F339770

General Info

Members Datasets Scaffolds Average Seq Length
227 134 454 458

Family's Representative Sequence

Representative Sequence 3300006048|Ga0075363_100021860|Ga0075363_1000218602
Length 482
Sequence MPRTRCRSNLDDVAILEHDESDTRALTQQRFDRMTLAGGDRLPEVDLAGLPDGPTWPALVQTVALLRFRHWFHPYLHKKYGDIYTVRLLPKGRPLIFFTKPEHAKEIFAGDPEIFHAGKGNAILGPVMGEHSLLLQDGAEHKRARKLLMPAFNGHALRTYQEMVTEIARDEVAHWPTDRPFKSHDRMNVLTLEVILRVVFGVTDEKRLAALRPRVNRTVNVSPAVLMVWTIPALHRFGPWKAAVQNQMELDELMYAEIRERRTAPDLAERTDVLSRLIREGEESGDRPSERLSDTELRDQLVTLLLAGHETTATALAWSLYELGRDPELMRRTQAAADEPGPDGDAWLDAVLKESMRLHPVIPMVVRTLMKPQTVAGVDVPRGATVGPSILIAHSRPDNHPDPERFDPERFLGHNPPTNTWIPFGGGVRRCIGAGFAMMEGVAVLREVFKAVDVTAVGTDEPLVRNITSVPRHGARIEVASR

