F338676

General Info

Members Datasets Scaffolds Average Seq Length
226 175 452 101

Family's Representative Sequence

Representative Sequence 3300005577|Ga0068857_101989182|Ga0068857_1019891822
Length 118
Sequence VIRHIVMWNLRGDTPGEKAANVELVRRSFHGLRGRVPGLLRIEVGVDTSGADYACDVVLFSEFESQAALDAYATHPEHLRVKQALGDLRIARHQVDYAPEDCHCGPDPQSMDPGSSPG

Samples

Sample ID Description Type Environment
1 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
27 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
49 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
50 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
51 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
52 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
53 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
54 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
55 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
56 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
57 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
58 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
59 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
60 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
61 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
62 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
63 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
64 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
65 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
66 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
67 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
68 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
69 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
70 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
71 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
72 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
73 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
74 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
75 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
76 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
77 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
78 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
79 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
80 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
81 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
82 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
83 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
84 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
85 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
86 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
87 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
88 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
89 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
90 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
91 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
92 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
93 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
94 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
95 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
96 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
97 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
98 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
99 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
100 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
101 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
102 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
103 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
104 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
105 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
106 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
107 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
108 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
109 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
110 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
111 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
112 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
113 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
114 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
115 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
116 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
117 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
118 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
119 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
120 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
121 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
122 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
123 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
124 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
125 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
126 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
