F339048

General Info

Members Datasets Scaffolds Average Seq Length
226 190 208 317

Family's Representative Sequence

Representative Sequence 3300035398|Ga0316574_0196213|Ga0316574_0196213_110_1195
Length 345
Sequence MIRAIDAVAALRQPLERSPTGDDRMTDTRHCKLLILGSGPAGYTAAVYAARANLSPVLVTGIQQGGQLTTTTEVENWPGDPGELQGPELMERMKLHAEKFDTEIVFDHIHEVALDRRPFRLSGDSGQYTCDALIIATGASARYLGLDSEQAFLGKGVSACATCDGFVEEALYLSNIASEVVLIHRRDELRAEKILQQRLFDRAGEDGNVRILWDSVLDEVLGDDSGVTGIRVRSTTKPDQVTELALAGVFIAIGHSPNTGIFADQLEMEHGYIIVRGGRHGDATATSVPGVFAAGDVMDSIYRQAVTSAGSGCMAALDAEKYLDALAETGDAERAQEISAASATV

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2547132374 Acidovorax radicis N35 Isolate Unclassified
3 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
4 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
5 2643221596 Acidovorax sp. Root70 Isolate Unclassified
6 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
7 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
8 2643221717 Acidovorax sp. Root267 Isolate Unclassified
9 2738541337 Pelomonas sp. BT06 Isolate Unclassified
10 2881714928 Pseudidiomarina mangrovi ZQ330 Isolate Rhizosphere
11 2885266251 Ralstonia sp. SET104 Isolate Nodule
12 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
13 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
14 2916178963 Pseudoalteromonas rhizosphaerae RA15 Isolate Rhizosphere
15 2928058823 Ralstonia sp. 1138 Isolate Unclassified
16 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
17 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
18 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
19 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
20 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
21 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
22 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
23 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
24 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
25 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
26 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
27 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
28 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
29 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
30 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
31 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
32 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
33 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
34 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
35 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
36 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
37 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
38 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
39 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
40 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
41 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
42 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
43 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
73 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
76 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
85 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
88 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
89 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
94 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
117 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
118 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
119 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
120 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
121 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
122 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
123 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
124 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
127 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
128 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
129 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
130 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
131 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
132 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
133 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
134 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
138 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
139 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
140 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
141 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
142 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
143 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
144 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
145 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
146 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
147 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
148 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
149 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
150 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
151 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
152 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
153 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
156 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
157 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
158 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
159 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
160 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
161 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
162 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
