 3300005539 Bacteria 1659
39 Ga0068853_100943821 3300005539 Unclassified 829
40 Ga0070672_100133052 3300005543 Bacteria 2046
41 Ga0070672_100390829 3300005543 Bacteria 1191
42 Ga0070672_101115848 3300005543 Bacteria 701
43 Ga0070686_100121330 3300005544 Bacteria 1795
44 Ga0070695_100848680 3300005545 Bacteria 735
45 Ga0068855_100002770 3300005563 Bacteria 21581
46 Ga0068855_100288189 3300005563 Bacteria 1821
47 Ga0070664_101014074 3300005564 Bacteria 780
48 Ga0068857_100299854 3300005577 Bacteria 1481
49 Ga0068854_100949774 3300005578 Unclassified 758
50 Ga0068856_100120996 3300005614 Bacteria 2619
51 Ga0070702_100047235 3300005615 Bacteria 2445
52 Ga0068859_100007279 3300005617 Bacteria 11225
53 Ga0068859_100152523 3300005617 Unclassified 2386
54 Ga0068859_100205214 3300005617 Bacteria 2056
55 Ga0068859_100383225 3300005617 Bacteria 1501
56 Ga0068859_100943556 3300005617 Unclassified 946
57 Ga0068859_101179811 3300005617 Unclassified 843
58 Ga0068864_100239212 3300005618 Bacteria 1682
59 Ga0068864_100549039 3300005618 Unclassified 1116
60 Ga0068851_10216720 3300005834 Bacteria 1074
61 Ga0068870_10085302 3300005840 Bacteria 1755
62 Ga0068863_100012069 3300005841 Bacteria 8346
63 Ga0068863_100412340 3300005841 Bacteria 1322
64 Ga0068863_100676572 3300005841 Bacteria 1025
65 Ga0068863_100760642 3300005841 Unclassified 965
66 Ga0068858_100036489 3300005842 Bacteria 4559
67 Ga0068858_100527083 3300005842 Unclassified 1143
68 Ga0068860_100123336 3300005843 Bacteria 2482
69 Ga0068860_101178237 3300005843 Unclassified 786
70 Ga0068862_100195143 3300005844 Bacteria 1823
71 Ga0097621_100004499 3300006237 Bacteria 9722
72 Ga0068871_100007061 3300006358 Bacteria 8004
73 Ga0068871_100298310 3300006358 Bacteria 1414
74 Ga0097620_100007279 3300006931 Bacteria 11225
75 Ga0097620_100152511 3300006931 Unclassified 2386
76 Ga0097620_100205220 3300006931 Bacteria 2056
77 Ga0097620_100383210 3300006931 Bacteria 1501
78 Ga0097620_100943466 3300006931 Unclassified 946
79 Ga0097620_101179903 3300006931 Unclassified 843
80 Ga0105240_10000242 3300009093 Bacteria 108001
81 Ga0105240_10044925 3300009093 Bacteria 5607
82 Ga0105240_10108395 3300009093 Bacteria 3365
83 Ga0105240_10141075 3300009093 Bacteria 2881
84 Ga0105240_10197104 3300009093 Bacteria 2363
85 Ga0105247_10018420 3300009101 Bacteria 4188
86 Ga0114129_10687186 3300009147 Bacteria 1317
87 Ga0105243_10000003 3300009148 Bacteria 712931
88 Ga0105243_10000112 3300009148 Bacteria 93493
89 Ga0105243_10306076 3300009148 Bacteria 1442
90 Ga0105241_10054149 3300009174 Unclassified 3070
91 Ga0105241_10127938 3300009174 Bacteria 2053
92 Ga0105241_10151233 3300009174 Bacteria 1899
93 Ga0105241_10184346 3300009174 Bacteria 1733
94 Ga0105242_10000013 3300009176 Bacteria 133981
95 Ga0105242_10149394 3300009176 Bacteria 2036
96 Ga0105248_11376022 3300009177 Unclassified 798
97 Ga0105237_10025928 3300009545 Bacteria 5992
98 Ga0105237_10612861 3300009545 Unclassified 1095
99 Ga0105238_10002420 3300009551 Bacteria 18719
