F339721

General Info

Members Datasets Scaffolds Average Seq Length
227 147 454 272

Family's Representative Sequence

Representative Sequence 3300005549|Ga0070704_100157578|Ga0070704_1001575782
Length 308
Sequence VSDARPVGVFDSGIGGLTVLRAVAARLPAERLVYLGDTARVPYGTKSAATVSRYASQCAGFLVESGVKALVVACNTASALAMETLHARLAPLHIPVLGVIEPGAVEACRLSRNGRVGVIGTASTIRSGAYARAIRAMRPDFTVVGAACPLFVPLAEEGWIDPDDPVVQQVALRYLAPVVAEGVDTLILGCTHYPLLRTVIERALAALSEGSSGLLPIALVDSGSAVAHDLARLLATRGLESDGAGARGPDDAPAGGTVAGTSRQAVYHVTDDPERFRDVGARFLGHILEGPHLADLTRHEAALTEENA

Samples

Sample ID Description Type Environment
1 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
65 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
88 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
91 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
92 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
93 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
94 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
95 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
96 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
97 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
98 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
99 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
100 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
101 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
102 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
103 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
104 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
105 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
106 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
107 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
109 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
110 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
115 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
116 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
117 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
118 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
119 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
120 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
121 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
122 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
123 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
124 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
125 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
126 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
127 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
128 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
129 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
132 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
133 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
134 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
136 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
137 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
138 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
139 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
140 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
141 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
142 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
143 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