127 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
128 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
129 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
130 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
131 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
147 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
148 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
149 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
150 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
151 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
152 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
153 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
154 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
155 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
156 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
157 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
158 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
159 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
161 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
162 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
163 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
164 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
165 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
166 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
167 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
168 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
169 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
170 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
171 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
172 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
173 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
174 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
175 2511231011 Pseudomonas sp. GM30 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.56
Metatranscriptomes 0
Isolates 0.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.87
Nodule 0.88
Rhizoplane 0.88
Rhizosphere 85.84
Stem 0
Stem Tuber 0
Unclassified 9.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068857_101989182 3300005577 Bacteria 570
2 rootH2_10177928 3300003320 Bacteria 1276
3 rootL2_10274398 3300003322 Bacteria 1056
4 Ga0055542_1021962 3300003762 Bacteria 914
5 Ga0065715_10725993 3300005293 Unclassified 641
6 Ga0070690_101261054 3300005330 Unclassified 591
7 Ga0070689_100129722 3300005340 Bacteria 2021
8 Ga0070687_100296443 3300005343 Bacteria 1024
9 Ga0070692_11233144 3300005345 Bacteria 534
10 Ga0070675_102198044 3300005354 Bacteria 508
11 Ga0070701_10069844 3300005438 Bacteria 1875
12 Ga0070705_100002794 3300005440 Bacteria 8698
13 Ga0070705_100132881 3300005440 Bacteria 1626
14 Ga0070694_100048913 3300005444 Bacteria 2845
15 Ga0070694_100373691 3300005444 Bacteria 1110
16 Ga0070708_100293065 3300005445 Bacteria 1532
17 Ga0070681_10010768 3300005458 Bacteria 9038
18 Ga0068867_100517593 3300005459 Bacteria 1028
19 Ga0070699_100286255 3300005518 Bacteria 1477
20 Ga0070679_100063599 3300005530 Bacteria 3678
21 Ga0070697_100033481 3300005536 Bacteria 4139
22 Ga0070697_100371666 3300005536 Bacteria 1237
23 Ga0068853_100958369 3300005539 Bacteria 823
24 Ga0070686_100238610 3300005544 Bacteria 1322
25 Ga0070686_100476645 3300005544 Bacteria 964
26 Ga0070686_100864614 3300005544 Bacteria 733
27 Ga0070695_100005760 3300005545 Bacteria 7299
28 Ga0070695_100189653 3300005545 Bacteria 1462
29 Ga0070695_100200493 3300005545 Bacteria 1426
30 Ga0070695_100994094 3300005545 Bacteria 682
31 Ga0070696_100003968 3300005546 Bacteria 9871
32 Ga0070696_100458666 3300005546 Bacteria 1007
33 Ga0070696_100570431 3300005546 Bacteria 909
34 Ga0070704_100071494 3300005549 Bacteria 2521
35 Ga0070704_100606051 3300005549 Bacteria 963
36 Ga0070704_101273364 3300005549 Bacteria 672
37 Ga0068859_101719822 3300005617 Bacteria 693
38 Ga0075432_10003325 3300006058 Bacteria 5434
39 Ga0075432_10011491 3300006058 Bacteria 3008
40 Ga0097621_100955388 3300006237 Bacteria 800
41 Ga0075430_100235711 3300006846 Unclassified 1517
42 Ga0075436_100000050 3300006914 Bacteria 71245
43 Ga0075436_100030060 3300006914 Bacteria 3738
44 Ga0075436_100040298 3300006914 Bacteria 3224
45 Ga0075436_100064043 3300006914 Bacteria 2541
46 Ga0097620_101720099 3300006931 Bacteria 693
47 Ga0075435_100084763 3300007076 Bacteria 2608
48 Ga0105250_10000660 3300009092 Bacteria 21815
49 Ga0111539_11444680 3300009094 Bacteria 798
50 Ga0105237_12074457 3300009545 Unclassified 577
51 Ga0209148_1001033 3300025254 Bacteria 17411
52 Ga0209455_1001082 3300025272 Bacteria 13412
53 Ga0207696_1001262 3300025711 Bacteria 14192
54 Ga0207655_1000051 3300025728 Bacteria 294176
55 Ga0207713_1001405 3300025735 Bacteria 19438
56 Ga0207688_10218438 3300025901 Bacteria 1147
57 Ga0207707_10000581 3300025912 Bacteria 37114
58 Ga0207662_10351207 3300025918 Bacteria 990
59 Ga0207652_10061105 3300025921 Bacteria 3253