Samples

Sample ID Description Type Environment
1 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
8 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
9 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
20 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
21 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
22 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
23 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
24 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
25 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
26 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
27 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
32 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
33 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
34 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
35 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
36 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
37 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
55 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
56 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
57 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
58 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
59 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
60 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
61 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
62 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
63 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
64 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
65 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
66 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
67 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
68 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
69 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
70 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
71 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
72 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
73 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
74 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
75 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
76 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
77 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
78 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
79 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
80 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
81 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
82 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
83 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
84 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
85 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
86 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
87 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
88 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
89 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
90 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
91 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
92 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
93 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
94 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
95 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
105 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
106 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
107 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
108 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
109 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
110 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
111 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
112 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
113 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
114 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
115 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
116 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
117 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
118 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
119 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
120 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
121 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
122 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
123 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
124 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
125 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
126 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
127 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
128 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
129 2643221615 Nocardioides sp. Root224 Isolate Unclassified
130 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
131 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
132 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
133 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
134 2932398195 Dietzia sp. 2505 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.48
Metatranscriptomes 0.88
Isolates 2.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.54
Nodule 0
Rhizoplane 14.54
Rhizosphere 68.28
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075363_100021860 3300006048 Bacteria 3229
2 Ga0070658_10011470 3300005327 Bacteria 7107
3 Ga0070683_100001637 3300005329 Bacteria 17330
4 Ga0070683_100014231 3300005329 Bacteria 6954
5 Ga0070683_100096582 3300005329 Bacteria 2779
6 Ga0070683_100135575 3300005329 Bacteria 2331
7 Ga0070692_10026003 3300005345 Bacteria 2890
8 Ga0070668_100196654 3300005347 Bacteria 1654
9 Ga0070714_100003880 3300005435 Bacteria 11229
10 Ga0070663_100024519 3300005455 Bacteria 4063
11 Ga0070678_100065519 3300005456 Bacteria 2698
12 Ga0070662_100037421 3300005457 Bacteria 3441
13 Ga0070698_100020561 3300005471 Bacteria 6921
14 Ga0070679_100252425 3300005530 Bacteria 1720
15 Ga0070684_100006836 3300005535 Bacteria 8851
16 Ga0070672_100169324 3300005543 Bacteria 1816
17 Ga0070665_100000566 3300005548 Bacteria 51646
18 Ga0068857_100011484 3300005577 Bacteria 7704
19 Ga0068856_100024406 3300005614 Bacteria 5886
20 Ga0068856_100051726 3300005614 Bacteria 4050
21 Ga0068860_100007643 3300005843 Bacteria 10815
22 Ga0081455_10000021 3300005937 Bacteria 160055
23 Ga0075365_10007245 3300006038 Bacteria 6198
24 Ga0075365_10008488 3300006038 Bacteria 5840
25 Ga0075365_10018890 3300006038 Bacteria 4245
26 Ga0075365_10058177 3300006038 Bacteria 2573
27 Ga0075365_10105487 3300006038 Bacteria 1933
28 Ga0075368_10003501 3300006042 Bacteria 5250
29 Ga0075363_100041009 3300006048 Bacteria 2441
30 Ga0075364_10011211 3300006051 Bacteria 5443
31 Ga0075364_10014926 3300006051 Bacteria 4808
32 Ga0075362_10019762 3300006177 Bacteria 2806
33 Ga0075367_10007803 3300006178 Bacteria 5504
34 Ga0075367_10024831 3300006178 Bacteria 3382
35 Ga0075370_10004390 3300006353 Bacteria 6841
36 Ga0075370_10032651 3300006353 Bacteria 2911
37 Ga0105245_10009067 3300009098 Bacteria 8667
38 Ga0105243_10082679 3300009148 Bacteria 2625
39 Ga0105249_10008667 3300009553 Bacteria 8858
40 Ga0105239_10029070 3300010375 Bacteria 6076
41 Ga0105246_10004798 3300011119 Bacteria 8233
42 Ga0157369_10187709 3300013105 Bacteria 2173
43 Ga0163162_10010461 3300013306 Bacteria 9020
44 Ga0157375_10017773 3300013308 Bacteria 6429
45 Ga0157375_10354887 3300013308 Bacteria 1632
46 Ga0163163_10218436 3300014325 Bacteria 1955
47 Ga0163163_10363240 3300014325 Bacteria 1504
48 Ga0182008_10063191 3300014497 Bacteria 1824
49 Ga0157379_10007978 3300014968 Bacteria 9184
50 Ga0163161_10026795 3300017792 Bacteria 4086
51 Ga0206353_10360439 3300020082 Bacteria 6300
52 Ga0206353_11955356 3300020082 Bacteria 2245
53 Ga0207688_10010198 3300025901 Bacteria 5115
54 Ga0207660_10118912 3300025917 Bacteria 1999
55 Ga0207706_10096470 3300025933 Bacteria 2600
56 Ga0207691_10173927 3300025940 Bacteria 1884
57 Ga0207661_10028356 3300025944 Bacteria 4287
58 Ga0207679_10033482 3300025945 Bacteria 3616
59 Ga0207712_10004036 3300025961 Bacteria 9271
60 Ga0207668_10046350 3300025972 Bacteria 2970
61 Ga0207658_10082053 3300025986 Bacteria 2475
62 Ga0207678_10039552 3300026067 Bacteria 4093
63 Ga0207702_10020617 3300026078 Bacteria 5456
64 Ga0207702_10062791 3300026078 Bacteria 3174
65 Ga0207676_10071286 3300026095 Bacteria 2789
66 Ga0207674_10012912 3300026116 Bacteria 9316
67 Ga0207683_10059778 3300026121 Bacteria 3348
