F339896

General Info

Members Datasets Scaffolds Average Seq Length
227 156 454 116

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10050928|Ga0105249_100509286
Length 130
Sequence LSLHSFSEGSVAVPLVFSYGTLQEERVQLSTFGRRLKGQEDELVGFEPSLVKIEDPEAVARTGKTHHANVTFNGRNDSRVSGTAFEITDAELAAADRYERVDGYQRIAARLASGRQTWVYIDARSAPAAS

Samples

Sample ID Description Type Environment
1 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
103 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
104 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
105 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
106 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
107 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
110 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
111 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
112 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
113 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
114 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
115 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
116 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
117 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
118 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
119 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
120 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
121 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
124 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
125 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
126 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
127 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
128 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
129 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
132 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
133 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
134 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
135 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
136 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
137 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
138 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
139 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
140 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
141 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
142 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
145 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
146 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
147 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
148 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
149 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
150 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
151 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
152 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
153 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
154 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
155 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
156 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.56
Metatranscriptomes 0
Isolates 0.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.44
Rhizoplane 2.64
Rhizosphere 95.15
Stem 0
Stem Tuber 0
Unclassified 23.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105249_10050928 3300009553 Bacteria 3776
2 Ga0065707_10262391 3300005295 Unclassified 1094
3 Ga0065707_10288977 3300005295 Bacteria 1029
4 Ga0070676_10074288 3300005328 Bacteria 2047
5 Ga0068869_100009092 3300005334 Bacteria 6438
6 Ga0068869_100087848 3300005334 Bacteria 2333
7 Ga0070680_101333504 3300005336 Bacteria 621
8 Ga0068868_101524293 3300005338 Bacteria 626
9 Ga0070691_10010086 3300005341 Bacteria 4305
10 Ga0070691_10757575 3300005341 Bacteria 588
11 Ga0070692_10063056 3300005345 Bacteria 1957
12 Ga0070668_100082104 3300005347 Bacteria 2528
13 Ga0070669_100011625 3300005353 Bacteria 6245