144 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
145 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
146 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
147 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.88
Nodule 0
Rhizoplane 3.08
Rhizosphere 94.71
Stem 0
Stem Tuber 0
Unclassified 8.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070704_100157578 3300005549 Bacteria 1792
2 LJNas_1000829 3300000546 Bacteria 5088
3 rootH1_10034019 3300003316 Unclassified 3297
4 rootL2_10132931 3300003322 Bacteria 9449
5 Ga0070683_100519223 3300005329 Bacteria 1138
6 Ga0070670_100075116 3300005331 Bacteria 2904
7 Ga0070666_10016480 3300005335 Bacteria 4727
8 Ga0070680_100018596 3300005336 Bacteria 5493
9 Ga0068868_100013302 3300005338 Bacteria 6031
10 Ga0070667_100109509 3300005367 Bacteria 2394
11 Ga0070667_100358365 3300005367 Bacteria 1321
12 Ga0070709_10222941 3300005434 Unclassified 1345
13 Ga0070714_100014692 3300005435 Bacteria 6292
14 Ga0070714_100309168 3300005435 Unclassified 1475
15 Ga0070711_100196978 3300005439 Bacteria 1552
16 Ga0070708_100000573 3300005445 Bacteria 27608
17 Ga0070708_100004222 3300005445 Bacteria 11280
18 Ga0070708_100012316 3300005445 Bacteria 6974
19 Ga0070708_100026270 3300005445 Unclassified 4983
20 Ga0070708_100033191 3300005445 Bacteria 4484
21 Ga0070681_10162794 3300005458 Bacteria 2155
22 Ga0070706_100040747 3300005467 Bacteria 4287
23 Ga0070706_100099345 3300005467 Unclassified 2704
24 Ga0070706_100206179 3300005467 Bacteria 1836
25 Ga0070706_100560455 3300005467 Unclassified 1063
26 Ga0070707_100057968 3300005468 Bacteria 3715
27 Ga0070707_100156860 3300005468 Bacteria 2217
28 Ga0070707_100348645 3300005468 Bacteria 1438
29 Ga0070698_100000349 3300005471 Bacteria 47759
30 Ga0070698_100140799 3300005471 Bacteria 2363
31 Ga0070698_100156331 3300005471 Bacteria 2226
32 Ga0070699_100150510 3300005518 Bacteria 2058
33 Ga0070699_100223188 3300005518 Bacteria 1679
34 Ga0070697_100011967 3300005536 Bacteria 6791
35 Ga0070697_100199674 3300005536 Bacteria 1700
36 Ga0070696_100032468 3300005546 Bacteria 3581
37 Ga0070665_100189241 3300005548 Bacteria 2059
38 Ga0070704_100045970 3300005549 Bacteria 3041
39 Ga0070704_100146456 3300005549 Bacteria 1851
40 Ga0068855_100028729 3300005563 Bacteria 6654
41 Ga0068854_100325207 3300005578 Bacteria 1251
42 Ga0068852_100224568 3300005616 Bacteria 1788
43 Ga0068859_100524807 3300005617 Bacteria 1279
44 Ga0068859_100821637 3300005617 Unclassified 1016
45 Ga0068863_100235890 3300005841 Bacteria 1765
46 Ga0068863_100399226 3300005841 Bacteria 1345
47 Ga0068858_100038165 3300005842 Bacteria 4455
48 Ga0068858_100041464 3300005842 Bacteria 4267
49 Ga0068860_100123417 3300005843 Bacteria 2481
50 Ga0068860_100363241 3300005843 Bacteria 1427
51 Ga0068860_100402067 3300005843 Bacteria 1355
52 Ga0068862_100225584 3300005844 Bacteria 1698
53 Ga0081455_10002577 3300005937 Bacteria 21503
54 Ga0081540_1082024 3300005983 Bacteria 1448
55 Ga0070716_100122620 3300006173 Bacteria 1630
56 Ga0070716_100201853 3300006173 Bacteria 1322
57 Ga0097621_100002081 3300006237 Bacteria 13696
58 Ga0068871_100009130 3300006358 Bacteria 7165
59 Ga0075428_100044692 3300006844 Bacteria 4867
60 Ga0075428_100460522 3300006844 Bacteria 1362
61 Ga0075430_100356770 3300006846 Bacteria 1207