68 Ga0268266_10000596 3300028379 Bacteria 49462
69 Ga0268264_10000249 3300028381 Bacteria 101309
70 Ga0307513_10028299 3300031456 Bacteria 6411
71 Ga0307413_10005379 3300031824 Bacteria 5711
72 Ga0307410_10040570 3300031852 Bacteria 3064
73 Ga0307406_10029190 3300031901 Bacteria 3339
74 Ga0307412_10009722 3300031911 Bacteria 5522
75 Ga0307409_100045488 3300031995 Bacteria 3314
76 Ga0307409_100211453 3300031995 Bacteria 1743
77 Ga0307416_100142628 3300032002 Bacteria 2180
78 Ga0307415_100178453 3300032126 Bacteria 1664
79 Ga0395899_0029216 3300037312 Bacteria 4147
80 Ga0395900_0018724 3300037418 Bacteria 7062
81 Ga0395900_0294983 3300037418 Bacteria 1609
82 Ga0395898_0048447 3300037466 Bacteria 4167
83 Ga0395898_0081070 3300037466 Bacteria 3129
84 Ga0395901_0257554 3300038443 Bacteria 1817
85 Ga0439446_0012133 3300042156 Bacteria 2351
86 Ga0466972_0009820 3300044658 Bacteria 4805
87 Ga0466972_0023510 3300044658 Bacteria 3064
88 Ga0466965_0002327 3300044683 Bacteria 8034
89 Ga0466966_0028554 3300044684 Bacteria 3632
90 Ga0466966_0113550 3300044684 Bacteria 1668
91 Ga0466961_0015451 3300044693 Bacteria 4899
92 Ga0466961_0063745 3300044693 Bacteria 2342
93 Ga0466963_0071420 3300044694 Bacteria 2336
94 Ga0466963_0081505 3300044694 Bacteria 2192
95 Ga0466963_0097241 3300044694 Bacteria 2012
96 Ga0466963_0179109 3300044694 Bacteria 1479
97 Ga0466963_0201872 3300044694 Bacteria 1391
98 Ga0466964_0016839 3300044706 Bacteria 2794
99 Ga0466964_0034289 3300044706 Bacteria 2025
100 Ga0466964_0046321 3300044706 Bacteria 1772
101 Ga0466971_0024753 3300044719 Bacteria 2679
102 Ga0466971_0027776 3300044719 Bacteria 2534
103 Ga0466970_0004677 3300044765 Bacteria 6758
104 Ga0466970_0041546 3300044765 Bacteria 2444
105 Ga0466970_0069192 3300044765 Bacteria 1897
106 Ga0466957_0003592 3300044842 Bacteria 8553
107 Ga0466957_0023596 3300044842 Bacteria 3637
108 Ga0466960_0000877 3300044901 Bacteria 10629
109 Ga0466960_0012096 3300044901 Bacteria 3633
110 Ga0466960_0016402 3300044901 Bacteria 3213
111 Ga0466960_0035317 3300044901 Bacteria 2335
112 Ga0466959_0040325 3300045049 Bacteria 3449
113 Ga0466958_0035150 3300045836 Bacteria 2993
114 Ga0466958_0104588 3300045836 Bacteria 1763
115 Ga0466967_0042980 3300045976 Bacteria 3910
116 Ga0466967_0087153 3300045976 Bacteria 2830
117 Ga0466967_0131525 3300045976 Bacteria 2323
118 Ga0495641_0045415 3300046461 Bacteria 2023
119 Ga0496100_0035852 3300048903 Bacteria 3124
120 Ga0496102_0006656 3300048905 Bacteria 9877
121 Ga0496102_0013679 3300048905 Bacteria 7034
122 Ga0496102_0062361 3300048905 Bacteria 3413
123 Ga0496102_0330844 3300048905 Bacteria 1435
124 Ga0496103_0036929 3300048906 Bacteria 2993
125 Ga0496104_0018910 3300048907 Bacteria 6293
126 Ga0496105_0012371 3300048908 Bacteria 6756
127 Ga0496105_0039245 3300048908 Bacteria 3903
128 Ga0496105_0069916 3300048908 Bacteria 2902
129 Ga0496106_0040354 3300048909 Bacteria 3496
130 Ga0496106_0052183 3300048909 Bacteria 3084
131 Ga0496106_0209621 3300048909 Bacteria 1552
132 Ga0496107_0007615 3300048910 Bacteria 7476
133 Ga0496107_0080377 3300048910 Bacteria 2377
134 Ga0496108_0026634 3300048911 Bacteria 4771
135 Ga0496108_0109336 3300048911 Bacteria 2362
136 Ga0496109_0011440 3300048912 Bacteria 7630
137 Ga0496109_0171079 3300048912 Bacteria 2038
138 Ga0496110_0097783 3300048913 Bacteria 2630
139 Ga0496110_0152090 3300048913 Bacteria 2096
140 Ga0496110_0159094 3300048913 Bacteria 2047
141 Ga0496110_0181605 3300048913 Bacteria 1910
142 Ga0496111_0000541 3300048914 Bacteria 19540
143 Ga0496111_0151823 3300048914 Bacteria 1718
144 Ga0496113_0016779 3300048916 Bacteria 5066
145 Ga0496113_0029667 3300048916 Bacteria 3954
146 Ga0496114_0020092 3300048917 Bacteria 5418
147 Ga0496114_0028306 3300048917 Bacteria 4597
148 Ga0496114_0051422 3300048917 Bacteria 3430
149 Ga0496114_0195470 3300048917 Bacteria 1770
150 Ga0496115_0021296 3300048918 Bacteria 5007
151 Ga0496115_0096437 3300048918 Bacteria 2421
152 Ga0501031_0039864 3300049568 Bacteria 3066
153 Ga0501031_0101428 3300049568 Bacteria 1878
154 Ga0501031_0103295 3300049568 Bacteria 1860
155 Ga0501032_0058697 3300049569 Bacteria 2583
156 Ga0501034_0020075 3300049571 Bacteria 6823
157 Ga0501034_0052608 3300049571 Bacteria 4102
