F339358

General Info

Members Datasets Scaffolds Average Seq Length
226 149 214 307

Family's Representative Sequence

Representative Sequence 3300053108|Ga0500562_000387|Ga0500562_000387_2842_3756
Length 304
Sequence MRLAFLGTPDLAVATLAALVEAGHEIACVYSQPPARRGRGQALKPSPVHAFAEDHGLTVRTPESMRDPGVIADFQALDLDAAIVVAFGQILPAAVLDAPRLGSFNLHGSLLPRWRGAAPIQRAIMAGDAETGVQVMRMTEGLDEGPVIATARLPIAPDETAGSLHDRMAVAGAALMTASLADIETGCAAETPQVEDGATYAKKLRPKETRIDWTQPASEIDRKIRGLSPFPGAWFQLGEHRVKALLSTLAEGAGEPGEVLDAALTVACGEGAIRLLRVQREGKGAQDAEVFLRGAAVAPGTTLA

Samples

Sample ID Description Type Environment
1 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
2 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
3 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
4 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
5 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
6 2842694124 Methylopila sp. R-72369 Isolate Unclassified
7 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
8 2849560528 Caulobacter zeae 410 Isolate Unclassified
9 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
10 2851153111 Caulobacter radicis 736 Isolate Unclassified
11 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
12 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
53 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
54 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
55 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
58 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
80 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
81 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
82 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
83 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
84 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
85 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
86 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
87 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
88 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
94 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
95 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
96 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
97 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
98 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
99 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
100 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
101 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
102 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
103 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
104 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
105 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
106 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
107 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
108 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
109 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
110 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
111 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
112 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
113 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
114 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
115 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
116 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
117 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
123 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
124 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
125 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
126 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
127 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
128 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
129 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
130 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
131 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
132 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
133 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
134 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
135 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
136 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
137 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
138 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
139 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
140 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
141 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
142 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
143 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
144 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
145 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
146 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
147 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
148 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
149 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.69
Metatranscriptomes 0
Isolates 5.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.14
Nodule 0
Rhizoplane 0.44
Rhizosphere 68.14
Stem 0
Stem Tuber 0