62 Ga0075431_100043696 3300006847 Bacteria 4622
63 Ga0075431_100118524 3300006847 Bacteria 2731
64 Ga0075431_100461666 3300006847 Bacteria 1264
65 Ga0075431_100481137 3300006847 Bacteria 1234
66 Ga0075431_100538003 3300006847 Bacteria 1156
67 Ga0075433_10039618 3300006852 Bacteria 4076
68 Ga0075433_10113588 3300006852 Bacteria 2403
69 Ga0075434_100238915 3300006871 Bacteria 1837
70 Ga0075429_100718758 3300006880 Bacteria 875
71 Ga0075436_100111578 3300006914 Bacteria 1909
72 Ga0075436_100146333 3300006914 Bacteria 1662
73 Ga0097620_100524807 3300006931 Bacteria 1279
74 Ga0097620_100821732 3300006931 Unclassified 1016
75 Ga0075435_100024089 3300007076 Bacteria 4718
76 Ga0075435_100272865 3300007076 Bacteria 1443
77 Ga0105240_10001354 3300009093 Bacteria 42043
78 Ga0105240_10105421 3300009093 Bacteria 3422
79 Ga0111539_10010019 3300009094 Bacteria 11945
80 Ga0111539_10050862 3300009094 Bacteria 4937
81 Ga0114129_10305111 3300009147 Bacteria 2120
82 Ga0114129_10471251 3300009147 Bacteria 1644
83 Ga0114129_10962661 3300009147 Bacteria 1077
84 Ga0105243_10373630 3300009148 Bacteria 1316
85 Ga0105241_10078955 3300009174 Bacteria 2572
86 Ga0105242_10065307 3300009176 Bacteria 3002
87 Ga0105248_11009090 3300009177 Bacteria 940
88 Ga0105249_10357880 3300009553 Bacteria 1480
89 Ga0105239_10305540 3300010375 Bacteria 1792
90 Ga0157371_10209786 3300013102 Bacteria 1398
91 Ga0157370_10017974 3300013104 Bacteria 7119
92 Ga0157370_10083179 3300013104 Unclassified 3010
93 Ga0157369_10023379 3300013105 Bacteria 6883
94 Ga0157369_10082106 3300013105 Bacteria 3449
95 Ga0157374_10000023 3300013296 Bacteria 265247
96 Ga0157378_10002278 3300013297 Bacteria 17042
97 Ga0163162_10077660 3300013306 Bacteria 3384
98 Ga0157372_10077713 3300013307 Bacteria 3750
99 Ga0157372_10141058 3300013307 Unclassified 2776
100 Ga0163163_10101786 3300014325 Bacteria 2895
101 Ga0157379_10087809 3300014968 Bacteria 2788
102 Ga0157379_10310829 3300014968 Bacteria 1438
103 Ga0157379_10404854 3300014968 Unclassified 1255
104 Ga0157376_10000534 3300014969 Bacteria 24453
105 Ga0157376_10001034 3300014969 Bacteria 18220
106 Ga0213872_10003517 3300021361 Bacteria 8657
107 Ga0213872_10027801 3300021361 Bacteria 2595
108 Ga0213872_10037740 3300021361 Bacteria 2206
109 Ga0213871_10022801 3300021441 Bacteria 1572
110 Ga0207680_10039499 3300025903 Bacteria 2739
111 Ga0207647_10007585 3300025904 Bacteria 7821
112 Ga0207684_10085856 3300025910 Bacteria 2680
113 Ga0207684_10158552 3300025910 Bacteria 1948
114 Ga0207684_10434382 3300025910 Unclassified 1128
115 Ga0207707_10088130 3300025912 Bacteria 2711
116 Ga0207707_10467354 3300025912 Bacteria 1078
117 Ga0207695_10000540 3300025913 Bacteria 78763
118 Ga0207695_10147982 3300025913 Bacteria 2290
119 Ga0207695_10326246 3300025913 Bacteria 1424
120 Ga0207693_10108783 3300025915 Bacteria 2174
121 Ga0207663_10111239 3300025916 Bacteria 1859
122 Ga0207660_10109173 3300025917 Bacteria 2079
123 Ga0207646_10051727 3300025922 Bacteria 3675
124 Ga0207646_10135383 3300025922 Bacteria 2218
125 Ga0207646_10196465 3300025922 Bacteria 1822
126 Ga0207646_10212521 3300025922 Bacteria 1747
127 Ga0207687_10027178 3300025927 Bacteria 3838
128 Ga0207664_10007103 3300025929 Bacteria 7761
129 Ga0207664_10115606 3300025929 Unclassified 2237
130 Ga0207644_10081722 3300025931 Bacteria 2389