163 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
164 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
165 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
174 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
175 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
176 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
177 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
178 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
179 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
180 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
182 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
183 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
184 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
185 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
186 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
187 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
188 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
189 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
190 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.82
Metatranscriptomes 2.21
Isolates 7.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.78
Nodule 0.88
Rhizoplane 0.44
Rhizosphere 63.72
Stem 0
Stem Tuber 0
Unclassified 10.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1798542 2162886007 Bacteria 3786
2 JGI24741J21665_1000022 3300001915 Bacteria 37410
3 JGI24741J21665_1008566 3300001915 Bacteria 1923
4 JGI24740J21852_10000488 3300001979 Bacteria 17051
5 JGI24740J21852_10001705 3300001979 Bacteria 10087
6 JGI24739J22299_10016272 3300001989 Bacteria 2693
7 JGI25156J39149_1004097 3300002705 Bacteria 4534
8 JGI25154J39366_1000699 3300002738 Bacteria 15314
9 JGI25152J39213_1008779 3300002773 Bacteria 2470
10 JGI25151J46595_10003552 3300003187 Bacteria 8559
11 JGI25151J46595_10009072 3300003187 Bacteria 4739
12 Ga0055539_1000068 3300003752 Bacteria 134912
13 Ga0055533_1003051 3300003756 Bacteria 3545
14 Ga0055532_1000008 3300003758 Bacteria 404753
15 Ga0055525_1000603 3300003759 Bacteria 15159
16 Ga0055527_1000946 3300003760 Bacteria 7144
17 Ga0055535_1000006 3300003761 Bacteria 404753
18 Ga0055542_1001446 3300003762 Bacteria 11830
19 Ga0055529_1000030 3300003763 Bacteria 272455
20 Ga0055537_1000134 3300003773 Bacteria 56046
21 Ga0055534_1000088 3300003784 Bacteria 72004
22 Ga0055528_1000630 3300003790 Bacteria 26033
23 Ga0055531_10011121 3300003794 Bacteria 4385
24 Ga0055541_1000676 3300003841 Bacteria 8852
25 Ga0055541_1005550 3300003841 Bacteria 2194
26 Ga0070690_100011480 3300005330 Bacteria 5181
27 Ga0068869_100150971 3300005334 Bacteria 1802
28 Ga0070682_100073844 3300005337 Bacteria 2189
29 Ga0070661_100000002 3300005344 Bacteria 265686
30 Ga0070669_100033237 3300005353 Bacteria 3730
31 Ga0070673_100003465 3300005364 Bacteria 9824
32 Ga0070659_100001714 3300005366 Bacteria 15769
33 Ga0070663_100000005 3300005455 Bacteria 251758
34 Ga0070678_100017957 3300005456 Bacteria 4572
35 Ga0068867_100000086 3300005459 Bacteria 58298
36 Ga0070672_100049410 3300005543 Bacteria 3272
37 Ga0070665_100027067 3300005548 Bacteria 5775
38 Ga0068855_100253917 3300005563 Bacteria 1961
39 Ga0070664_100000001 3300005564 Bacteria 551832
40 Ga0068857_100336763 3300005577 Bacteria 1395
41 Ga0068854_100000030 3300005578 Bacteria 111321
42 Ga0068856_100000008 3300005614 Bacteria 190886
43 Ga0068852_100170296 3300005616 Bacteria 2041
44 Ga0068862_100098068 3300005844 Bacteria 2560
45 Ga0075364_10030193 3300006051 Bacteria 3478
46 Ga0075366_10037885 3300006195 Bacteria 2848
47 Ga0075370_10004777 3300006353 Bacteria 6632
48 Ga0075370_10025197 3300006353 Bacteria 3288
49 Ga0075370_10094840 3300006353 Bacteria 1723
50 Ga0075370_10172123 3300006353 Bacteria 1273
51 Ga0105240_10001312 3300009093 Bacteria 42925
52 Ga0105240_10176424 3300009093 Bacteria 2526
53 Ga0105243_10002454 3300009148 Bacteria 15486
54 Ga0105243_10020633 3300009148 Bacteria 4996
55 Ga0105238_10153387 3300009551 Bacteria 2279
56 Ga0105246_10059847 3300011119 Bacteria 2644
57 Ga0105246_10137341 3300011119 Bacteria 1834
58 Ga0157373_10009617 3300013100 Bacteria 7134
59 Ga0157373_10012747 3300013100 Bacteria 6177
60 Ga0157371_10000035 3300013102 Bacteria 223396
61 Ga0157370_10000021 3300013104 Bacteria 166168
62 Ga0157370_10338647 3300013104 Bacteria 1387
63 Ga0157369_10001101 3300013105 Bacteria 33825
64 Ga0157378_10257681 3300013297 Bacteria 1672
65 Ga0157372_10000225 3300013307 Bacteria 62752
66 Ga0157377_10000038 3300014745 Bacteria 113777
67 Ga0182006_1002121 3300015261 Bacteria 11057
68 Ga0197907_10422221 3300020069 Bacteria 2185
69 Ga0154015_1576187 3300020610 Bacteria 23748
70 Ga0213872_10006952 3300021361 Bacteria 5620
71 Ga0213872_10015125 3300021361 Bacteria 3589
72 Ga0224712_10029910 3300022467 Bacteria 1961
73 Ga0209784_100014 3300025224 Bacteria 496182
74 Ga0209784_100484 3300025224 Bacteria 15981
75 Ga0209566_100011 3300025225 Bacteria 496182
76 Ga0209566_101124 3300025225 Bacteria 10185
77 Ga0209674_100032 3300025226 Bacteria 426888
78 Ga0209674_100220 3300025226 Bacteria 53058
79 Ga0209672_100566 3300025228 Bacteria 19646
80 Ga0209147_100002 3300025229 Bacteria 2158988
81 Ga0209563_100029 3300025230 Bacteria 496182
82 Ga0209258_100002 3300025242 Bacteria 2158988
83 Ga0209646_1000058 3300025246 Bacteria 259999
84 Ga0209677_100081 3300025253 Bacteria 120362
85 Ga0209148_1000043 3300025254 Bacteria 461531
86 Ga0209148_1006348 3300025254 Bacteria 2572
87 Ga0209759_1001289 3300025256 Bacteria 14933
88 Ga0209759_1018166 3300025256 Bacteria 1707
89 Ga0209129_1001116 3300025258 Bacteria 15622
90 Ga0209565_1000046 3300025263 Bacteria 226073