Unclassified 13.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055536_1005096 3300003781 Bacteria 6515
2 Ga0055530_10000949 3300003791 Bacteria 23707
3 Ga0055530_10005025 3300003791 Bacteria 6515
4 Ga0055531_10010421 3300003794 Bacteria 4620
5 Ga0055531_10049792 3300003794 Bacteria 1116
6 Ga0065165_1001262 3300005262 Bacteria 28613
7 Ga0070670_100000007 3300005331 Bacteria 318672
8 Ga0070680_100040330 3300005336 Bacteria 3780
9 Ga0070668_100007764 3300005347 Bacteria 7966
10 Ga0070668_100008888 3300005347 Bacteria 7460
11 Ga0070668_100017845 3300005347 Bacteria 5323
12 Ga0070668_100040646 3300005347 Bacteria 3559
13 Ga0070669_100028900 3300005353 Bacteria 3994
14 Ga0070671_100002518 3300005355 Bacteria 14197
15 Ga0070667_100000155 3300005367 Bacteria 85527
16 Ga0070667_100021236 3300005367 Bacteria 5393
17 Ga0070663_100182510 3300005455 Bacteria 1629
18 Ga0070681_10019999 3300005458 Bacteria 6708
19 Ga0070665_100001961 3300005548 Bacteria 23155
20 Ga0070665_100004749 3300005548 Bacteria 14144
21 Ga0070665_100036774 3300005548 Bacteria 4924
22 Ga0070665_100080804 3300005548 Bacteria 3256
23 Ga0068855_100069345 3300005563 Bacteria 4103
24 Ga0068855_100168574 3300005563 Bacteria 2480
25 Ga0068854_100153621 3300005578 Bacteria 1777
26 Ga0068856_100065818 3300005614 Bacteria 3581
27 Ga0068856_100136019 3300005614 Bacteria 2463
28 Ga0068852_100022836 3300005616 Bacteria 5024
29 Ga0068859_100000230 3300005617 Bacteria 55064
30 Ga0068859_100014488 3300005617 Bacteria 7916
31 Ga0068859_100300635 3300005617 Bacteria 1698
32 Ga0068864_100000067 3300005618 Bacteria 115834
33 Ga0068864_100000128 3300005618 Bacteria 73813
34 Ga0068864_100085404 3300005618 Bacteria 2775
35 Ga0068861_100082218 3300005719 Bacteria 2523
36 Ga0068863_100000237 3300005841 Bacteria 58657
37 Ga0068863_100000360 3300005841 Bacteria 46300
38 Ga0068863_100004709 3300005841 Bacteria 13447
39 Ga0068858_100000020 3300005842 Bacteria 175896
40 Ga0068858_100003515 3300005842 Bacteria 15534
41 Ga0068860_100000047 3300005843 Bacteria 213287
42 Ga0068862_100001031 3300005844 Bacteria 26791
43 Ga0068862_100010926 3300005844 Bacteria 7497
44 Ga0068862_100122701 3300005844 Bacteria 2292
45 Ga0075368_10015801 3300006042 Bacteria 2805
46 Ga0075364_10007381 3300006051 Bacteria 6525
47 Ga0075367_10028159 3300006178 Bacteria 3203
48 Ga0075369_10009336 3300006186 Bacteria 3808
49 Ga0075369_10029537 3300006186 Bacteria 2303
50 Ga0075366_10055750 3300006195 Bacteria 2347
51 Ga0075370_10131856 3300006353 Bacteria 1458
52 Ga0097620_100000230 3300006931 Bacteria 55064
53 Ga0097620_100014488 3300006931 Bacteria 7916
54 Ga0097620_100300622 3300006931 Bacteria 1698
55 Ga0105240_10062702 3300009093 Bacteria 4627
56 Ga0105240_10219343 3300009093 Bacteria 2217
57 Ga0105242_10437768 3300009176 Bacteria 1229
58 Ga0105248_10004051 3300009177 Bacteria 16197
59 Ga0105248_10104834 3300009177 Bacteria 3188
60 Ga0105238_10224737 3300009551 Bacteria 1854
61 Ga0105249_10001758 3300009553 Bacteria 18894
62 Ga0163162_10075545 3300013306 Bacteria 3430
63 Ga0163162_10280332 3300013306 Bacteria 1799
64 Ga0163163_10010857 3300014325 Bacteria 8225
65 Ga0163163_10021531 3300014325 Bacteria 6086
66 Ga0157379_10010392 3300014968 Bacteria 8109
67 Ga0213874_10029191 3300021377 Bacteria 1581
68 Ga0213876_10000081 3300021384 Bacteria 108997
69 Ga0213876_10162915 3300021384 Bacteria 1186
70 Ga0209026_1004839 3300025250 Bacteria 3830
71 Ga0209148_1012004 3300025254 Bacteria 1595
72 Ga0209676_1000253 3300025292 Bacteria 113412
73 Ga0209758_1000894 3300025297 Bacteria 40579
74 Ga0209050_1000173 3300025298 Bacteria 149800
75 Ga0209050_1000649 3300025298 Bacteria 53856
76 Ga0209051_1005367 3300025303 Bacteria 7521
77 Ga0209257_1000196 3300025304 Bacteria 149656
78 Ga0209257_1014332 3300025304 Bacteria 3412
79 Ga0207695_10007614 3300025913 Bacteria 13721
80 Ga0207695_10033508 3300025913 Bacteria 5600
81 Ga0207695_10073887 3300025913 Bacteria 3472
82 Ga0207681_10024548 3300025923 Bacteria 3870
83 Ga0207694_10142515 3300025924 Bacteria 1928
84 Ga0207650_10000030 3300025925 Bacteria 235824
85 Ga0207644_10001249 3300025931 Bacteria 16358
86 Ga0207711_10000669 3300025941 Bacteria 34078
87 Ga0207711_10002365 3300025941 Bacteria 16890
88 Ga0207711_10005325 3300025941 Bacteria 10911
89 Ga0207711_10111079 3300025941 Bacteria 2438
90 Ga0207667_10053212 3300025949 Bacteria 4260
91 Ga0207712_10000758 3300025961 Bacteria 24361
92 Ga0207712_10260873 3300025961 Bacteria 1405
93 Ga0207668_10000010 3300025972 Bacteria 185249
94 Ga0207668_10000108 3300025972 Bacteria 59119
95 Ga0207668_10004753 3300025972 Bacteria 7993
96 Ga0207668_10010421 3300025972 Bacteria 5614
97 Ga0207668_10012514 3300025972 Bacteria 5196
98 Ga0207668_10048054 3300025972 Bacteria 2926
99 Ga0207640_10105978 3300025981 Bacteria 1982
100 Ga0207658_10000265 3300025986 Bacteria 55108
101 Ga0207658_10014054 3300025986 Bacteria 5480
102 Ga0207658_10076554 3300025986 Bacteria 2549
103 Ga0207658_10181588 3300025986 Bacteria 1742
104 Ga0207703_10000082 3300026035 Bacteria 110579
105 Ga0207641_10000007 3300026088 Bacteria 441443
106 Ga0207641_10001651 3300026088 Bacteria 21777