131 Ga0207667_10014993 3300025949 Bacteria 8815
132 Ga0207712_10113644 3300025961 Bacteria 2035
133 Ga0207668_10279400 3300025972 Bacteria 1369
134 Ga0207668_10449895 3300025972 Bacteria 1099
135 Ga0207640_10214108 3300025981 Bacteria 1470
136 Ga0207658_10071057 3300025986 Bacteria 2635
137 Ga0207658_10114176 3300025986 Bacteria 2141
138 Ga0207677_10009785 3300026023 Bacteria 5402
139 Ga0207703_10026769 3300026035 Bacteria 4543
140 Ga0207702_10030921 3300026078 Bacteria 4461
141 Ga0207641_10103047 3300026088 Bacteria 2517
142 Ga0207641_10213603 3300026088 Bacteria 1785
143 Ga0207428_10006087 3300027907 Bacteria 11157
144 Ga0268265_10220757 3300028380 Bacteria 1658
145 Ga0268264_10340497 3300028381 Bacteria 1424
146 Ga0265318_10005270 3300028577 Bacteria 6083
147 Ga0265330_10087057 3300031235 Unclassified 1343
148 Ga0265332_10004513 3300031238 Bacteria 6524
149 Ga0265332_10010182 3300031238 Bacteria 4186
150 Ga0265320_10039091 3300031240 Bacteria 2374
151 Ga0265329_10049159 3300031242 Bacteria 1344
152 Ga0265339_10000629 3300031249 Bacteria 27294
153 Ga0265331_10020916 3300031250 Bacteria 3353
154 Ga0265316_10002599 3300031344 Bacteria 18635
155 Ga0265313_10036546 3300031595 Bacteria 2465
156 Ga0265314_10000716 3300031711 Bacteria 40092
157 Ga0265314_10076679 3300031711 Bacteria 2220
158 Ga0265342_10007410 3300031712 Bacteria 8034
159 Ga0265342_10025830 3300031712 Bacteria 3687
160 Ga0373926_0016447 3300035083 Bacteria 2530
161 Ga0373934_0057660 3300035086 Bacteria 1545
162 Ga0373923_0026319 3300035111 Bacteria 2314
163 Ga0373954_0055413 3300035118 Bacteria 1865
164 Ga0373956_0016305 3300035119 Bacteria 3119
165 Ga0373956_0043029 3300035119 Bacteria 2010
166 Ga0373956_0179512 3300035119 Unclassified 1001
167 Ga0373924_0020402 3300035410 Bacteria 2576
168 Ga0373935_0142862 3300035692 Bacteria 1618
169 Ga0373927_0002982 3300035695 Bacteria 12274
170 Ga0373933_0015316 3300035724 Bacteria 4275
171 Ga0373933_0052238 3300035724 Bacteria 2445
172 Ga0373933_0136930 3300035724 Bacteria 1543
173 Ga0373947_0092846 3300035725 Bacteria 1885
174 Ga0373937_0011494 3300036401 Bacteria 7771
175 Ga0373937_0079068 3300036401 Bacteria 3039
176 Ga0373937_0388483 3300036401 Bacteria 1324
177 Ga0373925_0022638 3300037068 Bacteria 4585
178 Ga0373925_0254417 3300037068 Bacteria 1409
179 Ga0436365_1772767 3300039437 Bacteria 2483
180 Ga0436360_0111215 3300039438 Bacteria 8281
181 Ga0436360_0882824 3300039438 Bacteria 2984
182 Ga0436361_0081931 3300039447 Unclassified 4240
183 Ga0436361_0108522 3300039447 Bacteria 3530
184 Ga0436361_0248901 3300039447 Bacteria 25197
185 Ga0436361_0250329 3300039447 Bacteria 4548
186 Ga0439448_0008381 3300042005 Bacteria 3026
187 Ga0439455_0068339 3300042012 Bacteria 951
188 Ga0451577_0015504 3300042876 Bacteria 7089
189 Ga0466969_0000464 3300044656 Bacteria 22365
190 Ga0466966_0005570 3300044684 Bacteria 8279
191 Ga0466963_0069382 3300044694 Bacteria 2369
192 Ga0466963_0140231 3300044694 Bacteria 1674
193 Ga0453684_0040360 3300044712 Bacteria 6339
194 Ga0466959_0026451 3300045049 Bacteria 4300
195 Ga0451576_0080681 3300045051 Bacteria 3384
196 Ga0451576_0154093 3300045051 Bacteria 2397
197 Ga0495587_0141350 3300046536 Bacteria 1374
198 Ga0495645_0041602 3300046543 Bacteria 3351
199 Ga0495669_0112019 3300046684 Unclassified 1275
200 Ga0496100_0097961 3300048903 Bacteria 2015