91 Ga0209455_1000009 3300025272 Bacteria 1042273
92 Ga0209673_1000058 3300025273 Bacteria 269028
93 Ga0209675_1000010 3300025291 Bacteria 541927
94 Ga0209025_1000122 3300025294 Bacteria 206064
95 Ga0209025_1008034 3300025294 Bacteria 7685
96 Ga0209050_1004630 3300025298 Bacteria 9176
97 Ga0209051_1004966 3300025303 Bacteria 7950
98 Ga0209051_1013402 3300025303 Bacteria 3905
99 Ga0209257_1000017 3300025304 Bacteria 866287
100 Ga0207654_10152795 3300025911 Bacteria 1483
101 Ga0207695_10006521 3300025913 Bacteria 15105
102 Ga0207695_10010618 3300025913 Bacteria 11254
103 Ga0207649_10000407 3300025920 Bacteria 31971
104 Ga0207681_10042940 3300025923 Bacteria 3023
105 Ga0207659_10299692 3300025926 Bacteria 1320
106 Ga0207690_10020166 3300025932 Bacteria 4115
107 Ga0207709_10005392 3300025935 Bacteria 7274
108 Ga0207709_10027080 3300025935 Bacteria 3298
109 Ga0207679_10000003 3300025945 Bacteria 597553
110 Ga0207651_10010402 3300025960 Bacteria 5157
111 Ga0207651_10283771 3300025960 Bacteria 1370
112 Ga0207640_10000070 3300025981 Bacteria 80803
113 Ga0207678_10000002 3300026067 Bacteria 371723
114 Ga0207702_10000031 3300026078 Bacteria 175405
115 Ga0207648_10000053 3300026089 Bacteria 107516
116 Ga0207648_10277567 3300026089 Bacteria 1498
117 Ga0207674_10009931 3300026116 Bacteria 10828
118 Ga0207683_10006050 3300026121 Bacteria 10361
119 Ga0207698_10077340 3300026142 Bacteria 2668
120 Ga0209282_1002486 3300027666 Bacteria 10675
121 Ga0268266_10014299 3300028379 Bacteria 6825
122 Ga0268265_10016123 3300028380 Bacteria 5128
123 Ga0307515_10226215 3300028794 Bacteria 1675
124 Ga0316183_1128476 3300030742 Bacteria 1849
125 Ga0316182_1217857 3300030745 Bacteria 2513
126 Ga0265328_10022295 3300031239 Bacteria 2411
127 Ga0265331_10011461 3300031250 Bacteria 4854
128 Ga0265327_10000144 3300031251 Bacteria 156779
129 Ga0265327_10024695 3300031251 Bacteria 3522
130 Ga0265327_10096566 3300031251 Bacteria 1433
131 Ga0316575_10023684 3300031665 Bacteria 2374
132 Ga0316576_10000632 3300031727 Bacteria 17001
133 Ga0307413_10166628 3300031824 Bacteria 1555
134 Ga0307412_10219844 3300031911 Bacteria 1455
135 Ga0316583_10001308 3300032133 Bacteria 8229
136 Ga0373940_0014434 3300035088 Bacteria 1927
137 Ga0373951_0012762 3300035091 Bacteria 1889
138 Ga0373939_0000004 3300035114 Bacteria 106519
139 Ga0373960_0001686 3300035121 Bacteria 4946
140 Ga0316574_0196213 3300035398 Bacteria 1298
141 Ga0373931_0000140 3300035691 Bacteria 32698
142 Ga0316584_0029446 3300036712 Bacteria 4053
143 Ga0395899_0285179 3300037312 Bacteria 1122
144 Ga0395900_0013815 3300037418 Bacteria 8240
145 Ga0395905_0000777 3300037471 Bacteria 41933
146 Ga0395905_0171348 3300037471 Bacteria 2039
147 Ga0395905_0180750 3300037471 Bacteria 1980
148 Ga0400483_031230 3300039062 Bacteria 4978
149 Ga0400483_186642 3300039062 Bacteria 10416
150 Ga0400483_284231 3300039062 Bacteria 12842
151 Ga0436361_0200340 3300039447 Bacteria 7799
152 Ga0436361_0201955 3300039447 Bacteria 14773
153 Ga0436361_0623740 3300039447 Bacteria 10631
154 Ga0439433_0006162 3300041999 Bacteria 2579
155 Ga0439452_011550 3300042010 Bacteria 2534
156 Ga0450904_000450 3300042139 Bacteria 8179
157 Ga0466986_0059142 3300044650 Bacteria 2652
158 Ga0466969_0077122 3300044656 Bacteria 1595
159 Ga0466972_0032982 3300044658 Bacteria 2540
160 Ga0466978_0071780 3300044671 Bacteria 2160
161 Ga0466965_0034963 3300044683 Bacteria 2460
162 Ga0466961_0017309 3300044693 Bacteria 4628
163 Ga0466964_0019771 3300044706 Bacteria 2590
164 Ga0453684_0209537 3300044712 Bacteria 2266
165 Ga0453684_0360957 3300044712 Bacteria 1636
166 Ga0466968_0061302 3300044735 Bacteria 1622
167 Ga0466970_0011126 3300044765 Bacteria 4582
168 Ga0466957_0014234 3300044842 Bacteria 4630
169 Ga0466959_0086538 3300045049 Bacteria 2254
170 Ga0466967_0043621 3300045976 Bacteria 3884
171 Ga0495638_0110882 3300046460 Bacteria 1630
172 Ga0495631_0009407 3300046518 Bacteria 4883
173 Ga0495654_0024675 3300046530 Bacteria 3105
174 Ga0495687_000700 3300047443 Bacteria 37469
175 Ga0495681_0083582 3300047470 Bacteria 1421
176 Ga0496121_0103745 3300048924 Bacteria 2186
177 Ga0496123_0132619 3300048926 Bacteria 1377
178 Ga0496125_0060835 3300048928 Bacteria 3033
179 Ga0501292_001788 3300049515 Bacteria 2684
180 Ga0501298_047094 3300049521 Bacteria 886
181 Ga0501311_014184 3300049527 Bacteria 1015
182 Ga0501314_001549 3300049530 Bacteria 1678
183 Ga0501034_0021731 3300049571 Bacteria 6538
184 Ga0501038_0062615 3300049574 Bacteria 3179
185 Ga0501038_0177929 3300049574 Bacteria 1718
186 Ga0501040_0064484 3300049576 Bacteria 2522
187 Ga0501042_0082555 3300049578 Bacteria 2304
188 Ga0501046_0251724 3300049580 Bacteria 1300
189 Ga0501047_0108297 3300049581 Bacteria 2661
190 Ga0501072_0017140 3300049588 Bacteria 5566
191 Ga0501075_0207164 3300049591 Bacteria 1496
192 Ga0501076_0148729 3300049592 Bacteria 1905
193 Ga0501206_003412 3300049653 Bacteria 2018
194 Ga0501081_0047961 3300049743 Bacteria 2939
195 Ga0501262_001008 3300049759 Bacteria 3197
196 Ga0501281_01725 3300049777 Bacteria 1675
197 Ga0501045_0212798 3300049824 Bacteria 1440
198 Ga0501226_000015 3300049853 Bacteria 164151
199 nmdc:mga0k408_98954_c1 3300050493 Bacteria 1719
200 nmdc:mga07m45_1573_c1 3300050496 Bacteria 10505
201 nmdc:mga07m45_52743_c1 3300050496 Bacteria 2297
202 nmdc:mga07m45_9440_c1 3300050496 Bacteria 5064
203 Ga0500593_001579 3300053117 Bacteria 8194
204 Ga0500594_0000938 3300053118 Bacteria 6261
205 Ga0500658_0002003 3300053134 Bacteria 7959
206 Ga0500559_0026674 3300053136 Bacteria 2463
207 Ga0500568_0004400 3300053139 Bacteria 7534
208 Ga0466962_0060673 3300061719 Bacteria 1805