107 Ga0207641_10009307 3300026088 Bacteria 8103
108 Ga0207676_10000183 3300026095 Bacteria 55220
109 Ga0207676_10000241 3300026095 Bacteria 47707
110 Ga0207676_10093870 3300026095 Bacteria 2471
111 Ga0207676_10219587 3300026095 Bacteria 1692
112 Ga0207675_100096375 3300026118 Bacteria 2785
113 Ga0268266_10001015 3300028379 Bacteria 35377
114 Ga0268266_10005366 3300028379 Bacteria 11979
115 Ga0268266_10014766 3300028379 Bacteria 6709
116 Ga0268265_10006429 3300028380 Bacteria 7965
117 Ga0268265_10023439 3300028380 Bacteria 4351
118 Ga0268265_10040484 3300028380 Bacteria 3442
119 Ga0268265_10043415 3300028380 Bacteria 3342
120 Ga0268264_10000110 3300028381 Bacteria 206663
121 Ga0268264_10000125 3300028381 Bacteria 186416
122 Ga0265334_10044802 3300028573 Bacteria 1716
123 Ga0307517_10001402 3300028786 Bacteria 40531
124 Ga0307517_10029106 3300028786 Bacteria 6543
125 Ga0307517_10126564 3300028786 Bacteria 1861
126 Ga0265327_10002651 3300031251 Bacteria 18419
127 Ga0265327_10038029 3300031251 Bacteria 2629
128 Ga0307513_10003700 3300031456 Bacteria 20671
129 Ga0307513_10010991 3300031456 Bacteria 11295
130 Ga0307513_10013112 3300031456 Bacteria 10189
131 Ga0307516_10000001 3300031730 Bacteria 510338
132 Ga0373945_0115472 3300035116 Bacteria 1063
133 Ga0373943_0098197 3300035170 Bacteria 1527
134 Ga0373946_0015968 3300035171 Bacteria 2855
135 Ga0373927_0000472 3300035695 Bacteria 30834
136 Ga0373925_0000003 3300037068 Bacteria 362401
137 Ga0373925_0140744 3300037068 Bacteria 1888
138 Ga0395899_0076675 3300037312 Bacteria 2440
139 Ga0395900_0022855 3300037418 Bacteria 6398
140 Ga0395900_0269710 3300037418 Bacteria 1697
141 Ga0395898_0124062 3300037466 Bacteria 2474
142 Ga0395905_0009683 3300037471 Bacteria 9406
143 Ga0395905_0053948 3300037471 Bacteria 3762
144 Ga0395905_0062286 3300037471 Bacteria 3489
145 Ga0436364_0882847 3300037853 Bacteria 3537
146 Ga0395901_0137277 3300038443 Bacteria 2570
147 Ga0436365_0187494 3300039437 Bacteria 67801
148 Ga0436365_0195056 3300039437 Bacteria 3279
149 Ga0436363_0886336 3300039450 Bacteria 2087
150 Ga0439459_0015715 3300042438 Bacteria 1390
151 Ga0466969_0038947 3300044656 Bacteria 2390
152 Ga0466968_0043668 3300044735 Bacteria 1899
153 Ga0466959_0016077 3300045049 Bacteria 5463
154 Ga0495650_0066665 3300046471 Bacteria 1424
155 Ga0495643_0006929 3300046522 Bacteria 7373
156 Ga0495597_0020236 3300046542 Bacteria 3101
157 Ga0495668_0000291 3300046616 Bacteria 68802
158 Ga0495668_0017233 3300046616 Bacteria 4193
159 Ga0495668_0025207 3300046616 Bacteria 3381
160 Ga0495668_0054031 3300046616 Bacteria 2220
161 Ga0495669_0000044 3300046684 Bacteria 85633
162 Ga0495669_0079732 3300046684 Bacteria 1501
163 Ga0495677_0017589 3300047445 Bacteria 2591
164 Ga0495685_057766 3300047447 Bacteria 1310
165 Ga0495686_0010570 3300047472 Bacteria 6558
166 Ga0495602_0170140 3300048088 Bacteria 1692
167 Ga0496115_0141134 3300048918 Bacteria 1988
168 Ga0496117_0059406 3300048920 Bacteria 2641
169 Ga0496118_0072565 3300048921 Bacteria 2471
170 Ga0496119_0055328 3300048922 Bacteria 2410
171 Ga0496121_0000035 3300048924 Bacteria 374316
172 Ga0496124_0113683 3300048927 Bacteria 2175
173 Ga0496125_0028483 3300048928 Bacteria 5044
174 Ga0501036_0106083 3300049572 Bacteria 2376
175 Ga0501038_0039953 3300049574 Bacteria 4101
176 Ga0501038_0042929 3300049574 Bacteria 3936
177 Ga0501040_0238633 3300049576 Bacteria 1295
178 Ga0501046_0017408 3300049580 Bacteria 5998
179 Ga0501047_0005131 3300049581 Bacteria 12290
180 Ga0501047_0220490 3300049581 Bacteria 1753
181 Ga0501047_0265557 3300049581 Bacteria 1563
182 Ga0501071_0140148 3300049587 Bacteria 1800
183 Ga0501072_0101152 3300049588 Bacteria 2291
184 Ga0501075_0100097 3300049591 Bacteria 2201
185 Ga0501076_0047740 3300049592 Bacteria 3385
186 Ga0501076_0280156 3300049592 Bacteria 1366
187 Ga0501077_0045269 3300049593 Bacteria 2795
188 Ga0501079_0010693 3300049741 Bacteria 6988
189 Ga0501081_0142461 3300049743 Bacteria 1718
190 nmdc:mga00v17_254_c1 3300050491 Bacteria 31422
191 nmdc:mga06z11_175849_c1 3300050494 Bacteria 1232
192 nmdc:mga04h51_18617_c1 3300050495 Bacteria 2047
193 nmdc:mga07m45_106128_c1 3300050496 Bacteria 1616
194 Ga0500635_0000133 3300053080 Bacteria 42884
195 Ga0495655_0045818 3300053083 Bacteria 1137
196 Ga0500643_016835 3300053087 Bacteria 2465
197 Ga0500583_0075225 3300053092 Bacteria 1622
198 Ga0500651_0012784 3300053093 Bacteria 5095
199 Ga0500641_0011239 3300053096 Bacteria 3248
200 Ga0500562_000387 3300053108 Bacteria 10704
201 Ga0500569_037574 3300053109 Bacteria 1400
202 Ga0500595_009594 3300053119 Bacteria 3899
203 Ga0500595_015399 3300053119 Bacteria 2871
204 Ga0500608_002907 3300053122 Bacteria 6332
205 Ga0500559_0000048 3300053136 Bacteria 93755
206 Ga0500559_0002446 3300053136 Bacteria 9612
207 Ga0500559_0023470 3300053136 Bacteria 2618
208 Ga0500590_030642 3300053148 Bacteria 2790
209 Ga0500636_0003639 3300053177 Bacteria 8694
210 Ga0500637_0019160 3300053178 Bacteria 3686
211 Ga0501084_0021975 3300054114 Bacteria 5322
212 Ga0501084_0045308 3300054114 Bacteria 3683
213 Ga0501082_0054963 3300060353 Bacteria 3431
214 Ga0530510_0027025 3300061734 Bacteria 4111

