F338900

General Info

Members Datasets Scaffolds Average Seq Length
226 156 452 164

Family's Representative Sequence

Representative Sequence 3300014969|Ga0157376_11383859|Ga0157376_113838591
Length 185
Sequence MFFRPLHPTLDPPPEIDMETPIIDLESDHYFMGEALRQAARAYEAGEVPIGAVVVREGRIIGRAFNQVELLKDATAHAEMLALTQAEEAVGDWRLTDCTLYVTKEPCPMCAGAVVHVRLVRVVYGVADPKAGAAGSALNLLQFPSLNHRCEITAGVRDSECRTLLQTFFAEQRKKESGPKPGNGN

Samples

Sample ID Description Type Environment
1 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
96 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
98 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
99 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
100 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
101 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
102 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
103 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
104 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
105 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
106 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
107 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
108 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
109 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
112 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
113 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
114 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
115 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
116 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
117 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
118 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
119 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
120 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
121 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
122 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
123 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
124 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
125 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
126 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
127 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
128 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
129 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
130 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
131 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
132 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
133 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
134 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
135 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
136 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
137 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
138 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
139 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
140 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
141 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
142 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
143 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
144 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
146 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
147 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
148 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
149 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
150 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
152 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
153 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
154 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
155 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
156 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.56
Metatranscriptomes 0.44
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.88
Nodule 0
Rhizoplane 1.33
Rhizosphere 96.46
Stem 0
Stem Tuber 0
Unclassified 21.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157376_11383859 3300014969 Unclassified 735