14 Ga0070669_100350427 3300005353 Bacteria 1198
15 Ga0070669_100587907 3300005353 Bacteria 932
16 Ga0070674_100640878 3300005356 Bacteria 902
17 Ga0070673_101486525 3300005364 Unclassified 639
18 Ga0070659_100025053 3300005366 Bacteria 4579
19 Ga0070713_100000314 3300005436 Bacteria 31729
20 Ga0070701_10000168 3300005438 Bacteria 20343
21 Ga0070701_10751727 3300005438 Unclassified 661
22 Ga0070711_100376155 3300005439 Unclassified 1147
23 Ga0070705_100024766 3300005440 Bacteria 3244
24 Ga0070705_100520455 3300005440 Bacteria 906
25 Ga0070700_100262081 3300005441 Bacteria 1245
26 Ga0070694_100003697 3300005444 Bacteria 9129
27 Ga0070694_100059450 3300005444 Bacteria 2603
28 Ga0070708_100083746 3300005445 Bacteria 2892
29 Ga0070708_100726075 3300005445 Unclassified 934
30 Ga0070663_101612533 3300005455 Unclassified 579
31 Ga0068867_101708400 3300005459 Bacteria 590
32 Ga0068867_102043327 3300005459 Unclassified 542
33 Ga0070706_100099347 3300005467 Bacteria 2704
34 Ga0070706_100593195 3300005467 Bacteria 1030
35 Ga0070707_100145330 3300005468 Bacteria 2308
36 Ga0070707_100404290 3300005468 Bacteria 1326
37 Ga0070707_100538692 3300005468 Bacteria 1129
38 Ga0070707_100621780 3300005468 Bacteria 1042
39 Ga0070707_101121610 3300005468 Unclassified 753
40 Ga0070698_100086610 3300005471 Bacteria 3119
41 Ga0070698_100111210 3300005471 Bacteria 2704
42 Ga0070698_100527107 3300005471 Bacteria 1120
43 Ga0070698_101060061 3300005471 Unclassified 759
44 Ga0070699_100005786 3300005518 Bacteria 10813
45 Ga0070699_101282360 3300005518 Bacteria 672
46 Ga0070679_100541536 3300005530 Bacteria 1108
47 Ga0070697_100114876 3300005536 Bacteria 2247
48 Ga0070697_100405677 3300005536 Bacteria 1183
49 Ga0070697_100733860 3300005536 Bacteria 872
50 Ga0070672_100093510 3300005543 Bacteria 2429
51 Ga0070686_100024449 3300005544 Bacteria 3621
52 Ga0070695_100001405 3300005545 Bacteria 13335
53 Ga0070695_100055889 3300005545 Bacteria 2545
54 Ga0070696_100009836 3300005546 Bacteria 6394
55 Ga0070696_100263307 3300005546 Bacteria 1308
56 Ga0070696_100355523 3300005546 Bacteria 1135
57 Ga0070693_100698402 3300005547 Bacteria 742
58 Ga0070704_100015169 3300005549 Bacteria 4834
59 Ga0070704_100165481 3300005549 Bacteria 1753
60 Ga0070704_100400239 3300005549 Bacteria 1171
61 Ga0070664_101718756 3300005564 Unclassified 595
62 Ga0068857_100062186 3300005577 Archaea 3319
63 Ga0070702_100275895 3300005615 Bacteria 1152
64 Ga0068852_101093768 3300005616 Unclassified 817
65 Ga0068859_100620774 3300005617 Unclassified 1174
66 Ga0068866_10999331 3300005718 Unclassified 594
67 Ga0068861_100009018 3300005719 Bacteria 6876
68 Ga0068870_10049711 3300005840 Bacteria 2213
69 Ga0068870_10415254 3300005840 Unclassified 879
70 Ga0068870_10921447 3300005840 Bacteria 618
71 Ga0068860_100489467 3300005843 Bacteria 1227
72 Ga0068862_100003550 3300005844 Bacteria 13356
73 Ga0068862_100041851 3300005844 Bacteria 3900
74 Ga0081455_10003239 3300005937 Bacteria 18862
75 Ga0081540_1172606 3300005983 Unclassified 821
76 Ga0070716_100281557 3300006173 Bacteria 1148
77 Ga0075428_100453127 3300006844 Bacteria 1374
78 Ga0075429_100085723 3300006880 Bacteria 2745
79 Ga0075429_100903363 3300006880 Bacteria 773
80 Ga0097620_100620750 3300006931 Unclassified 1174
81 Ga0099794_10046605 3300007265 Bacteria 2077
82 Ga0105240_11829721 3300009093 Bacteria 632
83 Ga0111539_10000485 3300009094 Bacteria 50343
84 Ga0111539_10031987 3300009094 Bacteria 6392
85 Ga0111539_10587722 3300009094 Bacteria 1297
86 Ga0111539_10643268 3300009094 Bacteria 1235
87 Ga0105245_10386372 3300009098 Unclassified 1395
88 Ga0114129_10100120 3300009147 Bacteria 4010
89 Ga0114129_10317451 3300009147 Bacteria 2072
90 Ga0114129_11706561 3300009147 Unclassified 768
91 Ga0105243_10006374 3300009148 Bacteria 9115
92 Ga0105243_11025608 3300009148 Unclassified 829
93 Ga0105241_10039479 3300009174 Bacteria 3561
94 Ga0105242_10190338 3300009176 Bacteria 1816