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050495 nmdc:mga04h51_18617_c1 nmdc:mga04h51_18617_c1_1195_1995 266
2 3300053096 Ga0500641_0011239 Ga0500641_0011239_723_1523 266
3 3300042438 Ga0439459_0015715 Ga0439459_0015715_555_1361 268
4 3300005347 Ga0070668_100017845 Ga0070668_1000178452 293
5 3300025972 Ga0207668_10010421 Ga0207668_100104217 293
6 3300049587 Ga0501071_0140148 Ga0501071_0140148_898_1788 296
7 3300005617 Ga0068859_100300635 Ga0068859_1003006352 299
8 3300006931 Ga0097620_100300622 Ga0097620_1003006222 299
9 3300028380 Ga0268265_10006429 Ga0268265_100064297 299
10 3300025941 Ga0207711_10000669 Ga0207711_100006696 303
11 3300048920 Ga0496117_0059406 Ga0496117_0059406_1097_2023 303
12 3300048921 Ga0496118_0072565 Ga0496118_0072565_899_1825 303
13 3300048922 Ga0496119_0055328 Ga0496119_0055328_561_1487 303
14 3300048924 Ga0496121_0000035 Ga0496121_0000035_85358_86284 303
15 3300053108 Ga0500562_000387 Ga0500562_000387_2842_3756 304
16 iso_pu_bacteria 2643221614 2644087092 304
17 iso_pu_bacteria 2643221661 2644342046 304
18 iso_pu_bacteria 2643221666 2644368333 304
19 iso_pu_bacteria 2791355048 2792461849 304
20 iso_pu_bacteria 2843744320 2843745212 304
21 iso_pu_bacteria 2849560528 2849563995 304
22 iso_pu_bacteria 2849573788 2849577627 304
23 iso_pu_bacteria 2851153111 2851157541 304
24 iso_pu_bacteria 2857504554 2857506131 304
25 iso_pu_bacteria 2889306138 2889310723 304
26 3300049574 Ga0501038_0042929 Ga0501038_0042929_2979_3896 305
27 3300049580 Ga0501046_0017408 Ga0501046_0017408_4980_5897 305
28 iso_pu_bacteria 2842694124 2842697295 306
29 3300005578 Ga0068854_100153621 Ga0068854_1001536213 307
30 3300025981 Ga0207640_10105978 Ga0207640_101059783 307
31 3300003791 Ga0055530_10000949 Ga0055530_1000094926 308
32 3300003794 Ga0055531_10010421 Ga0055531_100104215 308
33 3300005262 Ga0065165_1001262 Ga0065165_100126225 308
34 3300005331 Ga0070670_100000007 Ga0070670_100000007186 308
35 3300005336 Ga0070680_100040330 Ga0070680_1000403304 308
36 3300005347 Ga0070668_100007764 Ga0070668_1000077644 308
37 3300005347 Ga0070668_100008888 Ga0070668_1000088883 308
38 3300005347 Ga0070668_100040646 Ga0070668_1000406463 308
39 3300005353 Ga0070669_100028900 Ga0070669_1000289004 308
40 3300005355 Ga0070671_100002518 Ga0070671_10000251812 308
41 3300005367 Ga0070667_100000155 Ga0070667_10000015549 308
42 3300005367 Ga0070667_100021236 Ga0070667_1000212363 308
43 3300005455 Ga0070663_100182510 Ga0070663_1001825101 308
44 3300005458 Ga0070681_10019999 Ga0070681_100199992 308
45 3300005548 Ga0070665_100001961 Ga0070665_10000196120 308
46 3300005548 Ga0070665_100004749 Ga0070665_1000047499 308
47 3300005548 Ga0070665_100036774 Ga0070665_1000367744 308
48 3300005548 Ga0070665_100080804 Ga0070665_1000808043 308
49 3300005563 Ga0068855_100069345 Ga0068855_1000693451 308
50 3300005563 Ga0068855_100168574 Ga0068855_1001685744 308
51 3300005614 Ga0068856_100065818 Ga0068856_1000658185 308
52 3300005614 Ga0068856_100136019 Ga0068856_1001360193 308
53 3300005616 Ga0068852_100022836 Ga0068852_1000228364 308
54 3300005617 Ga0068859_100000230 Ga0068859_10000023010 308
55 3300005617 Ga0068859_100014488 Ga0068859_1000144884 308
56 3300005618 Ga0068864_100000067 Ga0068864_10000006781 308
57 3300005618 Ga0068864_100000128 Ga0068864_10000012820 308
58 3300005618 Ga0068864_100085404 Ga0068864_1000854043 308
59 3300005719 Ga0068861_100082218 Ga0068861_1000822182 308