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049521 Ga0501298_047094 Ga0501298_047094_94_870 258
2 3300049777 Ga0501281_01725 Ga0501281_01725_824_1642 271
3 3300003187 JGI25151J46595_10003552 JGI25151J46595_100035526 275
4 3300044712 Ga0453684_0360957 Ga0453684_0360957_209_1156 291
5 3300049571 Ga0501034_0021731 Ga0501034_0021731_4817_5782 291
6 3300037471 Ga0395905_0171348 Ga0395905_0171348_223_1185 295
7 3300005353 Ga0070669_100033237 Ga0070669_1000332372 296
8 3300025923 Ga0207681_10042940 Ga0207681_100429404 296
9 3300049574 Ga0501038_0177929 Ga0501038_0177929_376_1344 296
10 3300049576 Ga0501040_0064484 Ga0501040_0064484_1349_2317 296
11 3300049578 Ga0501042_0082555 Ga0501042_0082555_676_1644 296
12 3300049580 Ga0501046_0251724 Ga0501046_0251724_78_1046 296
13 3300049588 Ga0501072_0017140 Ga0501072_0017140_1147_2115 296
14 3300049591 Ga0501075_0207164 Ga0501075_0207164_515_1483 296
15 3300049592 Ga0501076_0148729 Ga0501076_0148729_826_1794 296
16 3300049743 Ga0501081_0047961 Ga0501081_0047961_1058_2026 296
17 3300049824 Ga0501045_0212798 Ga0501045_0212798_196_1164 296
18 3300006353 Ga0075370_10172123 Ga0075370_101721232 300
19 3300031239 Ga0265328_10022295 Ga0265328_100222954 300
20 3300031251 Ga0265327_10000144 Ga0265327_1000014423 300
21 3300039062 Ga0400483_031230 Ga0400483_031230_2281_3243 303
22 3300039062 Ga0400483_284231 Ga0400483_284231_204_1166 303
23 3300053117 Ga0500593_001579 Ga0500593_001579_562_1524 303
24 3300032133 Ga0316583_10001308 Ga0316583_100013083 305
25 3300036712 Ga0316584_0029446 Ga0316584_0029446_1422_2378 305
26 iso_pu_bacteria 2596583598 2597031881 311
27 iso_pu_bacteria 2599185178 2599446882 311
28 iso_pu_bacteria 2885266251 2885268130 311
29 iso_pu_bacteria 2928058823 2928061903 311
30 3300053136 Ga0500559_0026674 Ga0500559_0026674_792_1766 312
31 iso_pu_bacteria 2916178963 2916182130 312
32 iso_pu_bacteria 2998344455 2998346831 312
33 iso_pu_bacteria 2547132374 2548499809 313
34 iso_pu_bacteria 2643221596 2643993947 313
35 iso_pu_bacteria 2643221717 2644644864 313
36 iso_pu_bacteria 2881714928 2881715181 313
37 iso_pu_bacteria 2990710928 2990713593 313
38 3300039062 Ga0400483_186642 Ga0400483_186642_4206_5150 314
39 3300001915 JGI24741J21665_1000022 JGI24741J21665_100002213 315
40 3300001915 JGI24741J21665_1008566 JGI24741J21665_10085661 315
41 3300001979 JGI24740J21852_10000488 JGI24740J21852_1000048811 315
42 3300001979 JGI24740J21852_10001705 JGI24740J21852_100017052 315
43 3300002705 JGI25156J39149_1004097 JGI25156J39149_10040974 315
44 3300002738 JGI25154J39366_1000699 JGI25154J39366_10006997 315
45 3300003752 Ga0055539_1000068 Ga0055539_100006822 315
46 3300003756 Ga0055533_1003051 Ga0055533_10030514 315
47 3300003758 Ga0055532_1000008 Ga0055532_10000089 315
48 3300003759 Ga0055525_1000603 Ga0055525_10006039 315
49 3300003760 Ga0055527_1000946 Ga0055527_10009467 315
50 3300003761 Ga0055535_1000006 Ga0055535_1000006383 315
51 3300003762 Ga0055542_1001446 Ga0055542_100144612 315
52 3300003763 Ga0055529_1000030 Ga0055529_1000030266 315
53 3300003841 Ga0055541_1000676 Ga0055541_10006764 315
54 3300003841 Ga0055541_1005550 Ga0055541_10055502 315
55 3300005344 Ga0070661_100000002 Ga0070661_10000000227 315
56 3300005366 Ga0070659_100001714 Ga0070659_1000017145 315
57 3300005455 Ga0070663_100000005 Ga0070663_100000005211 315