100 Ga0105238_10294751 3300009551 Bacteria 1605
101 Ga0105249_10020127 3300009553 Bacteria 5960
102 Ga0105249_10323129 3300009553 Bacteria 1555
103 Ga0105239_10012601 3300010375 Bacteria 9408
104 Ga0105246_10161422 3300011119 Bacteria 1708
105 Ga0105246_10372366 3300011119 Unclassified 1177
106 Ga0157374_10493820 3300013296 Bacteria 1228
107 Ga0163162_10003354 3300013306 Bacteria 15318
108 Ga0163162_10124541 3300013306 Bacteria 2683
109 Ga0163162_10218279 3300013306 Unclassified 2037
110 Ga0163162_10276923 3300013306 Unclassified 1810
111 Ga0163162_12372959 3300013306 Bacteria 610
112 Ga0157375_10701195 3300013308 Bacteria 1166
113 Ga0157375_11322691 3300013308 Bacteria 848
114 Ga0163163_10249464 3300014325 Bacteria 1825
115 Ga0163163_10646039 3300014325 Unclassified 1121
116 Ga0157377_10009620 3300014745 Bacteria 4753
117 Ga0157379_10405164 3300014968 Unclassified 1254
118 Ga0157379_10552818 3300014968 Bacteria 1071
119 Ga0157376_10297121 3300014969 Bacteria 1527
120 Ga0157376_10801799 3300014969 Unclassified 954
121 Ga0163161_10010665 3300017792 Bacteria 6363
122 Ga0163161_10423174 3300017792 Unclassified 1072
123 Ga0207647_10001526 3300025904 Bacteria 17817
124 Ga0207647_10065919 3300025904 Bacteria 2197
125 Ga0207643_10074630 3300025908 Bacteria 1956
126 Ga0207705_10000195 3300025909 Bacteria 61397
127 Ga0207684_10000110 3300025910 Bacteria 153722
128 Ga0207654_10107962 3300025911 Bacteria 1726
129 Ga0207654_10333236 3300025911 Bacteria 1040
130 Ga0207695_10000066 3300025913 Bacteria 334103
131 Ga0207695_10026581 3300025913 Bacteria 6459
132 Ga0207695_10105815 3300025913 Bacteria 2800
133 Ga0207671_10445326 3300025914 Unclassified 1031
134 Ga0207662_10099641 3300025918 Bacteria 1799
135 Ga0207650_10093861 3300025925 Bacteria 2297
136 Ga0207650_10226262 3300025925 Unclassified 1507
137 Ga0207659_10041581 3300025926 Bacteria 3219
138 Ga0207644_10261991 3300025931 Bacteria 1383
139 Ga0207686_10000006 3300025934 Bacteria 259583
140 Ga0207709_10000008 3300025935 Bacteria 713099
141 Ga0207709_10000037 3300025935 Bacteria 279771
142 Ga0207709_10203933 3300025935 Unclassified 1414
143 Ga0207670_10215996 3300025936 Bacteria 1465
144 Ga0207691_10042784 3300025940 Bacteria 4174
145 Ga0207711_10729918 3300025941 Unclassified 924
146 Ga0207667_10005483 3300025949 Bacteria 15466
147 Ga0207651_10609621 3300025960 Bacteria 955
148 Ga0207712_10000765 3300025961 Bacteria 24158
149 Ga0207712_10007840 3300025961 Bacteria 6750
150 Ga0207712_10197360 3300025961 Bacteria 1593
151 Ga0207712_10212312 3300025961 Bacteria 1542
152 Ga0207712_10687847 3300025961 Bacteria 892
153 Ga0207703_10322849 3300026035 Unclassified 1414
154 Ga0207639_11161763 3300026041 Bacteria 724
155 Ga0207708_10035065 3300026075 Bacteria 3818
156 Ga0207708_10282135 3300026075 Bacteria 1346
157 Ga0207641_10002324 3300026088 Bacteria 17635
158 Ga0207641_10125458 3300026088 Bacteria 2298
159 Ga0207641_10311983 3300026088 Bacteria 1489