60 3300005841 Ga0068863_100000237 Ga0068863_10000023733 308
61 3300005841 Ga0068863_100000360 Ga0068863_10000036022 308
62 3300005841 Ga0068863_100004709 Ga0068863_10000470912 308
63 3300005842 Ga0068858_100000020 Ga0068858_100000020130 308
64 3300005842 Ga0068858_100003515 Ga0068858_10000351514 308
65 3300005843 Ga0068860_100000047 Ga0068860_100000047186 308
66 3300005844 Ga0068862_100001031 Ga0068862_1000010317 308
67 3300005844 Ga0068862_100010926 Ga0068862_1000109263 308
68 3300005844 Ga0068862_100122701 Ga0068862_1001227012 308
69 3300006042 Ga0075368_10015801 Ga0075368_100158013 308
70 3300006051 Ga0075364_10007381 Ga0075364_100073815 308
71 3300006178 Ga0075367_10028159 Ga0075367_100281594 308
72 3300006186 Ga0075369_10009336 Ga0075369_100093363 308
73 3300006186 Ga0075369_10029537 Ga0075369_100295372 308
74 3300006353 Ga0075370_10131856 Ga0075370_101318562 308
75 3300006931 Ga0097620_100000230 Ga0097620_10000023010 308
76 3300006931 Ga0097620_100014488 Ga0097620_1000144887 308
77 3300009093 Ga0105240_10062702 Ga0105240_100627022 308
78 3300009093 Ga0105240_10219343 Ga0105240_102193433 308
79 3300009176 Ga0105242_10437768 Ga0105242_104377682 308
80 3300009177 Ga0105248_10004051 Ga0105248_100040514 308
81 3300009177 Ga0105248_10104834 Ga0105248_101048342 308
82 3300009551 Ga0105238_10224737 Ga0105238_102247372 308
83 3300009553 Ga0105249_10001758 Ga0105249_100017588 308
84 3300013306 Ga0163162_10075545 Ga0163162_100755454 308
85 3300013306 Ga0163162_10280332 Ga0163162_102803323 308
86 3300014325 Ga0163163_10010857 Ga0163163_100108577 308
87 3300014325 Ga0163163_10021531 Ga0163163_100215318 308
88 3300014968 Ga0157379_10010392 Ga0157379_100103925 308
89 3300021377 Ga0213874_10029191 Ga0213874_100291912 308
90 3300021384 Ga0213876_10000081 Ga0213876_1000008120 308
91 3300021384 Ga0213876_10162915 Ga0213876_101629152 308
92 3300025250 Ga0209026_1004839 Ga0209026_10048395 308
93 3300025254 Ga0209148_1012004 Ga0209148_10120042 308
94 3300025297 Ga0209758_1000894 Ga0209758_100089414 308
95 3300025298 Ga0209050_1000173 Ga0209050_100017364 308
96 3300025304 Ga0209257_1000196 Ga0209257_100019664 308
97 3300025913 Ga0207695_10007614 Ga0207695_1000761410 308
98 3300025913 Ga0207695_10033508 Ga0207695_100335085 308
99 3300025913 Ga0207695_10073887 Ga0207695_100738872 308
100 3300025923 Ga0207681_10024548 Ga0207681_100245484 308
101 3300025924 Ga0207694_10142515 Ga0207694_101425152 308
102 3300025925 Ga0207650_10000030 Ga0207650_10000030166 308
103 3300025931 Ga0207644_10001249 Ga0207644_1000124911 308
104 3300025941 Ga0207711_10002365 Ga0207711_1000236510 308
105 3300025941 Ga0207711_10005325 Ga0207711_1000532513 308
106 3300025941 Ga0207711_10111079 Ga0207711_101110792 308
107 3300025949 Ga0207667_10053212 Ga0207667_100532124 308
108 3300025961 Ga0207712_10000758 Ga0207712_100007588 308
109 3300025961 Ga0207712_10260873 Ga0207712_102608731 308
110 3300025972 Ga0207668_10000010 Ga0207668_1000001049 308
111 3300025972 Ga0207668_10000108 Ga0207668_1000010849 308
112 3300025972 Ga0207668_10004753 Ga0207668_100047534 308
113 3300025972 Ga0207668_10012514 Ga0207668_100125143 308
114 3300025972 Ga0207668_10048054 Ga0207668_100480542 308
115 3300025986 Ga0207658_10000265 Ga0207658_1000026521 308
116 3300025986 Ga0207658_10014054 Ga0207658_100140544 308
117 3300025986 Ga0207658_10076554 Ga0207658_100765543 308