201 Ga0496108_0482043 3300048911 Bacteria 1083
202 Ga0496109_0000503 3300048912 Bacteria 33473
203 Ga0496109_0161135 3300048912 Unclassified 2102
204 Ga0496112_0184742 3300048915 Unclassified 2048
205 Ga0496113_0005588 3300048916 Bacteria 7860
206 Ga0496115_0576766 3300048918 Bacteria 896
207 Ga0501039_0593019 3300049575 Bacteria 869
208 Ga0501072_0192386 3300049588 Bacteria 1627
209 Ga0501075_0125166 3300049591 Bacteria 1957
210 Ga0501077_0138064 3300049593 Bacteria 1546
211 nmdc:mga05p37_16946_c1 3300050507 Bacteria 8787
212 nmdc:mga09592_105446_c1 3300050508 Bacteria 2417
213 nmdc:mga0qj67_276192_c1 3300050509 Bacteria 1362
214 nmdc:mga06r32_1038608_c1 3300050510 Unclassified 771
215 nmdc:mga06r32_27911_c2 3300050510 Bacteria 1692
216 nmdc:mga06r32_35740_c1 3300050510 Bacteria 4688
217 nmdc:mga06r32_373124_c1 3300050510 Bacteria 1410
218 nmdc:mga06r32_581919_c1 3300050510 Bacteria 1092
219 nmdc:mga06r32_658732_c1 3300050510 Bacteria 1015
220 nmdc:mga08y16_342570_c1 3300050511 Bacteria 1537
221 nmdc:mga0rr50_20306_c1 3300050513 Bacteria 4507
222 nmdc:mga08x19_159368_c1 3300050514 Bacteria 1532
223 nmdc:mga08x19_89798_c1 3300050514 Bacteria 2027
224 nmdc:mga0a205_201227_c1 3300050515 Bacteria 1882
225 nmdc:mga0a205_52291_c2 3300050515 Bacteria 3308
226 Ga0500578_0079891 3300053086 Bacteria 2081
227 Ga0500641_0031002 3300053096 Bacteria 2106
228 Ga0070704_100157578
229 LJNas_1000829
230 rootH1_10034019
231 rootL2_10132931
232 Ga0070683_100519223
233 Ga0070670_100075116
234 Ga0070666_10016480
235 Ga0070680_100018596
236 Ga0068868_100013302
237 Ga0070667_100109509
238 Ga0070667_100358365
239 Ga0070709_10222941
240 Ga0070714_100014692
241 Ga0070714_100309168
242 Ga0070711_100196978
243 Ga0070708_100000573
244 Ga0070708_100004222
245 Ga0070708_100012316
246 Ga0070708_100026270
247 Ga0070708_100033191
248 Ga0070681_10162794
249 Ga0070706_100040747
250 Ga0070706_100099345
251 Ga0070706_100206179
252 Ga0070706_100560455
253 Ga0070707_100057968
254 Ga0070707_100156860
255 Ga0070707_100348645
256 Ga0070698_100000349
257 Ga0070698_100140799
258 Ga0070698_100156331
259 Ga0070699_100150510
260 Ga0070699_100223188
261 Ga0070697_100011967
262 Ga0070697_100199674
263 Ga0070696_100032468
264 Ga0070665_100189241
265 Ga0070704_100045970
266 Ga0070704_100146456
267 Ga0068855_100028729
268 Ga0068854_100325207
269 Ga0068852_100224568
270 Ga0068859_100524807
271 Ga0068859_100821637
272 Ga0068863_100235890
273 Ga0068863_100399226
274 Ga0068858_100038165
275 Ga0068858_100041464
276 Ga0068860_100123417
277 Ga0068860_100363241
278 Ga0068860_100402067
279 Ga0068862_100225584
280 Ga0081455_10002577
281 Ga0081540_1082024
282 Ga0070716_100122620
283 Ga0070716_100201853
284 Ga0097621_100002081
285 Ga0068871_100009130
286 Ga0075428_100044692
287 Ga0075428_100460522
288 Ga0075430_100356770
289 Ga0075431_100043696
290 Ga0075431_100118524
291 Ga0075431_100461666
292 Ga0075431_100481137
293 Ga0075431_100538003
294 Ga0075433_10039618
295 Ga0075433_10113588
296 Ga0075434_100238915
297 Ga0075429_100718758
298 Ga0075436_100111578
299 Ga0075436_100146333
300 Ga0097620_100524807
301 Ga0097620_100821732
302 Ga0075435_100024089
303 Ga0075435_100272865
304 Ga0105240_10001354
305 Ga0105240_10105421
306 Ga0111539_10010019
307 Ga0111539_10050862
308 Ga0114129_10305111
309 Ga0114129_10471251
310 Ga0114129_10962661