160 Ga0207641_10400206 3300026088 Bacteria 1318
161 Ga0207648_10095321 3300026089 Bacteria 2603
162 Ga0207648_10362709 3300026089 Unclassified 1307
163 Ga0207676_10349186 3300026095 Bacteria 1367
164 Ga0207676_10401324 3300026095 Bacteria 1281
165 Ga0207676_11129756 3300026095 Unclassified 775
166 Ga0207674_10322034 3300026116 Bacteria 1495
167 Ga0207675_100439502 3300026118 Bacteria 1291
168 Ga0268265_10061227 3300028380 Bacteria 2888
169 Ga0268265_10540500 3300028380 Unclassified 1104
170 Ga0268264_10514374 3300028381 Bacteria 1169
171 Ga0268264_11124441 3300028381 Unclassified 794
172 Ga0307515_10000036 3300028794 Bacteria 332188
173 Ga0307405_10326518 3300031731 Bacteria 1174
174 Ga0307413_10111805 3300031824 Unclassified 1830
175 Ga0307413_10248143 3300031824 Bacteria 1319
176 Ga0307410_10106045 3300031852 Bacteria 2024
177 Ga0307406_10246987 3300031901 Unclassified 1342
178 Ga0307416_100151077 3300032002 Bacteria 2130
179 Ga0307416_100175368 3300032002 Bacteria 2002
180 Ga0307416_100553514 3300032002 Bacteria 1224
181 Ga0307416_101176986 3300032002 Bacteria 872
182 Ga0307414_10660186 3300032004 Bacteria 943
183 Ga0307414_11129411 3300032004 Unclassified 724
184 Ga0307415_100093875 3300032126 Bacteria 2180
185 Ga0316574_0112087 3300035398 Bacteria 1749
186 Ga0395901_0495064 3300038443 Unclassified 1245
187 Ga0242422_01715 3300038699 Bacteria 1512
188 Ga0436363_0518566 3300039450 Bacteria 1774
189 Ga0439439_0084002 3300041406 Bacteria 864
190 Ga0439431_0014753 3300041997 Bacteria 1814
191 Ga0453683_0013751 3300044673 Bacteria 5267
192 Ga0453684_0090801 3300044712 Bacteria 3773
193 Ga0466959_0071012 3300045049 Bacteria 2522
194 Ga0495651_0157753 3300046462 Bacteria 1629
195 Ga0495667_0202850 3300046559 Bacteria 1269
196 Ga0495659_0066545 3300046664 Bacteria 1342
197 Ga0495613_0686921 3300046689 Unclassified 675
198 Ga0495674_0853897 3300047319 Unclassified 705
199 Ga0495677_0219265 3300047445 Unclassified 741
200 Ga0495684_0155520 3300047471 Bacteria 1708
201 Ga0496106_0275907 3300048909 Unclassified 1346
202 Ga0496106_0805859 3300048909 Bacteria 745
203 Ga0496110_1433202 3300048913 Bacteria 600
204 Ga0496112_0488479 3300048915 Bacteria 1167
205 Ga0496116_0027581 3300048919 Bacteria 4133
206 Ga0496117_0001774 3300048920 Bacteria 29604
207 Ga0496118_0127088 3300048921 Bacteria 1646
208 Ga0496122_0003563 3300048925 Bacteria 20343
209 Ga0496123_0021106 3300048926 Bacteria 5072
210 Ga0501315_062106 3300049531 Unclassified 606
211 Ga0501316_016397 3300049532 Bacteria 900
212 Ga0501317_000316 3300049533 Bacteria 3196
213 Ga0501216_034121 3300049660 Unclassified 951
214 Ga0501235_053343 3300049669 Unclassified 939
215 Ga0501257_022119 3300049686 Bacteria 1503
216 Ga0501257_059646 3300049686 Bacteria 963
217 Ga0501259_056134 3300049688 Unclassified 812
218 Ga0501225_0035117 3300049705 Unclassified 1380
219 Ga0501204_083792 3300049850 Unclassified 546
220 nmdc:mga06r32_203412_c1 3300050510 Bacteria 1968
221 Ga0500611_000001 3300053727 Bacteria 385744