158 Ga0501036_0039354 3300049572 Bacteria 4001
159 Ga0501036_0064179 3300049572 Bacteria 3109
160 Ga0501036_0209615 3300049572 Bacteria 1638
161 Ga0501038_0011336 3300049574 Bacteria 8138
162 Ga0501039_0045852 3300049575 Bacteria 3378
163 Ga0501039_0119815 3300049575 Bacteria 2062
164 Ga0501041_0011000 3300049577 Bacteria 5343
165 Ga0501041_0116552 3300049577 Bacteria 1659
166 Ga0501042_0001961 3300049578 Bacteria 12402
167 Ga0501046_0089241 3300049580 Bacteria 2373
168 Ga0501067_0000568 3300049583 Bacteria 19972
169 Ga0501067_0006022 3300049583 Bacteria 6722
170 Ga0501067_0021245 3300049583 Bacteria 3591
171 Ga0501067_0037999 3300049583 Bacteria 2674
172 Ga0501068_0016370 3300049584 Bacteria 4274
173 Ga0501068_0033399 3300049584 Bacteria 3064
174 Ga0501068_0056427 3300049584 Bacteria 2381
175 Ga0501068_0124692 3300049584 Bacteria 1608
176 Ga0501069_0011377 3300049585 Bacteria 4718
177 Ga0501069_0025804 3300049585 Bacteria 3214
178 Ga0501069_0056792 3300049585 Bacteria 2182
179 Ga0501069_0069837 3300049585 Bacteria 1967
180 Ga0501069_0071387 3300049585 Bacteria 1946
181 Ga0501070_0007927 3300049586 Bacteria 8996
182 Ga0501070_0040376 3300049586 Bacteria 3890
183 Ga0501070_0126649 3300049586 Bacteria 2110
184 Ga0501071_0006683 3300049587 Bacteria 7495
185 Ga0501071_0008884 3300049587 Bacteria 6663
186 Ga0501072_0014172 3300049588 Bacteria 6109
187 Ga0501073_0007601 3300049589 Bacteria 8051
188 Ga0501073_0020746 3300049589 Bacteria 4739
189 Ga0501074_0000164 3300049590 Bacteria 35412
190 Ga0501074_0003629 3300049590 Bacteria 10957
191 Ga0501074_0127387 3300049590 Bacteria 1822
192 Ga0501074_0136469 3300049590 Bacteria 1755
193 Ga0501076_0065552 3300049592 Bacteria 2897
194 Ga0501079_0100081 3300049741 Bacteria 2247
195 Ga0501079_0147319 3300049741 Bacteria 1835
196 Ga0501080_0012366 3300049742 Bacteria 7823
197 Ga0501083_0002676 3300049744 Bacteria 12266
198 nmdc:mga03n38_47986_c1 3300050490 Bacteria 1893
199 nmdc:mga00v17_32769_c1 3300050491 Bacteria 3073
200 nmdc:mga00v17_33685_c1 3300050491 Bacteria 3036
201 nmdc:mga00v17_35503_c1 3300050491 Bacteria 2967
202 nmdc:mga00v17_4812_c1 3300050491 Bacteria 7067
203 nmdc:mga00v17_52172_c1 3300050491 Bacteria 2487
204 nmdc:mga00v17_6534_c1 3300050491 Bacteria 6191
205 nmdc:mga00v17_75743_c1 3300050491 Bacteria 2093
206 nmdc:mga0yw44_14603_c1 3300050492 Bacteria 4176
207 nmdc:mga0yw44_86013_c1 3300050492 Bacteria 1979
208 nmdc:mga04h51_2701_c1 3300050495 Bacteria 4225
209 nmdc:mga07m45_17728_c3 3300050496 Bacteria 2650
210 nmdc:mga07m45_23458_c1 3300050496 Bacteria 3374
211 nmdc:mga07m45_30516_c1 3300050496 Bacteria 2986
212 Ga0500644_0000544 3300053088 Bacteria 15504
213 Ga0500556_0002032 3300053104 Bacteria 7049
214 Ga0500573_0011460 3300053140 Bacteria 4964
215 Ga0500616_0003423 3300053153 Bacteria 12148
216 Ga0501084_0060416 3300054114 Bacteria 3173
217 Ga0501084_0063030 3300054114 Bacteria 3103
218 Ga0501082_0001324 3300060353 Bacteria 21681
219 Ga0501082_0025489 3300060353 Bacteria 5095
220 Ga0466962_0007534 3300061719 Bacteria 5223
221 Ga0530510_0091162 3300061734 Bacteria 2224
222 2644092890 2643221615 Bacteria 5487866
223 2644322503 2643221657 Bacteria 5490246
224 2645721077 2643221961 Bacteria 3919167
225 2855388773 2855386786 Bacteria 4752232
226 2891330905 2891326441 Bacteria 6439512
227 2932400088 2932398195 Bacteria 3847976
228 Ga0075363_100021860
229 Ga0070658_10011470
230 Ga0070683_100001637
231 Ga0070683_100014231
232 Ga0070683_100096582
233 Ga0070683_100135575
234 Ga0070692_10026003
235 Ga0070668_100196654
236 Ga0070714_100003880
237 Ga0070663_100024519
238 Ga0070678_100065519
239 Ga0070662_100037421
240 Ga0070698_100020561
241 Ga0070679_100252425
242 Ga0070684_100006836
243 Ga0070672_100169324
244 Ga0070665_100000566
245 Ga0068857_100011484
246 Ga0068856_100024406
247 Ga0068856_100051726
248 Ga0068860_100007643
249 Ga0081455_10000021
250 Ga0075365_10007245
251 Ga0075365_10008488
252 Ga0075365_10018890
253 Ga0075365_10058177
254 Ga0075365_10105487
255 Ga0075368_10003501
256 Ga0075363_100041009
257 Ga0075364_10011211
258 Ga0075364_10014926
259 Ga0075362_10019762
260 Ga0075367_10007803
261 Ga0075367_10024831
262 Ga0075370_10004390
263 Ga0075370_10032651
264 Ga0105245_10009067
265 Ga0105243_10082679