2 JGI24746J21847_1007390 3300001977 Bacteria 1684
3 rootL2_10047848 3300003322 Bacteria 8809
4 JGI25405J52794_10001976 3300003911 Unclassified 3477
5 JGI25405J52794_10002193 3300003911 Bacteria 3329
6 Ga0065712_10249194 3300005290 Bacteria 957
7 Ga0065715_10024728 3300005293 Bacteria 1504
8 Ga0065707_10162315 3300005295 Bacteria 1552
9 Ga0070676_10006802 3300005328 Bacteria 6127
10 Ga0070690_100199737 3300005330 Bacteria 1391
11 Ga0070670_100028880 3300005331 Bacteria 4774
12 Ga0068869_100428141 3300005334 Bacteria 1093
13 Ga0070666_10016137 3300005335 Bacteria 4773
14 Ga0070666_10229642 3300005335 Bacteria 1310
15 Ga0070680_100331141 3300005336 Unclassified 1293
16 Ga0068868_100054661 3300005338 Bacteria 3147
17 Ga0068868_100615319 3300005338 Bacteria 964
18 Ga0070689_100004436 3300005340 Bacteria 9480
19 Ga0070661_100041956 3300005344 Bacteria 3339
20 Ga0070668_100015587 3300005347 Bacteria 5680
21 Ga0070668_100583593 3300005347 Bacteria 976
22 Ga0070669_100012207 3300005353 Bacteria 6097
23 Ga0070675_100015378 3300005354 Bacteria 6049
24 Ga0070675_100848977 3300005354 Bacteria 836
25 Ga0070674_100009467 3300005356 Bacteria 5832
26 Ga0070688_100004799 3300005365 Bacteria 7070
27 Ga0070688_100051833 3300005365 Bacteria 2561
28 Ga0070659_100379580 3300005366 Bacteria 1190
29 Ga0070667_100013883 3300005367 Bacteria 6658
30 Ga0070667_100272868 3300005367 Bacteria 1517
31 Ga0070713_100107403 3300005436 Bacteria 2428
32 Ga0070705_100467291 3300005440 Bacteria 950
33 Ga0070705_101143416 3300005440 Bacteria 639
34 Ga0070678_100033909 3300005456 Bacteria 3550
35 Ga0068867_100050100 3300005459 Bacteria 3076
36 Ga0070706_100030778 3300005467 Bacteria 4947
37 Ga0070707_100001315 3300005468 Bacteria 24451
38 Ga0070707_100012562 3300005468 Bacteria 7910
39 Ga0070707_100213945 3300005468 Unclassified 1878
40 Ga0070707_100641444 3300005468 Bacteria 1025
41 Ga0070698_100003606 3300005471 Bacteria 17018
42 Ga0070698_100905533 3300005471 Unclassified 828
43 Ga0070699_100056575 3300005518 Unclassified 3397
44 Ga0070684_100807259 3300005535 Bacteria 877
45 Ga0070672_100012757 3300005543 Bacteria 5916
46 Ga0070686_100200124 3300005544 Unclassified 1431
47 Ga0070686_100602232 3300005544 Bacteria 866
48 Ga0070686_100904179 3300005544 Bacteria 718
49 Ga0070696_100854517 3300005546 Bacteria 752
50 Ga0070665_100038489 3300005548 Bacteria 4808
51 Ga0070704_100117144 3300005549 Unclassified 2038
52 Ga0068859_100428207 3300005617 Bacteria 1420
53 Ga0068864_100031143 3300005618 Bacteria 4525
54 Ga0068864_100115384 3300005618 Unclassified 2396
55 Ga0068863_100077060 3300005841 Bacteria 3155
56 Ga0068860_100011154 3300005843 Bacteria 8856
57 Ga0068860_101237018 3300005843 Unclassified 767
58 Ga0081455_10000953 3300005937 Bacteria 37056
59 Ga0081455_10379454 3300005937 Unclassified 988
60 Ga0081455_10464104 3300005937 Bacteria 861
61 Ga0070717_10014537 3300006028 Bacteria 6057
62 Ga0070717_10034098 3300006028 Unclassified 4112
63 Ga0070717_10098941 3300006028 Bacteria 2474
64 Ga0070717_10413138 3300006028 Bacteria 1213
65 Ga0075432_10132426 3300006058 Bacteria 945
66 Ga0070715_10107012 3300006163 Bacteria 1313
67 Ga0070716_101401181 3300006173 Unclassified 568
68 Ga0097621_100030723 3300006237 Bacteria 4256
69 Ga0097621_100240827 3300006237 Bacteria 1581
70 Ga0068871_100033641 3300006358 Bacteria 4061
71 Ga0068871_100095037 3300006358 Bacteria 2488
72 Ga0075428_100013741 3300006844 Bacteria 9016
73 Ga0075430_100196661 3300006846 Bacteria 1675
74 Ga0075434_100550563 3300006871 Bacteria 1173
75 Ga0075434_100895493 3300006871 Unclassified 902
76 Ga0075429_100506256 3300006880 Bacteria 1058
77 Ga0068865_100099625 3300006881 Bacteria 2125
78 Ga0097620_100428195 3300006931 Bacteria 1420
79 Ga0105240_10228696 3300009093 Bacteria 2163
80 Ga0111539_10029648 3300009094 Bacteria 6661
81 Ga0111539_10137759 3300009094 Bacteria 2858
82 Ga0111539_10237849 3300009094 Bacteria 2120
83 Ga0114129_10014419 3300009147 Bacteria 11263
84 Ga0114129_10494121 3300009147 Unclassified 1599