95 Ga0105238_12282825 3300009551 Bacteria 576
96 Ga0105249_10000578 3300009553 Bacteria 33622
97 Ga0105239_10059533 3300010375 Bacteria 4192
98 Ga0105246_11050856 3300011119 Unclassified 740
99 Ga0157378_10256491 3300013297 Bacteria 1676
100 Ga0157378_10420451 3300013297 Bacteria 1321
101 Ga0157378_10763071 3300013297 Unclassified 991
102 Ga0157378_12305042 3300013297 Bacteria 590
103 Ga0163162_10033818 3300013306 Bacteria 5082
104 Ga0163162_10427319 3300013306 Bacteria 1457
105 Ga0157375_10022876 3300013308 Bacteria 5759
106 Ga0157380_10604735 3300014326 Unclassified 1085
107 Ga0157377_11147549 3300014745 Unclassified 598
108 Ga0157379_10311704 3300014968 Bacteria 1435
109 Ga0207653_10004354 3300025885 Bacteria 4445
110 Ga0207645_10071729 3300025907 Bacteria 2217
111 Ga0207643_10016081 3300025908 Bacteria 4077
112 Ga0207643_10688017 3300025908 Bacteria 661
113 Ga0207643_11079327 3300025908 Unclassified 518
114 Ga0207684_10178993 3300025910 Bacteria 1828
115 Ga0207684_10770376 3300025910 Bacteria 815
116 Ga0207654_10174174 3300025911 Unclassified 1399
117 Ga0207693_10004450 3300025915 Bacteria 11842
118 Ga0207663_10891887 3300025916 Unclassified 711
119 Ga0207660_10015610 3300025917 Bacteria 5016
120 Ga0207660_11558643 3300025917 Archaea 533
121 Ga0207646_10042052 3300025922 Bacteria 4106
122 Ga0207646_10075417 3300025922 Unclassified 3013
123 Ga0207646_10254249 3300025922 Archaea 1588
124 Ga0207646_10377011 3300025922 Unclassified 1281
125 Ga0207681_10108316 3300025923 Bacteria 2016
126 Ga0207694_10632574 3300025924 Bacteria 901
127 Ga0207700_10000390 3300025928 Bacteria 25598
128 Ga0207644_11276533 3300025931 Bacteria 617
129 Ga0207686_10094567 3300025934 Bacteria 1981
130 Ga0207686_10314379 3300025934 Bacteria 1168
131 Ga0207709_10055215 3300025935 Bacteria 2453
132 Ga0207669_10644350 3300025937 Bacteria 866
133 Ga0207665_10035148 3300025939 Plasmid 3325
134 Ga0207691_10126567 3300025940 Bacteria 2260
135 Ga0207711_10088458 3300025941 Bacteria 2719
136 Ga0207689_10007972 3300025942 Bacteria 9252
137 Ga0207689_10091425 3300025942 Bacteria 2500
138 Ga0207651_10478662 3300025960 Bacteria 1073
139 Ga0207712_10006906 3300025961 Bacteria 7165
140 Ga0207668_10147080 3300025972 Bacteria 1819
141 Ga0207658_11958224 3300025986 Bacteria 533
142 Ga0207678_11417336 3300026067 Unclassified 614
143 Ga0207708_11996051 3300026075 Unclassified 508
144 Ga0207648_10525278 3300026089 Bacteria 1085
145 Ga0207648_11344195 3300026089 Unclassified 671
146 Ga0207674_10012029 3300026116 Bacteria 9695
147 Ga0207675_100002770 3300026118 Bacteria 17213
148 Ga0207675_101101261 3300026118 Bacteria 814
149 Ga0207683_10279860 3300026121 Unclassified 1524
150 Ga0209588_1032904 3300027671 Bacteria 1662
151 Ga0207428_10265896 3300027907 Bacteria 1276
152 Ga0268265_10177408 3300028380 Bacteria 1827
153 Ga0268265_10300772 3300028380 Bacteria 1444
154 Ga0268264_10290709 3300028381 Bacteria 1535
155 Ga0307513_10145272 3300031456 Bacteria 2291
156 Ga0307513_10789302 3300031456 Unclassified 655
157 Ga0307408_100004836 3300031548 Bacteria 9073
158 Ga0307408_100175486 3300031548 Bacteria 1714
159 Ga0307508_10450315 3300031616 Bacteria 880
160 Ga0307406_10066642 3300031901 Bacteria 2344
161 Ga0307406_11574308 3300031901 Unclassified 580
162 Ga0307412_10145669 3300031911 Bacteria 1740
163 Ga0307412_10175009 3300031911 Bacteria 1608
164 Ga0307409_100283453 3300031995 Unclassified 1533
165 Ga0307409_102211144 3300031995 Unclassified 579
166 Ga0307416_100026116 3300032002 Bacteria 4297
167 Ga0307416_100070001 3300032002 Bacteria 2906
168 Ga0307416_100199257 3300032002 Bacteria 1898
169 Ga0307414_10062402 3300032004 Bacteria 2644
170 Ga0307411_10012869 3300032005 Bacteria 4587
171 Ga0307411_10197843 3300032005 Bacteria 1541
172 Ga0307411_10456369 3300032005 Bacteria 1070
173 Ga0307415_100254270 3300032126 Bacteria 1429
174 Ga0373948_0029961 3300034817 Bacteria 1092
175 Ga0373948_0091063 3300034817 Unclassified 708