266 Ga0105249_10008667
267 Ga0105239_10029070
268 Ga0105246_10004798
269 Ga0157369_10187709
270 Ga0163162_10010461
271 Ga0157375_10017773
272 Ga0157375_10354887
273 Ga0163163_10218436
274 Ga0163163_10363240
275 Ga0182008_10063191
276 Ga0157379_10007978
277 Ga0163161_10026795
278 Ga0206353_10360439
279 Ga0206353_11955356
280 Ga0207688_10010198
281 Ga0207660_10118912
282 Ga0207706_10096470
283 Ga0207691_10173927
284 Ga0207661_10028356
285 Ga0207679_10033482
286 Ga0207712_10004036
287 Ga0207668_10046350
288 Ga0207658_10082053
289 Ga0207678_10039552
290 Ga0207702_10020617
291 Ga0207702_10062791
292 Ga0207676_10071286
293 Ga0207674_10012912
294 Ga0207683_10059778
295 Ga0268266_10000596
296 Ga0268264_10000249
297 Ga0307513_10028299
298 Ga0307413_10005379
299 Ga0307410_10040570
300 Ga0307406_10029190
301 Ga0307412_10009722
302 Ga0307409_100045488
303 Ga0307409_100211453
304 Ga0307416_100142628
305 Ga0307415_100178453
306 Ga0395899_0029216
307 Ga0395900_0018724
308 Ga0395900_0294983
309 Ga0395898_0048447
310 Ga0395898_0081070
311 Ga0395901_0257554
312 Ga0439446_0012133
313 Ga0466972_0009820
314 Ga0466972_0023510
315 Ga0466965_0002327
316 Ga0466966_0028554
317 Ga0466966_0113550
318 Ga0466961_0015451
319 Ga0466961_0063745
320 Ga0466963_0071420
321 Ga0466963_0081505
322 Ga0466963_0097241
323 Ga0466963_0179109
324 Ga0466963_0201872
325 Ga0466964_0016839
326 Ga0466964_0034289
327 Ga0466964_0046321
328 Ga0466971_0024753
329 Ga0466971_0027776
330 Ga0466970_0004677
331 Ga0466970_0041546
332 Ga0466970_0069192
333 Ga0466957_0003592
334 Ga0466957_0023596
335 Ga0466960_0000877
336 Ga0466960_0012096
337 Ga0466960_0016402
338 Ga0466960_0035317
339 Ga0466959_0040325
340 Ga0466958_0035150
341 Ga0466958_0104588
342 Ga0466967_0042980
343 Ga0466967_0087153
344 Ga0466967_0131525
345 Ga0495641_0045415
346 Ga0496100_0035852
347 Ga0496102_0006656
348 Ga0496102_0013679
349 Ga0496102_0062361
350 Ga0496102_0330844
351 Ga0496103_0036929
352 Ga0496104_0018910
353 Ga0496105_0012371
354 Ga0496105_0039245
355 Ga0496105_0069916
356 Ga0496106_0040354
357 Ga0496106_0052183
358 Ga0496106_0209621
359 Ga0496107_0007615
360 Ga0496107_0080377
361 Ga0496108_0026634
362 Ga0496108_0109336
363 Ga0496109_0011440
364 Ga0496109_0171079
365 Ga0496110_0097783
366 Ga0496110_0152090
367 Ga0496110_0159094
368 Ga0496110_0181605
369 Ga0496111_0000541
370 Ga0496111_0151823
371 Ga0496113_0016779
372 Ga0496113_0029667
373 Ga0496114_0020092
374 Ga0496114_0028306
375 Ga0496114_0051422
376 Ga0496114_0195470
377 Ga0496115_0021296
378 Ga0496115_0096437
379 Ga0501031_0039864
380 Ga0501031_0101428
381 Ga0501031_0103295
382 Ga0501032_0058697
383 Ga0501034_0020075
384 Ga0501034_0052608
385 Ga0501036_0039354
386 Ga0501036_0064179
387 Ga0501036_0209615
388 Ga0501038_0011336
389 Ga0501039_0045852
390 Ga0501039_0119815
391 Ga0501041_0011000
392 Ga0501041_0116552
393 Ga0501042_0001961
394 Ga0501046_0089241
395 Ga0501067_0000568
396 Ga0501067_0006022
397 Ga0501067_0021245
398 Ga0501067_0037999
399 Ga0501068_0016370
400 Ga0501068_0033399
401 Ga0501068_0056427
402 Ga0501068_0124692
403 Ga0501069_0011377
404 Ga0501069_0025804
405 Ga0501069_0056792
406 Ga0501069_0069837
407 Ga0501069_0071387
408 Ga0501070_0007927
409 Ga0501070_0040376
410 Ga0501070_0126649
411 Ga0501071_0006683
412 Ga0501071_0008884
413 Ga0501072_0014172
414 Ga0501073_0007601
415 Ga0501073_0020746
416 Ga0501074_0000164
417 Ga0501074_0003629
418 Ga0501074_0127387
419 Ga0501074_0136469
420 Ga0501076_0065552
421 Ga0501079_0100081
422 Ga0501079_0147319
423 Ga0501080_0012366
424 Ga0501083_0002676
425 nmdc:mga03n38_47986_c1
426 nmdc:mga00v17_32769_c1
427 nmdc:mga00v17_33685_c1
428 nmdc:mga00v17_35503_c1
429 nmdc:mga00v17_4812_c1
430 nmdc:mga00v17_52172_c1
431 nmdc:mga00v17_6534_c1
432 nmdc:mga00v17_75743_c1
433 nmdc:mga0yw44_14603_c1
434 nmdc:mga0yw44_86013_c1
435 nmdc:mga04h51_2701_c1
436 nmdc:mga07m45_17728_c3
437 nmdc:mga07m45_23458_c1
438 nmdc:mga07m45_30516_c1
439 Ga0500644_0000544
440 Ga0500556_0002032
441 Ga0500573_0011460
442 Ga0500616_0003423
443 Ga0501084_0060416
444 Ga0501084_0063030
445 Ga0501082_0001324
446 Ga0501082_0025489
447 Ga0466962_0007534
448 Ga0530510_0091162
449 2644092890
450 2644322503
451 2645721077
452 2855388773
453 2891330905
454 2932400088