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049531 Ga0501315_062106 Ga0501315_062106_108_581 153
2 3300006358 Ga0068871_100298310 Ga0068871_1002983101 154
3 3300011119 Ga0105246_10161422 Ga0105246_101614222 154
4 3300026095 Ga0207676_11129756 Ga0207676_111297561 154
5 3300005618 Ga0068864_100549039 Ga0068864_1005490392 156
6 3300026095 Ga0207676_10349186 Ga0207676_103491863 156
7 3300045049 Ga0466959_0071012 Ga0466959_0071012_1848_2357 156
8 3300046559 Ga0495667_0202850 Ga0495667_0202850_763_1233 156
9 3300049850 Ga0501204_083792 Ga0501204_083792_15_512 156
10 iso_pu_bacteria 2721755487 2722730894 164
11 iso_pu_bacteria 2904780799 2904783572 164
12 iso_pu_bacteria 2919177583 2919181434 164
13 iso_pu_bacteria 8055588893 8055589986 164
14 iso_pu_bacteria 2977254563 2977259241 166
15 iso_pu_bacteria 2990275345 2990280278 166
16 3300005289 Ga0065704_10001591 Ga0065704_100015916 167
17 3300009148 Ga0105243_10000003 Ga0105243_10000003252 167
18 3300025935 Ga0207709_10000008 Ga0207709_10000008322 167
19 3300048919 Ga0496116_0027581 Ga0496116_0027581_3375_3923 167
20 3300048920 Ga0496117_0001774 Ga0496117_0001774_2000_2548 167
21 3300048921 Ga0496118_0127088 Ga0496118_0127088_843_1391 167
22 3300048925 Ga0496122_0003563 Ga0496122_0003563_17606_18154 167
23 3300048926 Ga0496123_0021106 Ga0496123_0021106_3132_3680 167
24 3300005290 Ga0065712_10008179 Ga0065712_100081794 168
25 3300005471 Ga0070698_100465490 Ga0070698_1004654902 168
26 3300032004 Ga0307414_10660186 Ga0307414_106601861 168
27 3300041406 Ga0439439_0084002 Ga0439439_0084002_208_714 168
28 3300041997 Ga0439431_0014753 Ga0439431_0014753_180_686 168
29 3300032002 Ga0307416_101176986 Ga0307416_1011769861 170
30 3300048909 Ga0496106_0805859 Ga0496106_0805859_123_635 170
31 3300048913 Ga0496110_1433202 Ga0496110_1433202_21_533 170
32 3300048915 Ga0496112_0488479 Ga0496112_0488479_199_711 170
33 3300049532 Ga0501316_016397 Ga0501316_016397_101_625 170
34 3300049533 Ga0501317_000316 Ga0501317_000316_102_626 170
35 3300005364 Ga0070673_100162657 Ga0070673_1001626572 171
36 3300005459 Ga0068867_100391253 Ga0068867_1003912532 171
37 3300005543 Ga0070672_100390829 Ga0070672_1003908292 171
38 3300005564 Ga0070664_101014074 Ga0070664_1010140742 171
39 3300025960 Ga0207651_10609621 Ga0207651_106096212 171
40 3300005356 Ga0070674_100342220 Ga0070674_1003422202 172
41 3300005577 Ga0068857_100299854 Ga0068857_1002998542 172
42 3300005614 Ga0068856_100120996 Ga0068856_1001209963 172
43 3300009093 Ga0105240_10044925 Ga0105240_100449253 172
44 3300009093 Ga0105240_10108395 Ga0105240_101083952 172
45 3300009174 Ga0105241_10054149 Ga0105241_100541492 172
46 3300009545 Ga0105237_10025928 Ga0105237_100259285 172
47 3300010375 Ga0105239_10012601 Ga0105239_100126016 172
48 3300025913 Ga0207695_10026581 Ga0207695_100265815 172
49 3300026116 Ga0207674_10322034 Ga0207674_103220341 172
50 3300046462 Ga0495651_0157753 Ga0495651_0157753_1064_1591 172
51 3300003322 rootL2_10140194 rootL2_101401941 173
52 3300005289 Ga0065704_10191970 Ga0065704_101919702 173
53 3300005293 Ga0065715_10000568 Ga0065715_100005687 173
54 3300005293 Ga0065715_10489009 Ga0065715_104890091 173
55 3300005295 Ga0065707_10013553 Ga0065707_100135532 173
56 3300005327 Ga0070658_10000059 Ga0070658_1000005959 173
57 3300005331 Ga0070670_100096487 Ga0070670_1000964872 173