176 Ga0373940_0006599 3300035088 Bacteria 2582
177 Ga0373951_0041786 3300035091 Unclassified 1108
178 Ga0373932_0002099 3300035112 Bacteria 5183
179 Ga0373939_0025463 3300035114 Unclassified 1659
180 Ga0373941_0141186 3300035115 Unclassified 876
181 Ga0373942_0309217 3300035207 Unclassified 550
182 Ga0373962_0104995 3300035242 Bacteria 885
183 Ga0316574_0038493 3300035398 Bacteria 2936
184 Ga0316574_0053605 3300035398 Bacteria 2518
185 Ga0373931_0033532 3300035691 Bacteria 2661
186 Ga0395905_0973902 3300037471 Unclassified 751
187 Ga0439448_0102933 3300042005 Bacteria 972
188 Ga0439455_0034911 3300042012 Bacteria 1267
189 Ga0439458_0206442 3300042157 Bacteria 538
190 Ga0439435_0224385 3300042436 Bacteria 626
191 Ga0439460_0357637 3300042461 Unclassified 515
192 Ga0451577_0932522 3300042876 Bacteria 781
193 Ga0453683_1190841 3300044673 Unclassified 510
194 Ga0451576_0051319 3300045051 Bacteria 4324
195 Ga0451576_0173695 3300045051 Bacteria 2249
196 Ga0495638_0003354 3300046460 Bacteria 12631
197 Ga0495584_0056004 3300046491 Bacteria 1984
198 Ga0495607_0271669 3300046501 Bacteria 808
199 Ga0495583_0060324 3300046506 Bacteria 1696
200 Ga0495609_0066192 3300046538 Unclassified 1592
201 Ga0495622_0028131 3300046557 Bacteria 2624
202 Ga0495659_0076645 3300046664 Unclassified 1262
203 Ga0495661_0549414 3300046665 Unclassified 546
204 Ga0495593_0442162 3300047673 Unclassified 651
205 Ga0496102_0366700 3300048905 Bacteria 1356
206 Ga0496102_0619020 3300048905 Bacteria 1006
207 Ga0496102_0730128 3300048905 Bacteria 913
208 Ga0496106_0636552 3300048909 Bacteria 853
209 Ga0496107_0342716 3300048910 Bacteria 1112
210 Ga0496112_0508117 3300048915 Bacteria 1140
211 Ga0496125_0029939 3300048928 Bacteria 4880
212 Ga0501073_0540139 3300049589 Unclassified 806
213 Ga0501075_0237013 3300049591 Bacteria 1391
214 Ga0501247_025129 3300049677 Unclassified 791
215 Ga0501250_088520 3300049680 Unclassified 536
216 Ga0501270_034882 3300049767 Unclassified 850
217 nmdc:mga05p37_152870_c2 3300050507 Bacteria 1709
218 nmdc:mga05p37_186744_c1 3300050507 Bacteria 2520
219 nmdc:mga09592_268901_c1 3300050508 Bacteria 1478
220 nmdc:mga09592_541691_c1 3300050508 Bacteria 1000
221 nmdc:mga0qj67_4622_c1 3300050509 Bacteria 9988
222 nmdc:mga06r32_1377452_c1 3300050510 Bacteria 648
223 nmdc:mga06r32_272599_c1 3300050510 Bacteria 1680
224 nmdc:mga08y16_1026401_c1 3300050511 Bacteria 803
225 nmdc:mga08y16_274409_c1 3300050511 Bacteria 1740
226 Ga0501084_1041439 3300054114 Unclassified 687
227 2513588974 2513237087 Bacteria 5817514
228 Ga0105249_10050928
229 Ga0065707_10262391
230 Ga0065707_10288977
231 Ga0070676_10074288
232 Ga0068869_100009092
233 Ga0068869_100087848
234 Ga0070680_101333504
235 Ga0068868_101524293
236 Ga0070691_10010086
237 Ga0070691_10757575
238 Ga0070692_10063056
239 Ga0070668_100082104
240 Ga0070669_100011625
241 Ga0070669_100350427
242 Ga0070669_100587907
243 Ga0070674_100640878
244 Ga0070673_101486525
245 Ga0070659_100025053
246 Ga0070713_100000314
247 Ga0070701_10000168
248 Ga0070701_10751727
249 Ga0070711_100376155
250 Ga0070705_100024766
251 Ga0070705_100520455
252 Ga0070700_100262081
253 Ga0070694_100003697
254 Ga0070694_100059450
255 Ga0070708_100083746
256 Ga0070708_100726075
257 Ga0070663_101612533
258 Ga0068867_101708400
259 Ga0068867_102043327
260 Ga0070706_100099347
261 Ga0070706_100593195
262 Ga0070707_100145330
263 Ga0070707_100404290
264 Ga0070707_100538692
265 Ga0070707_100621780
266 Ga0070707_101121610
267 Ga0070698_100086610
268 Ga0070698_100111210
269 Ga0070698_100527107
270 Ga0070698_101060061
271 Ga0070699_100005786
272 Ga0070699_101282360
273 Ga0070679_100541536
274 Ga0070697_100114876
275 Ga0070697_100405677
276 Ga0070697_100733860
277 Ga0070672_100093510
278 Ga0070686_100024449
279 Ga0070695_100001405
280 Ga0070695_100055889
281 Ga0070696_100009836
282 Ga0070696_100263307
283 Ga0070696_100355523
284 Ga0070693_100698402