311 Ga0105243_10373630
312 Ga0105241_10078955
313 Ga0105242_10065307
314 Ga0105248_11009090
315 Ga0105249_10357880
316 Ga0105239_10305540
317 Ga0157371_10209786
318 Ga0157370_10017974
319 Ga0157370_10083179
320 Ga0157369_10023379
321 Ga0157369_10082106
322 Ga0157374_10000023
323 Ga0157378_10002278
324 Ga0163162_10077660
325 Ga0157372_10077713
326 Ga0157372_10141058
327 Ga0163163_10101786
328 Ga0157379_10087809
329 Ga0157379_10310829
330 Ga0157379_10404854
331 Ga0157376_10000534
332 Ga0157376_10001034
333 Ga0213872_10003517
334 Ga0213872_10027801
335 Ga0213872_10037740
336 Ga0213871_10022801
337 Ga0207680_10039499
338 Ga0207647_10007585
339 Ga0207684_10085856
340 Ga0207684_10158552
341 Ga0207684_10434382
342 Ga0207707_10088130
343 Ga0207707_10467354
344 Ga0207695_10000540
345 Ga0207695_10147982
346 Ga0207695_10326246
347 Ga0207693_10108783
348 Ga0207663_10111239
349 Ga0207660_10109173
350 Ga0207646_10051727
351 Ga0207646_10135383
352 Ga0207646_10196465
353 Ga0207646_10212521
354 Ga0207687_10027178
355 Ga0207664_10007103
356 Ga0207664_10115606
357 Ga0207644_10081722
358 Ga0207667_10014993
359 Ga0207712_10113644
360 Ga0207668_10279400
361 Ga0207668_10449895
362 Ga0207640_10214108
363 Ga0207658_10071057
364 Ga0207658_10114176
365 Ga0207677_10009785
366 Ga0207703_10026769
367 Ga0207702_10030921
368 Ga0207641_10103047
369 Ga0207641_10213603
370 Ga0207428_10006087
371 Ga0268265_10220757
372 Ga0268264_10340497
373 Ga0265318_10005270
374 Ga0265330_10087057
375 Ga0265332_10004513
376 Ga0265332_10010182
377 Ga0265320_10039091
378 Ga0265329_10049159
379 Ga0265339_10000629
380 Ga0265331_10020916
381 Ga0265316_10002599
382 Ga0265313_10036546
383 Ga0265314_10000716
384 Ga0265314_10076679
385 Ga0265342_10007410
386 Ga0265342_10025830
387 Ga0373926_0016447
388 Ga0373934_0057660
389 Ga0373923_0026319
390 Ga0373954_0055413
391 Ga0373956_0016305
392 Ga0373956_0043029
393 Ga0373956_0179512
394 Ga0373924_0020402
395 Ga0373935_0142862
396 Ga0373927_0002982
397 Ga0373933_0015316
398 Ga0373933_0052238
399 Ga0373933_0136930
400 Ga0373947_0092846
401 Ga0373937_0011494
402 Ga0373937_0079068
403 Ga0373937_0388483
404 Ga0373925_0022638
405 Ga0373925_0254417
406 Ga0436365_1772767
407 Ga0436360_0111215
408 Ga0436360_0882824
409 Ga0436361_0081931
410 Ga0436361_0108522
411 Ga0436361_0248901
412 Ga0436361_0250329
413 Ga0439448_0008381
414 Ga0439455_0068339
415 Ga0451577_0015504
416 Ga0466969_0000464
417 Ga0466966_0005570
418 Ga0466963_0069382
419 Ga0466963_0140231
420 Ga0453684_0040360
421 Ga0466959_0026451
422 Ga0451576_0080681
423 Ga0451576_0154093
424 Ga0495587_0141350
425 Ga0495645_0041602
426 Ga0495669_0112019
427 Ga0496100_0097961
428 Ga0496108_0482043
429 Ga0496109_0000503
430 Ga0496109_0161135
431 Ga0496112_0184742
432 Ga0496113_0005588
433 Ga0496115_0576766
434 Ga0501039_0593019
435 Ga0501072_0192386
436 Ga0501075_0125166
437 Ga0501077_0138064
438 nmdc:mga05p37_16946_c1
439 nmdc:mga09592_105446_c1
440 nmdc:mga0qj67_276192_c1
441 nmdc:mga06r32_1038608_c1
442 nmdc:mga06r32_27911_c2
443 nmdc:mga06r32_35740_c1
444 nmdc:mga06r32_373124_c1
445 nmdc:mga06r32_581919_c1
446 nmdc:mga06r32_658732_c1
447 nmdc:mga08y16_342570_c1
448 nmdc:mga0rr50_20306_c1
449 nmdc:mga08x19_159368_c1
450 nmdc:mga08x19_89798_c1
451 nmdc:mga0a205_201227_c1
452 nmdc:mga0a205_52291_c2
453 Ga0500578_0079891
454 Ga0500641_0031002