58 3300005459 Ga0068867_100000086 Ga0068867_1000000866 315
59 3300005564 Ga0070664_100000001 Ga0070664_100000001169 315
60 3300005577 Ga0068857_100336763 Ga0068857_1003367632 315
61 3300005578 Ga0068854_100000030 Ga0068854_10000003083 315
62 3300005614 Ga0068856_100000008 Ga0068856_10000000894 315
63 3300005616 Ga0068852_100170296 Ga0068852_1001702962 315
64 3300009093 Ga0105240_10176424 Ga0105240_101764242 315
65 3300009148 Ga0105243_10002454 Ga0105243_100024546 315
66 3300013100 Ga0157373_10009617 Ga0157373_100096171 315
67 3300013102 Ga0157371_10000035 Ga0157371_10000035100 315
68 3300013104 Ga0157370_10000021 Ga0157370_1000002116 315
69 3300013105 Ga0157369_10001101 Ga0157369_1000110114 315
70 3300013297 Ga0157378_10257681 Ga0157378_102576811 315
71 3300013307 Ga0157372_10000225 Ga0157372_1000022553 315
72 3300014745 Ga0157377_10000038 Ga0157377_1000003880 315
73 3300015261 Ga0182006_1002121 Ga0182006_10021219 315
74 3300020069 Ga0197907_10422221 Ga0197907_104222212 315
75 3300020610 Ga0154015_1576187 Ga0154015_157618713 315
76 3300022467 Ga0224712_10029910 Ga0224712_100299102 315
77 3300025224 Ga0209784_100014 Ga0209784_100014269 315
78 3300025224 Ga0209784_100484 Ga0209784_10048415 315
79 3300025225 Ga0209566_100011 Ga0209566_100011269 315
80 3300025225 Ga0209566_101124 Ga0209566_1011249 315
81 3300025226 Ga0209674_100032 Ga0209674_100032216 315
82 3300025226 Ga0209674_100220 Ga0209674_10022046 315
83 3300025228 Ga0209672_100566 Ga0209672_10056614 315
84 3300025229 Ga0209147_100002 Ga0209147_100002506 315
85 3300025230 Ga0209563_100029 Ga0209563_100029216 315
86 3300025242 Ga0209258_100002 Ga0209258_100002506 315
87 3300025246 Ga0209646_1000058 Ga0209646_100005863 315
88 3300025253 Ga0209677_100081 Ga0209677_100081106 315
89 3300025254 Ga0209148_1000043 Ga0209148_1000043245 315
90 3300025254 Ga0209148_1006348 Ga0209148_10063483 315
91 3300025256 Ga0209759_1001289 Ga0209759_10012895 315
92 3300025256 Ga0209759_1018166 Ga0209759_10181662 315
93 3300025272 Ga0209455_1000009 Ga0209455_1000009385 315
94 3300025913 Ga0207695_10006521 Ga0207695_100065219 315
95 3300025920 Ga0207649_10000407 Ga0207649_1000040714 315
96 3300025932 Ga0207690_10020166 Ga0207690_100201665 315
97 3300025935 Ga0207709_10005392 Ga0207709_100053926 315
98 3300025945 Ga0207679_10000003 Ga0207679_10000003354 315
99 3300025981 Ga0207640_10000070 Ga0207640_1000007041 315
100 3300026067 Ga0207678_10000002 Ga0207678_10000002222 315
101 3300026078 Ga0207702_10000031 Ga0207702_1000003174 315
102 3300026089 Ga0207648_10000053 Ga0207648_10000053101 315
103 3300026089 Ga0207648_10277567 Ga0207648_102775672 315
104 3300026116 Ga0207674_10009931 Ga0207674_1000993110 315
105 3300026142 Ga0207698_10077340 Ga0207698_100773401 315
106 3300031665 Ga0316575_10023684 Ga0316575_100236842 315
107 3300037312 Ga0395899_0285179 Ga0395899_0285179_144_1100 315
108 3300037418 Ga0395900_0013815 Ga0395900_0013815_7071_8027 315
109 3300042139 Ga0450904_000450 Ga0450904_000450_1801_2748 315
110 3300044650 Ga0466986_0059142 Ga0466986_0059142_1077_2033 315
111 3300047443 Ga0495687_000700 Ga0495687_000700_29943_30902 315
112 3300048928 Ga0496125_0060835 Ga0496125_0060835_1707_2663 315
113 3300049515 Ga0501292_001788 Ga0501292_001788_480_1433 315
114 3300049527 Ga0501311_014184 Ga0501311_014184_18_965 315
115 3300049530 Ga0501314_001549 Ga0501314_001549_344_1291 315