118 3300025986 Ga0207658_10181588 Ga0207658_101815882 308
119 3300026035 Ga0207703_10000082 Ga0207703_1000008270 308
120 3300026088 Ga0207641_10000007 Ga0207641_1000000733 308
121 3300026088 Ga0207641_10001651 Ga0207641_1000165112 308
122 3300026088 Ga0207641_10009307 Ga0207641_100093079 308
123 3300026095 Ga0207676_10000183 Ga0207676_1000018334 308
124 3300026095 Ga0207676_10000241 Ga0207676_1000024135 308
125 3300026095 Ga0207676_10093870 Ga0207676_100938702 308
126 3300026095 Ga0207676_10219587 Ga0207676_102195872 308
127 3300026118 Ga0207675_100096375 Ga0207675_1000963753 308
128 3300028379 Ga0268266_10001015 Ga0268266_100010152 308
129 3300028379 Ga0268266_10005366 Ga0268266_100053668 308
130 3300028379 Ga0268266_10014766 Ga0268266_100147663 308
131 3300028380 Ga0268265_10023439 Ga0268265_100234394 308
132 3300028380 Ga0268265_10040484 Ga0268265_100404843 308
133 3300028380 Ga0268265_10043415 Ga0268265_100434153 308
134 3300028381 Ga0268264_10000110 Ga0268264_10000110170 308
135 3300028381 Ga0268264_10000125 Ga0268264_1000012535 308
136 3300028573 Ga0265334_10044802 Ga0265334_100448023 308
137 3300028786 Ga0307517_10001402 Ga0307517_1000140230 308
138 3300028786 Ga0307517_10029106 Ga0307517_100291064 308
139 3300028786 Ga0307517_10126564 Ga0307517_101265642 308
140 3300031251 Ga0265327_10002651 Ga0265327_100026514 308
141 3300031251 Ga0265327_10038029 Ga0265327_100380292 308
142 3300031456 Ga0307513_10003700 Ga0307513_1000370020 308
143 3300031456 Ga0307513_10010991 Ga0307513_100109917 308
144 3300031456 Ga0307513_10013112 Ga0307513_100131121 308
145 3300031730 Ga0307516_10000001 Ga0307516_10000001512 308
146 3300035116 Ga0373945_0115472 Ga0373945_0115472_52_978 308
147 3300035170 Ga0373943_0098197 Ga0373943_0098197_216_1142 308
148 3300035171 Ga0373946_0015968 Ga0373946_0015968_626_1552 308
149 3300035695 Ga0373927_0000472 Ga0373927_0000472_21771_22697 308
150 3300037068 Ga0373925_0000003 Ga0373925_0000003_41195_42121 308
151 3300037068 Ga0373925_0140744 Ga0373925_0140744_819_1745 308
152 3300037312 Ga0395899_0076675 Ga0395899_0076675_675_1661 308
153 3300037418 Ga0395900_0022855 Ga0395900_0022855_2839_3825 308
154 3300037418 Ga0395900_0269710 Ga0395900_0269710_109_1035 308
155 3300037466 Ga0395898_0124062 Ga0395898_0124062_567_1493 308
156 3300037471 Ga0395905_0009683 Ga0395905_0009683_3226_4161 308
157 3300037471 Ga0395905_0053948 Ga0395905_0053948_2054_2989 308
158 3300037471 Ga0395905_0062286 Ga0395905_0062286_70_1056 308
159 3300037853 Ga0436364_0882847 Ga0436364_0882847_2568_3494 308
160 3300038443 Ga0395901_0137277 Ga0395901_0137277_887_1813 308
161 3300039437 Ga0436365_0187494 Ga0436365_0187494_60069_60995 308
162 3300039437 Ga0436365_0195056 Ga0436365_0195056_2283_3209 308
163 3300039450 Ga0436363_0886336 Ga0436363_0886336_596_1522 308
164 3300044656 Ga0466969_0038947 Ga0466969_0038947_356_1282 308
165 3300044735 Ga0466968_0043668 Ga0466968_0043668_940_1866 308
166 3300045049 Ga0466959_0016077 Ga0466959_0016077_3466_4392 308
167 3300046471 Ga0495650_0066665 Ga0495650_0066665_33_959 308
168 3300046522 Ga0495643_0006929 Ga0495643_0006929_6336_7262 308
169 3300046542 Ga0495597_0020236 Ga0495597_0020236_1500_2426 308
170 3300046616 Ga0495668_0000291 Ga0495668_0000291_20388_21314 308
171 3300046616 Ga0495668_0017233 Ga0495668_0017233_2005_2931 308
172 3300046616 Ga0495668_0025207 Ga0495668_0025207_268_1194 308