58 3300005337 Ga0070682_100002797 Ga0070682_1000027974 173
59 3300005406 Ga0070703_10314668 Ga0070703_103146681 173
60 3300005444 Ga0070694_100002499 Ga0070694_1000024998 173
61 3300005457 Ga0070662_100023154 Ga0070662_1000231544 173
62 3300005467 Ga0070706_100000031 Ga0070706_100000031111 173
63 3300005539 Ga0068853_100240352 Ga0068853_1002403522 173
64 3300005545 Ga0070695_100848680 Ga0070695_1008486801 173
65 3300005563 Ga0068855_100002770 Ga0068855_1000027706 173
66 3300005563 Ga0068855_100288189 Ga0068855_1002881893 173
67 3300005578 Ga0068854_100949774 Ga0068854_1009497741 173
68 3300005617 Ga0068859_100007279 Ga0068859_1000072798 173
69 3300005617 Ga0068859_100943556 Ga0068859_1009435562 173
70 3300005617 Ga0068859_101179811 Ga0068859_1011798111 173
71 3300005841 Ga0068863_100760642 Ga0068863_1007606422 173
72 3300005842 Ga0068858_100036489 Ga0068858_1000364895 173
73 3300005843 Ga0068860_100123336 Ga0068860_1001233363 173
74 3300005843 Ga0068860_101178237 Ga0068860_1011782372 173
75 3300006237 Ga0097621_100004499 Ga0097621_1000044995 173
76 3300006358 Ga0068871_100007061 Ga0068871_1000070616 173
77 3300006931 Ga0097620_100007279 Ga0097620_1000072797 173
78 3300006931 Ga0097620_100943466 Ga0097620_1009434662 173
79 3300006931 Ga0097620_101179903 Ga0097620_1011799031 173
80 3300009093 Ga0105240_10141075 Ga0105240_101410753 173
81 3300009147 Ga0114129_10687186 Ga0114129_106871862 173
82 3300009148 Ga0105243_10000112 Ga0105243_100001127 173
83 3300009148 Ga0105243_10306076 Ga0105243_103060762 173
84 3300009176 Ga0105242_10000013 Ga0105242_1000001397 173
85 3300009551 Ga0105238_10294751 Ga0105238_102947511 173
86 3300011119 Ga0105246_10372366 Ga0105246_103723662 173
87 3300013306 Ga0163162_12372959 Ga0163162_123729591 173
88 3300014325 Ga0163163_10249464 Ga0163163_102494642 173
89 3300014745 Ga0157377_10009620 Ga0157377_100096208 173
90 3300014968 Ga0157379_10552818 Ga0157379_105528183 173
91 3300014969 Ga0157376_10801799 Ga0157376_108017991 173
92 3300017792 Ga0163161_10423174 Ga0163161_104231742 173
93 3300025904 Ga0207647_10001526 Ga0207647_100015267 173
94 3300025904 Ga0207647_10065919 Ga0207647_100659192 173
95 3300025909 Ga0207705_10000195 Ga0207705_100001952 173
96 3300025910 Ga0207684_10000110 Ga0207684_10000110115 173
97 3300025913 Ga0207695_10105815 Ga0207695_101058153 173
98 3300025925 Ga0207650_10226262 Ga0207650_102262622 173
99 3300025931 Ga0207644_10261991 Ga0207644_102619912 173
100 3300025934 Ga0207686_10000006 Ga0207686_1000000679 173
101 3300025935 Ga0207709_10000037 Ga0207709_1000003798 173
102 3300025935 Ga0207709_10203933 Ga0207709_102039332 173
103 3300025949 Ga0207667_10005483 Ga0207667_100054832 173
104 3300026041 Ga0207639_11161763 Ga0207639_111617631 173
105 3300026075 Ga0207708_10282135 Ga0207708_102821351 173
106 3300026088 Ga0207641_10400206 Ga0207641_104002062 173
107 3300026118 Ga0207675_100439502 Ga0207675_1004395022 173
108 3300028381 Ga0268264_10514374 Ga0268264_105143742 173
109 3300031901 Ga0307406_10246987 Ga0307406_102469873 173
110 3300038443 Ga0395901_0495064 Ga0395901_0495064_61_582 173
111 3300038699 Ga0242422_01715 Ga0242422_01715_203_781 173
112 3300039450 Ga0436363_0518566 Ga0436363_0518566_707_1234 173
113 3300044673 Ga0453683_0013751 Ga0453683_0013751_3729_4256 173
114 3300044712 Ga0453684_0090801 Ga0453684_0090801_702_1229 173