116 3300049653 Ga0501206_003412 Ga0501206_003412_63_1016 315
117 3300049853 Ga0501226_000015 Ga0501226_000015_44804_45751 315
118 iso_pu_bacteria 2643221639 2644221611 315
119 iso_pu_bacteria 2643221646 2644257626 315
120 iso_pu_bacteria 2738541337 2739058610 315
121 iso_pu_bacteria 2904479285 2904482873 315
122 iso_pu_bacteria 2904541872 2904549818 315
123 iso_pu_bacteria 2929160207 2929161785 315
124 iso_pu_bacteria 8054357960 8054359515 315
125 3300003794 Ga0055531_10011121 Ga0055531_100111213 316
126 3300005330 Ga0070690_100011480 Ga0070690_1000114804 316
127 3300013100 Ga0157373_10012747 Ga0157373_100127473 316
128 3300021361 Ga0213872_10015125 Ga0213872_100151254 316
129 3300025298 Ga0209050_1004630 Ga0209050_10046309 316
130 3300025303 Ga0209051_1004966 Ga0209051_10049664 316
131 3300025304 Ga0209257_1000017 Ga0209257_1000017574 316
132 3300028794 Ga0307515_10226215 Ga0307515_102262152 316
133 3300031251 Ga0265327_10024695 Ga0265327_100246953 316
134 3300031251 Ga0265327_10096566 Ga0265327_100965662 316
135 3300039447 Ga0436361_0200340 Ga0436361_0200340_5424_6377 316
136 3300039447 Ga0436361_0201955 Ga0436361_0201955_905_1858 316
137 3300044656 Ga0466969_0077122 Ga0466969_0077122_361_1320 316
138 3300044658 Ga0466972_0032982 Ga0466972_0032982_993_1952 316
139 3300044671 Ga0466978_0071780 Ga0466978_0071780_885_1844 316
140 3300044683 Ga0466965_0034963 Ga0466965_0034963_687_1646 316
141 3300044693 Ga0466961_0017309 Ga0466961_0017309_921_1880 316
142 3300044706 Ga0466964_0019771 Ga0466964_0019771_828_1787 316
143 3300044735 Ga0466968_0061302 Ga0466968_0061302_154_1113 316
144 3300044765 Ga0466970_0011126 Ga0466970_0011126_883_1842 316
145 3300044842 Ga0466957_0014234 Ga0466957_0014234_2747_3706 316
146 3300045049 Ga0466959_0086538 Ga0466959_0086538_360_1319 316
147 3300045976 Ga0466967_0043621 Ga0466967_0043621_192_1151 316
148 3300061719 Ga0466962_0060673 Ga0466962_0060673_108_1067 316
149 3300005456 Ga0070678_100017957 Ga0070678_1000179572 317
150 3300005548 Ga0070665_100027067 Ga0070665_1000270671 317
151 3300021361 Ga0213872_10006952 Ga0213872_100069522 317
152 3300025303 Ga0209051_1013402 Ga0209051_10134025 317
153 3300026121 Ga0207683_10006050 Ga0207683_100060507 317
154 3300028379 Ga0268266_10014299 Ga0268266_100142993 317
155 3300031911 Ga0307412_10219844 Ga0307412_102198442 317
156 3300039447 Ga0436361_0623740 Ga0436361_0623740_5621_6574 317
157 3300041999 Ga0439433_0006162 Ga0439433_0006162_823_1776 317
158 3300049574 Ga0501038_0062615 Ga0501038_0062615_263_1216 317
159 3300005337 Ga0070682_100073844 Ga0070682_1000738442 318
160 3300006353 Ga0075370_10094840 Ga0075370_100948402 318
161 3300031250 Ga0265331_10011461 Ga0265331_100114616 318
162 3300035088 Ga0373940_0014434 Ga0373940_0014434_499_1458 318
163 3300035091 Ga0373951_0012762 Ga0373951_0012762_813_1772 318
164 3300035114 Ga0373939_0000004 Ga0373939_0000004_7711_8670 318
165 3300035121 Ga0373960_0001686 Ga0373960_0001686_3861_4820 318
166 3300035691 Ga0373931_0000140 Ga0373931_0000140_6175_7134 318
167 3300037471 Ga0395905_0000777 Ga0395905_0000777_34290_35249 318
168 3300044712 Ga0453684_0209537 Ga0453684_0209537_919_1875 318
169 3300050496 nmdc:mga07m45_9440_c1 nmdc:mga07m45_9440_c1_216_1175 318
170 3300001989 JGI24739J22299_10016272 JGI24739J22299_100162723 319
171 3300002773 JGI25152J39213_1008779 JGI25152J39213_10087794 319