173 3300046684 Ga0495669_0000044 Ga0495669_0000044_14565_15491 308
174 3300046684 Ga0495669_0079732 Ga0495669_0079732_284_1210 308
175 3300047445 Ga0495677_0017589 Ga0495677_0017589_1588_2514 308
176 3300047447 Ga0495685_057766 Ga0495685_057766_221_1147 308
177 3300047472 Ga0495686_0010570 Ga0495686_0010570_2473_3399 308
178 3300048088 Ga0495602_0170140 Ga0495602_0170140_401_1327 308
179 3300048927 Ga0496124_0113683 Ga0496124_0113683_444_1370 308
180 3300048928 Ga0496125_0028483 Ga0496125_0028483_4063_4989 308
181 3300049572 Ga0501036_0106083 Ga0501036_0106083_905_1831 308
182 3300049574 Ga0501038_0039953 Ga0501038_0039953_528_1454 308
183 3300049576 Ga0501040_0238633 Ga0501040_0238633_41_967 308
184 3300049581 Ga0501047_0005131 Ga0501047_0005131_1315_2241 308
185 3300049581 Ga0501047_0220490 Ga0501047_0220490_702_1628 308
186 3300049581 Ga0501047_0265557 Ga0501047_0265557_111_1037 308
187 3300049588 Ga0501072_0101152 Ga0501072_0101152_1155_2081 308
188 3300049591 Ga0501075_0100097 Ga0501075_0100097_213_1139 308
189 3300049592 Ga0501076_0047740 Ga0501076_0047740_1681_2607 308
190 3300049592 Ga0501076_0280156 Ga0501076_0280156_307_1233 308
191 3300049593 Ga0501077_0045269 Ga0501077_0045269_1765_2691 308
192 3300049741 Ga0501079_0010693 Ga0501079_0010693_1445_2371 308
193 3300049743 Ga0501081_0142461 Ga0501081_0142461_491_1417 308
194 3300050491 nmdc:mga00v17_254_c1 nmdc:mga00v17_254_c1_2089_3015 308
195 3300050494 nmdc:mga06z11_175849_c1 nmdc:mga06z11_175849_c1_121_1047 308
196 3300050496 nmdc:mga07m45_106128_c1 nmdc:mga07m45_106128_c1_425_1351 308
197 3300053080 Ga0500635_0000133 Ga0500635_0000133_32510_33436 308
198 3300053083 Ga0495655_0045818 Ga0495655_0045818_120_1046 308
199 3300053087 Ga0500643_016835 Ga0500643_016835_1140_2066 308
200 3300053092 Ga0500583_0075225 Ga0500583_0075225_401_1327 308
201 3300053093 Ga0500651_0012784 Ga0500651_0012784_2579_3505 308
202 3300053109 Ga0500569_037574 Ga0500569_037574_262_1188 308
203 3300053119 Ga0500595_009594 Ga0500595_009594_747_1673 308
204 3300053119 Ga0500595_015399 Ga0500595_015399_1136_2062 308
205 3300053122 Ga0500608_002907 Ga0500608_002907_4907_5833 308
206 3300053136 Ga0500559_0000048 Ga0500559_0000048_65144_66070 308
207 3300053136 Ga0500559_0002446 Ga0500559_0002446_7155_8081 308
208 3300053136 Ga0500559_0023470 Ga0500559_0023470_1128_2054 308
209 3300053148 Ga0500590_030642 Ga0500590_030642_736_1662 308
210 3300053177 Ga0500636_0003639 Ga0500636_0003639_6830_7756 308
211 3300053178 Ga0500637_0019160 Ga0500637_0019160_2021_2947 308
212 3300054114 Ga0501084_0021975 Ga0501084_0021975_2793_3719 308
213 3300054114 Ga0501084_0045308 Ga0501084_0045308_2008_2934 308
214 3300060353 Ga0501082_0054963 Ga0501082_0054963_1624_2550 308
215 3300061734 Ga0530510_0027025 Ga0530510_0027025_2245_3171 308
216 iso_pu_bacteria 2585428106 2587917059 308
217 3300003781 Ga0055536_1005096 Ga0055536_10050964 312
218 3300003791 Ga0055530_10005025 Ga0055530_100050256 312
219 3300003794 Ga0055531_10049792 Ga0055531_100497921 312
220 3300006195 Ga0075366_10055750 Ga0075366_100557503 312
221 3300025292 Ga0209676_1000253 Ga0209676_100025338 312
222 3300025298 Ga0209050_1000649 Ga0209050_100064943 312
223 3300025303 Ga0209051_1005367 Ga0209051_10053675 312
224 3300025304 Ga0209257_1014332 Ga0209257_10143323 312
225 3300046616 Ga0495668_0054031 Ga0495668_0054031_1178_2116 312
226 3300048918 Ga0496115_0141134 Ga0496115_0141134_69_1007 312