85 Ga0105242_10330792 3300009176 Bacteria 1401
86 Ga0105242_10702275 3300009176 Bacteria 990
87 Ga0105249_11695449 3300009553 Bacteria 704
88 Ga0105249_13101829 3300009553 Bacteria 534
89 Ga0157370_10072962 3300013104 Bacteria 3238
90 Ga0157374_10010433 3300013296 Bacteria 7988
91 Ga0157374_10843789 3300013296 Bacteria 933
92 Ga0157374_11516043 3300013296 Unclassified 694
93 Ga0157378_10007440 3300013297 Bacteria 9566
94 Ga0163162_10007511 3300013306 Bacteria 10613
95 Ga0163162_10287244 3300013306 Bacteria 1777
96 Ga0163162_11757221 3300013306 Unclassified 709
97 Ga0157375_10000080 3300013308 Bacteria 96665
98 Ga0157375_10029599 3300013308 Bacteria 5153
99 Ga0157375_10515378 3300013308 Unclassified 1359
100 Ga0157375_11333023 3300013308 Unclassified 844
101 Ga0163163_10030335 3300014325 Bacteria 5209
102 Ga0163163_10046955 3300014325 Unclassified 4243
103 Ga0163163_10443875 3300014325 Unclassified 1357
104 Ga0157380_11413885 3300014326 Unclassified 746
105 Ga0157377_10473171 3300014745 Unclassified 870
106 Ga0157379_11217204 3300014968 Unclassified 725
107 Ga0157376_10565069 3300014969 Bacteria 1127
108 Ga0163161_10627795 3300017792 Unclassified 888
109 Ga0207666_1013257 3300025271 Bacteria 1156
110 Ga0207697_10001050 3300025315 Bacteria 15289
111 Ga0207697_10002980 3300025315 Bacteria 8546
112 Ga0207697_10003071 3300025315 Bacteria 8369
113 Ga0207680_10164038 3300025903 Bacteria 1492
114 Ga0207684_10086869 3300025910 Bacteria 2664
115 Ga0207684_10848992 3300025910 Bacteria 770
116 Ga0207684_11224803 3300025910 Unclassified 621
117 Ga0207649_10101285 3300025920 Bacteria 1907
118 Ga0207646_10000653 3300025922 Bacteria 44777
119 Ga0207646_10070307 3300025922 Bacteria 3126
120 Ga0207646_10275583 3300025922 Bacteria 1520
121 Ga0207646_10286643 3300025922 Unclassified 1488
122 Ga0207646_10315079 3300025922 Unclassified 1413
123 Ga0207681_10017284 3300025923 Bacteria 4527
124 Ga0207681_10072154 3300025923 Bacteria 2410
125 Ga0207659_10148082 3300025926 Bacteria 1830
126 Ga0207700_10265296 3300025928 Bacteria 1472
127 Ga0207644_10094446 3300025931 Bacteria 2234
128 Ga0207644_10479215 3300025931 Bacteria 1025
129 Ga0207669_10018554 3300025937 Bacteria 3599
130 Ga0207691_10002414 3300025940 Bacteria 18290
131 Ga0207651_10159933 3300025960 Bacteria 1764
132 Ga0207668_10205128 3300025972 Bacteria 1572
133 Ga0207668_10498570 3300025972 Bacteria 1047
134 Ga0207658_10250568 3300025986 Bacteria 1504
135 Ga0207677_10071216 3300026023 Bacteria 2453
136 Ga0207677_10306761 3300026023 Bacteria 1313
137 Ga0207641_10909378 3300026088 Bacteria 874
138 Ga0207648_10020551 3300026089 Bacteria 5945
139 Ga0207648_10873554 3300026089 Bacteria 839
140 Ga0207676_11439875 3300026095 Bacteria 685
141 Ga0207675_100537845 3300026118 Bacteria 1166
142 Ga0207683_10219010 3300026121 Bacteria 1734
143 Ga0207428_10135454 3300027907 Bacteria 1883
144 Ga0268266_10020457 3300028379 Bacteria 5640
145 Ga0268265_10329626 3300028380 Bacteria 1386
146 Ga0268265_10418515 3300028380 Unclassified 1243
147 Ga0268264_10170569 3300028381 Bacteria 1967
148 Ga0268264_11253368 3300028381 Unclassified 751
149 Ga0265318_10031598 3300028577 Bacteria 2053
150 Ga0265760_10067652 3300031090 Bacteria 1092
151 Ga0265320_10277251 3300031240 Bacteria 742
152 Ga0265325_10301616 3300031241 Bacteria 715
153 Ga0265327_10003371 3300031251 Bacteria 15379
154 Ga0316575_10178779 3300031665 Unclassified 881
155 Ga0316576_10358249 3300031727 Bacteria 1085
156 Ga0316578_10085347 3300031728 Bacteria 1882
157 Ga0373940_0026872 3300035088 Bacteria 1509
158 Ga0373945_0041671 3300035116 Bacteria 1661
159 Ga0373945_0172746 3300035116 Bacteria 886
160 Ga0373956_0403584 3300035119 Unclassified 652
161 Ga0373943_0093887 3300035170 Bacteria 1558
162 Ga0373927_0336283 3300035695 Bacteria 995
163 Ga0316582_0551629 3300036647 Bacteria 794
164 Ga0373925_1518797 3300037068 Bacteria 548
165 Ga0395905_0883071 3300037471 Bacteria 797
166 Ga0395905_1702459 3300037471 Unclassified 536
167 Ga0451853_2823305 3300041512 Unclassified 958