172 3300003187 JGI25151J46595_10009072 JGI25151J46595_100090723 319
173 3300003773 Ga0055537_1000134 Ga0055537_10001342 319
174 3300003784 Ga0055534_1000088 Ga0055534_10000882 319
175 3300003790 Ga0055528_1000630 Ga0055528_10006301 319
176 3300005334 Ga0068869_100150971 Ga0068869_1001509712 319
177 3300005364 Ga0070673_100003465 Ga0070673_1000034657 319
178 3300005543 Ga0070672_100049410 Ga0070672_1000494102 319
179 3300005563 Ga0068855_100253917 Ga0068855_1002539172 319
180 3300005844 Ga0068862_100098068 Ga0068862_1000980683 319
181 3300006195 Ga0075366_10037885 Ga0075366_100378852 319
182 3300006353 Ga0075370_10004777 Ga0075370_100047772 319
183 3300006353 Ga0075370_10025197 Ga0075370_100251973 319
184 3300009093 Ga0105240_10001312 Ga0105240_1000131231 319
185 3300009148 Ga0105243_10020633 Ga0105243_100206334 319
186 3300009551 Ga0105238_10153387 Ga0105238_101533871 319
187 3300011119 Ga0105246_10059847 Ga0105246_100598472 319
188 3300011119 Ga0105246_10137341 Ga0105246_101373412 319
189 3300013104 Ga0157370_10338647 Ga0157370_103386471 319
190 3300025258 Ga0209129_1001116 Ga0209129_100111615 319
191 3300025263 Ga0209565_1000046 Ga0209565_1000046153 319
192 3300025273 Ga0209673_1000058 Ga0209673_100005859 319
193 3300025291 Ga0209675_1000010 Ga0209675_1000010206 319
194 3300025294 Ga0209025_1000122 Ga0209025_10001223 319
195 3300025294 Ga0209025_1008034 Ga0209025_10080347 319
196 3300025911 Ga0207654_10152795 Ga0207654_101527952 319
197 3300025913 Ga0207695_10010618 Ga0207695_100106183 319
198 3300025926 Ga0207659_10299692 Ga0207659_102996922 319
199 3300025935 Ga0207709_10027080 Ga0207709_100270803 319
200 3300025960 Ga0207651_10010402 Ga0207651_100104023 319
201 3300025960 Ga0207651_10283771 Ga0207651_102837711 319
202 3300027666 Ga0209282_1002486 Ga0209282_10024865 319
203 3300028380 Ga0268265_10016123 Ga0268265_100161233 319
204 3300030742 Ga0316183_1128476 Ga0316183_11284762 319
205 3300030745 Ga0316182_1217857 Ga0316182_12178573 319
206 3300031727 Ga0316576_10000632 Ga0316576_100006328 319
207 3300031824 Ga0307413_10166628 Ga0307413_101666281 319
208 3300046460 Ga0495638_0110882 Ga0495638_0110882_598_1557 319
209 3300046518 Ga0495631_0009407 Ga0495631_0009407_2301_3260 319
210 3300046530 Ga0495654_0024675 Ga0495654_0024675_778_1737 319
211 3300047470 Ga0495681_0083582 Ga0495681_0083582_410_1369 319
212 3300048924 Ga0496121_0103745 Ga0496121_0103745_33_992 319
213 3300048926 Ga0496123_0132619 Ga0496123_0132619_342_1301 319
214 3300049759 Ga0501262_001008 Ga0501262_001008_1655_2614 319
215 3300050493 nmdc:mga0k408_98954_c1 nmdc:mga0k408_98954_c1_489_1448 319
216 3300050496 nmdc:mga07m45_1573_c1 nmdc:mga07m45_1573_c1_2751_3710 319
217 3300050496 nmdc:mga07m45_52743_c1 nmdc:mga07m45_52743_c1_140_1099 319
218 3300053118 Ga0500594_0000938 Ga0500594_0000938_874_1833 319
219 3300053134 Ga0500658_0002003 Ga0500658_0002003_2547_3506 319
220 3300053139 Ga0500568_0004400 Ga0500568_0004400_5505_6464 319
221 3300035398 Ga0316574_0196213 Ga0316574_0196213_110_1195 322
222 3300037471 Ga0395905_0180750 Ga0395905_0180750_825_1820 325
223 3300042010 Ga0439452_011550 Ga0439452_011550_668_1654 328
224 3300049581 Ga0501047_0108297 Ga0501047_0108297_57_1124 343
225 3300006051 Ga0075364_10030193 Ga0075364_100301932 347
226 2162886007 SwRhRL2b_contig_1798542 SwRhRL2b_0747.00006940 358