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01177

Asp_Glu_race

Asp/Glu/Hydantoin racemase

15

230

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vvt-assembly1.cif.gz_A glutamate racemase (muri) from e. faecalis in complex with a 9-benzyl purine inhibitor 0.9158 6 273
2w4i-assembly2.cif.gz_E crystal structure of helicobacter pylori glutamate racemase in complex with d-glutamate and an inhibitor 0.9158 7 261
2jfx-assembly1.cif.gz_A crystal structure of helicobacter pylori glutamate racemase in complex with d-glutamate 0.9123 7 261
5w1q-assembly1.cif.gz_B crystal structure of alternate isoform of glutamate racemase from helicobacter pylori bound to d-glutamate 0.9099 7 261
2dwu-assembly2.cif.gz_C crystal structure of glutamate racemase isoform race1 from bacillus anthracis 0.9091 6 273
ID Description Score Start End Superfamily
af_P9WPW9_6_95_3.40.50.1860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9459 5 95 3.40.50.1860
af_P9WPW9_6_95_3.40.50.1860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.936 5 95 3.40.50.1860
3hfrA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9267 98 217 3.40.50.1860
af_Q2FZC6_4_227_3.40.50.12500 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9161 8 231 3.40.50.12500
2jfxB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9107 7 96 3.40.50.1860
ID Description Score Start End GO Terms
AF-A0A7V1XYN3-F1-model_v4 Glutamate racemase (EC 5.1.1.3) 0.9732 1 272 GO:0008360
GO:0008881
GO:0009252
GO:0071555
AF-A0A0S8G8X2-F1-model_v4 Glutamate racemase (EC 5.1.1.3) 0.972 9 145 GO:0008360
GO:0008881
GO:0009252
GO:0071555
AF-A0A7X5DGA3-F1-model_v4 Glutamate racemase 0.9708 4 96 GO:0008881
GO:0009252
AF-A0A4Y9H3Y2-F1-model_v4 deleted 0.9681 4 96
AF-A0A7V1XYN3-F1-model_v4 Glutamate racemase (EC 5.1.1.3) 0.9623 1 272 GO:0008360
GO:0008881
GO:0009252
GO:0071555

Map