168 Ga0453684_0576968 3300044712 Bacteria 1236
169 Ga0453684_0617968 3300044712 Bacteria 1186
170 Ga0451576_0076119 3300045051 Bacteria 3493
171 Ga0451576_0123758 3300045051 Unclassified 2694
172 Ga0451576_0956309 3300045051 Bacteria 898
173 Ga0495592_0000034 3300046454 Bacteria 125977
174 Ga0495592_0093828 3300046454 Unclassified 2149
175 Ga0495651_0364369 3300046462 Unclassified 952
176 Ga0495582_0022133 3300046473 Bacteria 3478
177 Ga0495639_0207835 3300046475 Unclassified 960
178 Ga0495662_0019832 3300046476 Bacteria 3252
179 Ga0495664_0026665 3300046477 Bacteria 3366
180 Ga0495594_0289303 3300046499 Unclassified 934
181 Ga0495618_0048094 3300046514 Bacteria 2692
182 Ga0495628_0002699 3300046516 Bacteria 15877
183 Ga0495628_0744875 3300046516 Bacteria 689
184 Ga0495630_0002119 3300046517 Bacteria 13799
185 Ga0495630_0009533 3300046517 Bacteria 6982
186 Ga0495630_0652104 3300046517 Bacteria 806
187 Ga0495630_0944354 3300046517 Unclassified 656
188 Ga0495666_0008383 3300046526 Bacteria 5182
189 Ga0495640_0024362 3300046533 Bacteria 4404
190 Ga0495586_0000512 3300046535 Bacteria 22881
191 Ga0495645_0001374 3300046543 Bacteria 16428
192 Ga0495645_0402326 3300046543 Bacteria 872
193 Ga0495645_0428819 3300046543 Unclassified 838
194 Ga0495667_0464833 3300046559 Unclassified 794
195 Ga0495588_0244000 3300046674 Bacteria 947
196 Ga0495599_0172471 3300046678 Unclassified 1334
197 Ga0495647_0233135 3300046681 Bacteria 815
198 Ga0495658_0082697 3300046683 Bacteria 1887
199 Ga0495613_0797900 3300046689 Unclassified 616
200 Ga0495624_0029383 3300046690 Bacteria 3586
201 Ga0495624_0402829 3300046690 Bacteria 821
202 Ga0495604_0503523 3300047317 Unclassified 785
203 Ga0495674_0004615 3300047319 Bacteria 13241
204 Ga0495674_0026890 3300047319 Bacteria 5262
205 Ga0495676_0050906 3300047321 Bacteria 3318
206 Ga0495675_0101820 3300047444 Bacteria 1797
207 Ga0495684_0379310 3300047471 Unclassified 998
208 Ga0496109_0420810 3300048912 Unclassified 1262
209 Ga0496112_0121774 3300048915 Bacteria 2579
210 Ga0496112_0754525 3300048915 Bacteria 899
211 Ga0496126_0487570 3300048929 Unclassified 987
212 Ga0501298_027055 3300049521 Bacteria 1107
213 Ga0501034_0144721 3300049571 Unclassified 2355
214 Ga0501216_080704 3300049660 Bacteria 688
215 Ga0501217_014205 3300049661 Bacteria 1795
216 Ga0501257_025642 3300049686 Bacteria 1403
217 Ga0501245_046767 3300049708 Bacteria 757
218 Ga0501080_0211049 3300049742 Bacteria 1779
219 Ga0501035_0283776 3300049822 Bacteria 1399
220 Ga0501044_0109053 3300049823 Bacteria 2778
221 Ga0501044_1018009 3300049823 Bacteria 700
222 nmdc:mga05p37_11700_c1 3300050507 Bacteria 10456
223 nmdc:mga09592_321063_c1 3300050508 Bacteria 1341
224 nmdc:mga08y16_25209_c1 3300050511 Bacteria 6270
225 Ga0500643_065372 3300053087 Bacteria 1015
226 Ga0500595_000009 3300053119 Bacteria 278382
227 Ga0157376_11383859
228 JGI24746J21847_1007390
229 rootL2_10047848
230 JGI25405J52794_10001976
231 JGI25405J52794_10002193
232 Ga0065712_10249194
233 Ga0065715_10024728
234 Ga0065707_10162315
235 Ga0070676_10006802
236 Ga0070690_100199737
237 Ga0070670_100028880
238 Ga0068869_100428141
239 Ga0070666_10016137
240 Ga0070666_10229642
241 Ga0070680_100331141
242 Ga0068868_100054661
243 Ga0068868_100615319
244 Ga0070689_100004436
245 Ga0070661_100041956
246 Ga0070668_100015587
247 Ga0070668_100583593
248 Ga0070669_100012207
249 Ga0070675_100015378
250 Ga0070675_100848977
251 Ga0070674_100009467
252 Ga0070688_100004799
253 Ga0070688_100051833
254 Ga0070659_100379580
255 Ga0070667_100013883
256 Ga0070667_100272868
257 Ga0070713_100107403
258 Ga0070705_100467291
259 Ga0070705_101143416
260 Ga0070678_100033909
261 Ga0068867_100050100
262 Ga0070706_100030778
263 Ga0070707_100001315
264 Ga0070707_100012562
265 Ga0070707_100213945
266 Ga0070707_100641444
267 Ga0070698_100003606
268 Ga0070698_100905533
269 Ga0070699_100056575
270 Ga0070684_100807259
271 Ga0070672_100012757
272 Ga0070686_100200124
273 Ga0070686_100602232
274 Ga0070686_100904179
275 Ga0070696_100854517
276 Ga0070665_100038489