115 3300046664 Ga0495659_0066545 Ga0495659_0066545_792_1325 173
116 3300046689 Ga0495613_0686921 Ga0495613_0686921_26_547 173
117 3300047445 Ga0495677_0219265 Ga0495677_0219265_136_669 173
118 3300047471 Ga0495684_0155520 Ga0495684_0155520_178_699 173
119 3300048909 Ga0496106_0275907 Ga0496106_0275907_173_694 173
120 3300049660 Ga0501216_034121 Ga0501216_034121_334_858 173
121 3300049669 Ga0501235_053343 Ga0501235_053343_243_767 173
122 3300049686 Ga0501257_022119 Ga0501257_022119_346_870 173
123 3300049705 Ga0501225_0035117 Ga0501225_0035117_195_719 173
124 3300050510 nmdc:mga06r32_203412_c1 nmdc:mga06r32_203412_c1_668_1219 173
125 3300005347 Ga0070668_101441617 Ga0070668_1014416171 175
126 3300009553 Ga0105249_10020127 Ga0105249_100201276 175
127 3300013306 Ga0163162_10003354 Ga0163162_1000335411 175
128 3300014968 Ga0157379_10405164 Ga0157379_104051642 175
129 3300017792 Ga0163161_10010665 Ga0163161_100106656 175
130 3300028794 Ga0307515_10000036 Ga0307515_10000036137 175
131 3300013296 Ga0157374_10493820 Ga0157374_104938202 177
132 3300031731 Ga0307405_10326518 Ga0307405_103265182 177
133 3300031824 Ga0307413_10111805 Ga0307413_101118051 177
134 3300031852 Ga0307410_10106045 Ga0307410_101060453 177
135 3300032002 Ga0307416_100175368 Ga0307416_1001753683 177
136 3300032126 Ga0307415_100093875 Ga0307415_1000938753 177
137 3300035398 Ga0316574_0112087 Ga0316574_0112087_578_1132 177
138 3300005330 Ga0070690_100900831 Ga0070690_1009008311 178
139 3300005331 Ga0070670_100140569 Ga0070670_1001405691 178
140 3300005340 Ga0070689_100005177 Ga0070689_1000051773 178
141 3300005340 Ga0070689_100477626 Ga0070689_1004776261 178
142 3300005347 Ga0070668_100399649 Ga0070668_1003996492 178
143 3300005353 Ga0070669_100793239 Ga0070669_1007932391 178
144 3300005354 Ga0070675_100097542 Ga0070675_1000975423 178
145 3300005354 Ga0070675_100890096 Ga0070675_1008900961 178
146 3300005364 Ga0070673_100177066 Ga0070673_1001770664 178
147 3300005365 Ga0070688_100002851 Ga0070688_1000028513 178
148 3300005365 Ga0070688_100130068 Ga0070688_1001300682 178
149 3300005367 Ga0070667_100638910 Ga0070667_1006389102 178
150 3300005441 Ga0070700_100136307 Ga0070700_1001363071 178
151 3300005466 Ga0070685_10001964 Ga0070685_100019645 178
152 3300005466 Ga0070685_10007021 Ga0070685_100070216 178
153 3300005539 Ga0068853_100943821 Ga0068853_1009438212 178
154 3300005543 Ga0070672_100133052 Ga0070672_1001330521 178
155 3300005544 Ga0070686_100121330 Ga0070686_1001213304 178
156 3300005617 Ga0068859_100152523 Ga0068859_1001525233 178
157 3300005617 Ga0068859_100205214 Ga0068859_1002052142 178
158 3300005617 Ga0068859_100383225 Ga0068859_1003832252 178
159 3300005618 Ga0068864_100239212 Ga0068864_1002392122 178
160 3300005834 Ga0068851_10216720 Ga0068851_102167201 178
161 3300005840 Ga0068870_10085302 Ga0068870_100853022 178
162 3300005841 Ga0068863_100012069 Ga0068863_10001206912 178
163 3300005841 Ga0068863_100412340 Ga0068863_1004123402 178
164 3300005841 Ga0068863_100676572 Ga0068863_1006765721 178
165 3300005842 Ga0068858_100527083 Ga0068858_1005270832 178
166 3300005844 Ga0068862_100195143 Ga0068862_1001951432 178
167 3300006931 Ga0097620_100152511 Ga0097620_1001525113 178
168 3300006931 Ga0097620_100205220 Ga0097620_1002052202 178
169 3300006931 Ga0097620_100383210 Ga0097620_1003832102 178
170 3300009093 Ga0105240_10000242 Ga0105240_1000024241 178