285 Ga0070704_100015169
286 Ga0070704_100165481
287 Ga0070704_100400239
288 Ga0070664_101718756
289 Ga0068857_100062186
290 Ga0070702_100275895
291 Ga0068852_101093768
292 Ga0068859_100620774
293 Ga0068866_10999331
294 Ga0068861_100009018
295 Ga0068870_10049711
296 Ga0068870_10415254
297 Ga0068870_10921447
298 Ga0068860_100489467
299 Ga0068862_100003550
300 Ga0068862_100041851
301 Ga0081455_10003239
302 Ga0081540_1172606
303 Ga0070716_100281557
304 Ga0075428_100453127
305 Ga0075429_100085723
306 Ga0075429_100903363
307 Ga0097620_100620750
308 Ga0099794_10046605
309 Ga0105240_11829721
310 Ga0111539_10000485
311 Ga0111539_10031987
312 Ga0111539_10587722
313 Ga0111539_10643268
314 Ga0105245_10386372
315 Ga0114129_10100120
316 Ga0114129_10317451
317 Ga0114129_11706561
318 Ga0105243_10006374
319 Ga0105243_11025608
320 Ga0105241_10039479
321 Ga0105242_10190338
322 Ga0105238_12282825
323 Ga0105249_10000578
324 Ga0105239_10059533
325 Ga0105246_11050856
326 Ga0157378_10256491
327 Ga0157378_10420451
328 Ga0157378_10763071
329 Ga0157378_12305042
330 Ga0163162_10033818
331 Ga0163162_10427319
332 Ga0157375_10022876
333 Ga0157380_10604735
334 Ga0157377_11147549
335 Ga0157379_10311704
336 Ga0207653_10004354
337 Ga0207645_10071729
338 Ga0207643_10016081
339 Ga0207643_10688017
340 Ga0207643_11079327
341 Ga0207684_10178993
342 Ga0207684_10770376
343 Ga0207654_10174174
344 Ga0207693_10004450
345 Ga0207663_10891887
346 Ga0207660_10015610
347 Ga0207660_11558643
348 Ga0207646_10042052
349 Ga0207646_10075417
350 Ga0207646_10254249
351 Ga0207646_10377011
352 Ga0207681_10108316
353 Ga0207694_10632574
354 Ga0207700_10000390
355 Ga0207644_11276533
356 Ga0207686_10094567
357 Ga0207686_10314379
358 Ga0207709_10055215
359 Ga0207669_10644350
360 Ga0207665_10035148
361 Ga0207691_10126567
362 Ga0207711_10088458
363 Ga0207689_10007972
364 Ga0207689_10091425
365 Ga0207651_10478662
366 Ga0207712_10006906
367 Ga0207668_10147080
368 Ga0207658_11958224
369 Ga0207678_11417336
370 Ga0207708_11996051
371 Ga0207648_10525278
372 Ga0207648_11344195
373 Ga0207674_10012029
374 Ga0207675_100002770
375 Ga0207675_101101261
376 Ga0207683_10279860
377 Ga0209588_1032904
378 Ga0207428_10265896
379 Ga0268265_10177408
380 Ga0268265_10300772
381 Ga0268264_10290709
382 Ga0307513_10145272
383 Ga0307513_10789302
384 Ga0307408_100004836
385 Ga0307408_100175486
386 Ga0307508_10450315
387 Ga0307406_10066642
388 Ga0307406_11574308
389 Ga0307412_10145669
390 Ga0307412_10175009
391 Ga0307409_100283453
392 Ga0307409_102211144
393 Ga0307416_100026116
394 Ga0307416_100070001
395 Ga0307416_100199257
396 Ga0307414_10062402
397 Ga0307411_10012869
398 Ga0307411_10197843
399 Ga0307411_10456369
400 Ga0307415_100254270
401 Ga0373948_0029961
402 Ga0373948_0091063
403 Ga0373940_0006599
404 Ga0373951_0041786
405 Ga0373932_0002099
406 Ga0373939_0025463
407 Ga0373941_0141186
408 Ga0373942_0309217
409 Ga0373962_0104995
410 Ga0316574_0038493
411 Ga0316574_0053605
412 Ga0373931_0033532
413 Ga0395905_0973902
414 Ga0439448_0102933
415 Ga0439455_0034911
416 Ga0439458_0206442
417 Ga0439435_0224385
418 Ga0439460_0357637
419 Ga0451577_0932522
420 Ga0453683_1190841
421 Ga0451576_0051319
422 Ga0451576_0173695
423 Ga0495638_0003354
424 Ga0495584_0056004
425 Ga0495607_0271669
426 Ga0495583_0060324
427 Ga0495609_0066192
428 Ga0495622_0028131
429 Ga0495659_0076645
430 Ga0495661_0549414
431 Ga0495593_0442162
432 Ga0496102_0366700
433 Ga0496102_0619020
434 Ga0496102_0730128
435 Ga0496106_0636552
436 Ga0496107_0342716
437 Ga0496112_0508117
438 Ga0496125_0029939
439 Ga0501073_0540139
440 Ga0501075_0237013
441 Ga0501247_025129
442 Ga0501250_088520
443 Ga0501270_034882
444 nmdc:mga05p37_152870_c2
445 nmdc:mga05p37_186744_c1
446 nmdc:mga09592_268901_c1
447 nmdc:mga09592_541691_c1
448 nmdc:mga0qj67_4622_c1
449 nmdc:mga06r32_1377452_c1
450 nmdc:mga06r32_272599_c1
451 nmdc:mga08y16_1026401_c1
452 nmdc:mga08y16_274409_c1
453 Ga0501084_1041439
454 2513588974