277 Ga0070704_100117144
278 Ga0068859_100428207
279 Ga0068864_100031143
280 Ga0068864_100115384
281 Ga0068863_100077060
282 Ga0068860_100011154
283 Ga0068860_101237018
284 Ga0081455_10000953
285 Ga0081455_10379454
286 Ga0081455_10464104
287 Ga0070717_10014537
288 Ga0070717_10034098
289 Ga0070717_10098941
290 Ga0070717_10413138
291 Ga0075432_10132426
292 Ga0070715_10107012
293 Ga0070716_101401181
294 Ga0097621_100030723
295 Ga0097621_100240827
296 Ga0068871_100033641
297 Ga0068871_100095037
298 Ga0075428_100013741
299 Ga0075430_100196661
300 Ga0075434_100550563
301 Ga0075434_100895493
302 Ga0075429_100506256
303 Ga0068865_100099625
304 Ga0097620_100428195
305 Ga0105240_10228696
306 Ga0111539_10029648
307 Ga0111539_10137759
308 Ga0111539_10237849
309 Ga0114129_10014419
310 Ga0114129_10494121
311 Ga0105242_10330792
312 Ga0105242_10702275
313 Ga0105249_11695449
314 Ga0105249_13101829
315 Ga0157370_10072962
316 Ga0157374_10010433
317 Ga0157374_10843789
318 Ga0157374_11516043
319 Ga0157378_10007440
320 Ga0163162_10007511
321 Ga0163162_10287244
322 Ga0163162_11757221
323 Ga0157375_10000080
324 Ga0157375_10029599
325 Ga0157375_10515378
326 Ga0157375_11333023
327 Ga0163163_10030335
328 Ga0163163_10046955
329 Ga0163163_10443875
330 Ga0157380_11413885
331 Ga0157377_10473171
332 Ga0157379_11217204
333 Ga0157376_10565069
334 Ga0163161_10627795
335 Ga0207666_1013257
336 Ga0207697_10001050
337 Ga0207697_10002980
338 Ga0207697_10003071
339 Ga0207680_10164038
340 Ga0207684_10086869
341 Ga0207684_10848992
342 Ga0207684_11224803
343 Ga0207649_10101285
344 Ga0207646_10000653
345 Ga0207646_10070307
346 Ga0207646_10275583
347 Ga0207646_10286643
348 Ga0207646_10315079
349 Ga0207681_10017284
350 Ga0207681_10072154
351 Ga0207659_10148082
352 Ga0207700_10265296
353 Ga0207644_10094446
354 Ga0207644_10479215
355 Ga0207669_10018554
356 Ga0207691_10002414
357 Ga0207651_10159933
358 Ga0207668_10205128
359 Ga0207668_10498570
360 Ga0207658_10250568
361 Ga0207677_10071216
362 Ga0207677_10306761
363 Ga0207641_10909378
364 Ga0207648_10020551
365 Ga0207648_10873554
366 Ga0207676_11439875
367 Ga0207675_100537845
368 Ga0207683_10219010
369 Ga0207428_10135454
370 Ga0268266_10020457
371 Ga0268265_10329626
372 Ga0268265_10418515
373 Ga0268264_10170569
374 Ga0268264_11253368
375 Ga0265318_10031598
376 Ga0265760_10067652
377 Ga0265320_10277251
378 Ga0265325_10301616
379 Ga0265327_10003371
380 Ga0316575_10178779
381 Ga0316576_10358249
382 Ga0316578_10085347
383 Ga0373940_0026872
384 Ga0373945_0041671
385 Ga0373945_0172746
386 Ga0373956_0403584
387 Ga0373943_0093887
388 Ga0373927_0336283
389 Ga0316582_0551629
390 Ga0373925_1518797
391 Ga0395905_0883071
392 Ga0395905_1702459
393 Ga0451853_2823305
394 Ga0453684_0576968
395 Ga0453684_0617968
396 Ga0451576_0076119
397 Ga0451576_0123758
398 Ga0451576_0956309
399 Ga0495592_0000034
400 Ga0495592_0093828
401 Ga0495651_0364369
402 Ga0495582_0022133
403 Ga0495639_0207835
404 Ga0495662_0019832
405 Ga0495664_0026665
406 Ga0495594_0289303
407 Ga0495618_0048094
408 Ga0495628_0002699
409 Ga0495628_0744875
410 Ga0495630_0002119
411 Ga0495630_0009533
412 Ga0495630_0652104
413 Ga0495630_0944354
414 Ga0495666_0008383
415 Ga0495640_0024362
416 Ga0495586_0000512
417 Ga0495645_0001374
418 Ga0495645_0402326
419 Ga0495645_0428819
420 Ga0495667_0464833
421 Ga0495588_0244000
422 Ga0495599_0172471
423 Ga0495647_0233135
424 Ga0495658_0082697
425 Ga0495613_0797900
426 Ga0495624_0029383
427 Ga0495624_0402829
428 Ga0495604_0503523
429 Ga0495674_0004615
430 Ga0495674_0026890
431 Ga0495676_0050906
432 Ga0495675_0101820
433 Ga0495684_0379310
434 Ga0496109_0420810
435 Ga0496112_0121774
436 Ga0496112_0754525
437 Ga0496126_0487570
438 Ga0501298_027055
439 Ga0501034_0144721
440 Ga0501216_080704
441 Ga0501217_014205
442 Ga0501257_025642
443 Ga0501245_046767
444 Ga0501080_0211049
445 Ga0501035_0283776
446 Ga0501044_0109053
447 Ga0501044_1018009
448 nmdc:mga05p37_11700_c1
449 nmdc:mga09592_321063_c1
450 nmdc:mga08y16_25209_c1
451 Ga0500643_065372
452 Ga0500595_000009