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00070

Pyr_redox

Pyridine nucleotide-disulphide oxidoreductase

165

239

0.87

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

31

312

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5utx-assembly1.cif.gz_B crystal structure of thioredoxin-disulfide reductase from vibrio vulnificus cmcp6 - apo form 0.9342 43 355
5utx-assembly1.cif.gz_B crystal structure of thioredoxin-disulfide reductase from vibrio vulnificus cmcp6 - apo form 0.9278 43 355
1vkz-assembly2.cif.gz_B crystal structure of phosphoribosylamine--glycine ligase (tm1250) from thermotoga maritima at 2.30 a resolution 0.9135 47 74
4ccr-assembly2.cif.gz_D crystal structure of the thioredoxin reductase apoenzyme from entamoeba histolytica in the absence of the nadp cofactor 0.9078 41 353
5u63-assembly1.cif.gz_A crystal structure of putative thioredoxin reductase from haemophilus influenzae 0.8954 42 354
ID Description Score Start End Superfamily
5u63A02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9878 157 283 3.50.50.60
5u63A02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9802 157 283 3.50.50.60
3f8rD02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9728 157 283 3.50.50.60
af_Q39243_53_161_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9708 49 151 3.50.50.60
5uthA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9662 157 283 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A6N6X486-F1-model_v4 deleted 0.9924 148 279
AF-A0A520GV49-F1-model_v4 Thioredoxin-disulfide reductase 0.9867 40 147 GO:0016491
AF-A0A2G6L709-F1-model_v4 Thioredoxin-disulfide reductase 0.9865 43 139 GO:0016491
AF-A0A377M2W4-F1-model_v4 Thioredoxin reductase (EC 1.8.1.9) 0.9861 43 138 GO:0004791
AF-A0A3B0SBF0-F1-model_v4 Thioredoxin reductase (EC 1.8.1.9) 0.9822 43 139 GO:0004791

Feature Viewer

pLDDT pTM Quality
85.35 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map