171 3300009093 Ga0105240_10197104 Ga0105240_101971043 178
172 3300009101 Ga0105247_10018420 Ga0105247_100184204 178
173 3300009174 Ga0105241_10127938 Ga0105241_101279382 178
174 3300009174 Ga0105241_10151233 Ga0105241_101512332 178
175 3300009176 Ga0105242_10149394 Ga0105242_101493942 178
176 3300009177 Ga0105248_11376022 Ga0105248_113760221 178
177 3300009545 Ga0105237_10612861 Ga0105237_106128612 178
178 3300009553 Ga0105249_10323129 Ga0105249_103231292 178
179 3300013306 Ga0163162_10124541 Ga0163162_101245411 178
180 3300013306 Ga0163162_10218279 Ga0163162_102182791 178
181 3300013306 Ga0163162_10276923 Ga0163162_102769232 178
182 3300013308 Ga0157375_10701195 Ga0157375_107011951 178
183 3300013308 Ga0157375_11322691 Ga0157375_113226912 178
184 3300014325 Ga0163163_10646039 Ga0163163_106460392 178
185 3300014969 Ga0157376_10297121 Ga0157376_102971212 178
186 3300025908 Ga0207643_10074630 Ga0207643_100746302 178
187 3300025911 Ga0207654_10107962 Ga0207654_101079621 178
188 3300025911 Ga0207654_10333236 Ga0207654_103332362 178
189 3300025913 Ga0207695_10000066 Ga0207695_10000066233 178
190 3300025914 Ga0207671_10445326 Ga0207671_104453262 178
191 3300025918 Ga0207662_10099641 Ga0207662_100996412 178
192 3300025925 Ga0207650_10093861 Ga0207650_100938614 178
193 3300025926 Ga0207659_10041581 Ga0207659_100415813 178
194 3300025936 Ga0207670_10215996 Ga0207670_102159962 178
195 3300025940 Ga0207691_10042784 Ga0207691_100427844 178
196 3300025941 Ga0207711_10729918 Ga0207711_107299182 178
197 3300025961 Ga0207712_10000765 Ga0207712_100007654 178
198 3300025961 Ga0207712_10007840 Ga0207712_100078404 178
199 3300025961 Ga0207712_10197360 Ga0207712_101973603 178
200 3300025961 Ga0207712_10212312 Ga0207712_102123122 178
201 3300025961 Ga0207712_10687847 Ga0207712_106878471 178
202 3300026035 Ga0207703_10322849 Ga0207703_103228492 178
203 3300026075 Ga0207708_10035065 Ga0207708_100350651 178
204 3300026088 Ga0207641_10002324 Ga0207641_1000232414 178
205 3300026088 Ga0207641_10125458 Ga0207641_101254581 178
206 3300026088 Ga0207641_10311983 Ga0207641_103119832 178
207 3300026089 Ga0207648_10095321 Ga0207648_100953213 178
208 3300026089 Ga0207648_10362709 Ga0207648_103627092 178
209 3300026095 Ga0207676_10401324 Ga0207676_104013242 178
210 3300028380 Ga0268265_10061227 Ga0268265_100612273 178
211 3300028380 Ga0268265_10540500 Ga0268265_105405001 178
212 3300028381 Ga0268264_11124441 Ga0268264_111244411 178
213 3300031824 Ga0307413_10248143 Ga0307413_102481432 178
214 3300032002 Ga0307416_100553514 Ga0307416_1005535141 178
215 3300049686 Ga0501257_059646 Ga0501257_059646_49_612 178
216 3300053727 Ga0500611_000001 Ga0500611_000001_32926_33501 178
217 3300047319 Ga0495674_0853897 Ga0495674_0853897_44_592 181
218 3300009174 Ga0105241_10184346 Ga0105241_101843461 182
219 3300005441 Ga0070700_100327620 Ga0070700_1003276201 183
220 3300005543 Ga0070672_101115848 Ga0070672_1011158481 183
221 3300005615 Ga0070702_100047235 Ga0070702_1000472352 183
222 3300009551 Ga0105238_10002420 Ga0105238_100024205 183
223 3300032002 Ga0307416_100151077 Ga0307416_1001510773 183
224 3300032004 Ga0307414_11129411 Ga0307414_111294111 183
225 3300049688 Ga0501259_056134 Ga0501259_056134_59_610 183
226 2162886007 SwRhRL2b_contig_1088460 SwRhRL2b_0973.00003960 189
227 3300005289 Ga0065704_10090255 Ga0065704_100902552 189