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00383

dCMP_cyt_deam_1

Cytidine and deoxycytidylate deaminase zinc-binding region

25

126

0.97

PF14437

MafB19-deam

MafB19-like deaminase

26

173

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2b3j-assembly2.cif.gz_D crystal structure of staphylococcus aureus trna adenosine deaminase, tada, in complex with rna 0.9993 2 144
3ocq-assembly1.cif.gz_A-2 crystal structure of trna-specific adenosine deaminase from salmonella enterica 0.9963 1 139
1z3a-assembly1.cif.gz_B crystal structure of trna adenosine deaminase tada from escherichia coli 0.9931 2 144
7cph-assembly1.cif.gz_A crystal structure of trna adenosine deaminase from bacillus subtilis 0.9924 2 144
8e2q-assembly2.cif.gz_C crystal structure of tadac-1.17 in a complex with ssdna 0.9919 1 139
ID Description Score Start End Superfamily
2b3jA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 1 2 143 3.40.140.10
1z3aA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9917 2 145 3.40.140.10
2nx8A00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9821 2 146 3.40.140.10
1wwrD00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9805 2 143 3.40.140.10
af_O69719_1_151_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9752 2 142 3.40.140.10
ID Description Score Start End GO Terms
AF-A0A2V6GL77-F1-model_v4 tRNA-specific adenosine deaminase (EC 3.5.4.33) 1.003 2 143 GO:0002100
GO:0008270
GO:0052717
AF-A0A538NQV7-F1-model_v4 tRNA-specific adenosine deaminase (EC 3.5.4.33) 1.002 2 148 GO:0002100
GO:0008270
GO:0052717
AF-A0A2V6AMZ1-F1-model_v4 tRNA-specific adenosine deaminase (EC 3.5.4.33) 1.002 2 143 GO:0002100
GO:0008270
GO:0052717
AF-A0A2N9NNQ1-F1-model_v4 tRNA-specific adenosine deaminase (EC 3.5.4.33) 1.002 2 144 GO:0002100
GO:0008270
GO:0052717
AF-A0A1G1QGW9-F1-model_v4 tRNA-specific adenosine deaminase (EC 3.5.4.33) 1.002 1 145 GO:0002100
GO:0008270
GO:0052717

Map