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06094

GGACT

Gamma-glutamyl cyclotransferase, AIG2-like

16

129

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
2g0q-assembly1.cif.gz_A solution structure of at5g39720.1 from arabidopsis thaliana 0.8016 2 113
4ist-assembly1.cif.gz_B s177a kluyveromyces lactis allophanate hydrolase 0.78 2 109
5i8i-assembly2.cif.gz_D crystal structure of the k. lactis urea amidolyase 0.7796 2 109
4iss-assembly1.cif.gz_B semet-substituted kluyveromyces lactis allophanate hydrolase 0.7791 2 109
1v30-assembly1.cif.gz_A crystal structure of uncharacterized protein ph0828 from pyrococcus horikoshii 0.7761 1 109
ID Description Score Start End Superfamily
af_Q9MBH1_1_115_3.10.490.10 Alpha Beta;Roll;Hypothetical upf0131 protein ytfp;Gamma-glutamyl cyclotransferase-like 0.8275 2 113 3.10.490.10
af_A8MRP2_2_115_3.10.490.10 Alpha Beta;Roll;Hypothetical upf0131 protein ytfp;Gamma-glutamyl cyclotransferase-like 0.8177 2 111 3.10.490.10
af_Q18596_14_185_3.10.490.10 Alpha Beta;Roll;Hypothetical upf0131 protein ytfp;Gamma-glutamyl cyclotransferase-like 0.799 3 110 3.10.490.10
af_I6XWK6_2_145_3.10.490.10 Alpha Beta;Roll;Hypothetical upf0131 protein ytfp;Gamma-glutamyl cyclotransferase-like 0.7949 2 110 3.10.490.10
4issB03 Alpha Beta;Roll;Hypothetical upf0131 protein ytfp;Gamma-glutamyl cyclotransferase-like 0.7774 2 109 3.10.490.10
ID Description Score Start End GO Terms
AF-A0A7W4B6C8-F1-model_v4 Gamma-glutamylcyclotransferase 0.9809 1 111 GO:0016740
AF-A0A1H9MP40-F1-model_v4 Gamma-glutamyl cyclotransferase, AIG2-like 0.9809 2 110 GO:0016740
AF-A0A350QHD2-F1-model_v4 UDP-N-acetylmuramate--alanine ligase 0.9798 1 110 GO:0016874
AF-A0A3S0VJK5-F1-model_v4 Gamma-glutamylcyclotransferase 0.977 2 111 GO:0016740
AF-A0A1W1DQU9-F1-model_v4 Gamma-glutamylcyclotransferase AIG2-like domain-containing protein 0.9742 2 110

Map