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04978

DUF664

Protein of unknown function (DUF664)

31

176

0.85

PF12867

DinB_2

DinB superfamily

35

173

0.84

PF05163

DinB

DinB family

23

169

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rd9-assembly3.cif.gz_B crystal structure of a putative yfit-like metal-dependent hydrolase (bh0186) from bacillus halodurans c-125 at 2.30 a resolution 0.8415 37 188
1rxq-assembly1.cif.gz_B yfit from bacillus subtilis is a probable metal-dependent hydrolase with an unusual four-helix bundle topology 0.8299 18 186
2rd9-assembly1.cif.gz_A crystal structure of a putative yfit-like metal-dependent hydrolase (bh0186) from bacillus halodurans c-125 at 2.30 a resolution 0.788 37 188
2nsg-assembly1.cif.gz_A crystal structure of the mycothiol-dependent maleylpyruvate isomerase h52a mutant 0.7821 34 180
2yqy-assembly2.cif.gz_B crystal structure of tt2238, a four-helix bundle protein 0.7811 43 185
ID Description Score Start End Superfamily
2rd9B01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8405 43 185 1.20.120.450
1rxqD00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8204 18 186 1.20.120.450
2nsgA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7821 34 180 1.20.120.450
2yqyB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7811 43 185 1.20.120.450
1rxqD00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7749 18 186 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A7Y5G5L8-F1-model_v4 DinB family protein 0.9941 15 188
AF-A0A846F8E2-F1-model_v4 deleted 0.9915 15 188
AF-A0A554VFT1-F1-model_v4 DinB family protein 0.9853 13 189
AF-A0A7S8EAU5-F1-model_v4 DinB family protein 0.9791 15 189
AF-A0A537KKH6-F1-model_v4 DinB family protein 0.9785 48 189

Feature Viewer

pLDDT pTM Quality
92.31 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map