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00551

Formyl_trans_N

Formyl transferase

1

180

0.96

PF02911

Formyl_trans_C

Formyl transferase, C-terminal domain

203

296

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tqq-assembly1.cif.gz_A structure of the methionyl-trna formyltransferase (fmt) from coxiella burnetii 0.9027 2 308
5uai-assembly1.cif.gz_A crystal structure of methionyl-trna formyltransferase from pseudomonas aeruginosa 0.8984 2 308
3q0i-assembly1.cif.gz_A methionyl-trna formyltransferase from vibrio cholerae 0.8959 1 308
3tqq-assembly1.cif.gz_A structure of the methionyl-trna formyltransferase (fmt) from coxiella burnetii 0.8914 2 308
3q0i-assembly1.cif.gz_A methionyl-trna formyltransferase from vibrio cholerae 0.8903 1 308
ID Description Score Start End Superfamily
3tqqA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9505 2 205 3.40.50.170
3tqqA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9362 2 205 3.40.50.170
3rfoA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.934 2 205 3.40.50.170
3rfoA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9121 2 205 3.40.50.170
af_B4FRN6_28_246_3.40.50.170 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9041 2 205 3.40.50.170
ID Description Score Start End GO Terms
AF-A0A3B9VCC8-F1-model_v4 Methionyl-tRNA formyltransferase 0.9687 1 96 GO:0004479
GO:0005829
AF-H8K8G4-F1-model_v4 Methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9647 6 97 GO:0004479
GO:0005829
AF-A0A838F4N2-F1-model_v4 Methionyl-tRNA formyltransferase 0.9626 1 77 GO:0004479
GO:0005829
AF-A0A661M0D9-F1-model_v4 Methionyl-tRNA formyltransferase 0.9619 2 100 GO:0004479
GO:0005829
AF-A0A2V7K666-F1-model_v4 methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9602 1 124 GO:0004479
GO:0005829

Feature Viewer

pLDDT pTM Quality
93.25 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map