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00067

p450

Cytochrome P450

51

477

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7jj1-assembly3.cif.gz_C crystal structure of the sterol 14alpha-demethylase-ferredoxin (cyp51-fx) heme domain and architectural comparison to the whole fusion protein 0.884 39 460
5esg-assembly1.cif.gz_A saccharomyces cerevisiae cyp51 (lanosterol 14-alpha demethylase) g73e mutant complexed with itraconazole 0.8743 36 459
7y98-assembly1.cif.gz_A crystal structure of cyp109b4 from bacillus sonorensis in complex with testosterone 0.8737 64 460
7wzm-assembly1.cif.gz_A crystal structure of cytochrome p450 184a1 from streptomyces avermitilis in complex with oleic acid 0.8732 39 459
5l92-assembly2.cif.gz_B the 2.1 a crystal structure of cyp109e1 from bacillus megaterium in complex with corticosterone 0.8664 64 458
ID Description Score Start End Superfamily
af_P9WPN1_18_439_1.10.630.10 Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450 0.9678 48 459 1.10.630.10
af_P9WPM9_15_443_1.10.630.10 Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450 0.9545 45 459 1.10.630.10
af_P9WPN1_18_439_1.10.630.10 Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450 0.9431 48 459 1.10.630.10
af_P9WPM5_54_475_1.10.630.10 Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450 0.9336 46 460 1.10.630.10
af_P9WPM9_15_443_1.10.630.10 Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450 0.9221 45 459 1.10.630.10
ID Description Score Start End GO Terms
AF-A0A537ZGF5-F1-model_v4 Cytochrome P450 0.9325 37 459 GO:0004497
GO:0005506
GO:0016705
GO:0020037
AF-A0A846DVT3-F1-model_v4 Cytochrome P450 0.93 99 459 GO:0004497
GO:0005506
GO:0016705
GO:0020037
AF-A0A7V9KEE8-F1-model_v4 Cytochrome P450 0.9219 305 460 GO:0004497
GO:0005506
GO:0016705
GO:0020037
AF-A0A7Z1AZ05-F1-model_v4 Cytochrome P450 0.9212 52 459 GO:0004497
GO:0005506
GO:0016705
GO:0020037
AF-U9VX36-F1-model_v4 Cytochrome p450 0.9153 38 459 GO:0004497
GO:0005506
GO:0016705
GO:0020037

Map