60 Ga0207670_10316364 3300025936 Bacteria 1227
61 Ga0207639_10905477 3300026041 Bacteria 824
62 Ga0207708_10707266 3300026075 Bacteria 862
63 Ga0207674_11311058 3300026116 Bacteria 693
64 Ga0209389_1000116 3300027296 Bacteria 71576
65 Ga0209981_1037264 3300027378 Bacteria 722
66 Ga0207428_10027034 3300027907 Bacteria 4780
67 Ga0207428_10061920 3300027907 Bacteria 2960
68 Ga0265327_10206120 3300031251 Bacteria 889
69 Ga0307513_10000104 3300031456 Bacteria 119239
70 Ga0307513_10510654 3300031456 Bacteria 918
71 Ga0307408_100375443 3300031548 Bacteria 1214
72 Ga0307408_100497894 3300031548 Bacteria 1066
73 Ga0307405_10002191 3300031731 Bacteria 8538
74 Ga0307406_10444472 3300031901 Bacteria 1039
75 Ga0307412_12245902 3300031911 Unclassified 508
76 Ga0307416_100601098 3300032002 Bacteria 1180
77 Ga0307411_10012674 3300032005 Bacteria 4614
78 Ga0373928_0040559 3300035084 Bacteria 1067
79 Ga0373928_0124266 3300035084 Bacteria 694
80 Ga0373932_0224876 3300035112 Bacteria 676
81 Ga0373960_0016434 3300035121 Bacteria 1903
82 Ga0373942_0007927 3300035207 Bacteria 2469
83 Ga0373942_0250048 3300035207 Unclassified 602
84 Ga0373942_0349666 3300035207 Bacteria 522
85 Ga0373961_0019528 3300035241 Bacteria 1782
86 Ga0395905_0030746 3300037471 Bacteria 5057
87 Ga0436365_1574643 3300039437 Unclassified 689
88 Ga0436361_0584111 3300039447 Bacteria 910
89 Ga0439462_0047614 3300042015 Bacteria 1149
90 Ga0450912_002034 3300042116 Bacteria 1318
91 Ga0450890_053900 3300042127 Bacteria 618
92 Ga0450893_0002044 3300042532 Bacteria 3141
93 Ga0466965_0281738 3300044683 Bacteria 898
94 Ga0466957_0397425 3300044842 Viruses 942
95 Ga0451576_0092484 3300045051 Bacteria 3146
96 Ga0495603_0035087 3300046455 Bacteria 3014
97 Ga0495603_0163882 3300046455 Bacteria 1289
98 Ga0495591_172216 3300046458 Unclassified 516
99 Ga0495629_0031162 3300046459 Bacteria 3777
100 Ga0495651_0178460 3300046462 Bacteria 1505
101 Ga0495653_0006242 3300046463 Bacteria 9779
102 Ga0495580_0015193 3300046472 Bacteria 5820
103 Ga0495582_0072130 3300046473 Bacteria 1911
104 Ga0495594_0203387 3300046499 Bacteria 1129
105 Ga0495596_0011002 3300046500 Bacteria 3918
106 Ga0495610_0000297 3300046512 Bacteria 52357
107 Ga0495628_0000464 3300046516 Bacteria 37205
108 Ga0495630_0085425 3300046517 Bacteria 2382
109 Ga0495643_0000578 3300046522 Bacteria 44970
110 Ga0495648_0007865 3300046524 Bacteria 8474
111 Ga0495666_0019982 3300046526 Bacteria 3322
112 Ga0495652_0001163 3300046529 Bacteria 29681
113 Ga0495652_0635931 3300046529 Bacteria 724
114 Ga0495665_0000748 3300046531 Bacteria 16825
115 Ga0495640_0007938 3300046533 Bacteria 8345
116 Ga0495586_0045261 3300046535 Bacteria 2371
117 Ga0495633_0040873 3300046558 Bacteria 2207
118 Ga0495634_0002384 3300046642 Bacteria 15661
119 Ga0495611_0255266 3300046648 Bacteria 812
120 Ga0495661_0031139 3300046665 Bacteria 3389
121 Ga0495588_0121549 3300046674 Bacteria 1376
122 Ga0495599_0165603 3300046678 Bacteria 1365
123 Ga0495623_0069714 3300046679 Bacteria 2191
124 Ga0495646_0000186 3300046680 Bacteria 30935
125 Ga0495613_0003595 3300046689 Bacteria 11617
126 Ga0495624_0005675 3300046690 Bacteria 8957
127 Ga0495671_0040170 3300046692 Bacteria 2360
128 Ga0495589_0020564 3300046794 Bacteria 3375
129 Ga0495600_0035481 3300046809 Bacteria 3239
130 Ga0495604_0002252 3300047317 Bacteria 15457
131 Ga0495674_0003301 3300047319 Bacteria 15673
132 Ga0495676_0064159 3300047321 Bacteria 2859
133 Ga0495680_0023370 3300047322 Bacteria 5141
134 Ga0495683_0073392 3300047323 Bacteria 1678
135 Ga0495675_0008463 3300047444 Bacteria 6377
136 Ga0495679_000266 3300047446 Bacteria 43582
137 Ga0495673_0005347 3300047469 Bacteria 7785
138 Ga0495593_0000185 3300047673 Bacteria 32413
139 Ga0495602_0028667 3300048088 Bacteria 5322
140 Ga0495614_0000384 3300048089 Bacteria 17900
141 Ga0496105_0803059 3300048908 Unclassified 715
142 Ga0496112_1306464 3300048915 Bacteria 641
143 Ga0496116_0011047 3300048919 Bacteria 7510
144 Ga0496117_0317254 3300048920 Unclassified 818
145 Ga0496118_0444350 3300048921 Unclassified 660
146 Ga0496119_0029001 3300048922 Bacteria 3763
147 Ga0496120_0023347 3300048923 Bacteria 3872
148 Ga0496121_0092763 3300048924 Bacteria 2353
149 Ga0496122_0011215 3300048925 Bacteria 9113
150 Ga0496123_0000376 3300048926 Bacteria 83875
151 Ga0496124_0019168 3300048927 Bacteria 6381
152 Ga0496125_0000216 3300048928 Bacteria 117897
153 Ga0496125_0258319 3300048928 Bacteria 1093
154 Ga0496126_0009055 3300048929 Bacteria 10642
155 Ga0495682_0126035 3300049460 Bacteria 916
156 Ga0501031_0021833 3300049568 Bacteria 4171
157 Ga0501032_0038648 3300049569 Bacteria 3249
158 Ga0501032_0911354 3300049569 Unclassified 553
159 Ga0501033_0004223 3300049570 Bacteria 11561
160 Ga0501034_1569603 3300049571 Bacteria 531
161 Ga0501036_0003271 3300049572 Bacteria 12923
162 Ga0501037_0015985 3300049573 Bacteria 5524
163 Ga0501037_0837449 3300049573 Unclassified 606
164 Ga0501038_0001109 3300049574 Bacteria 24402
165 Ga0501039_0008351 3300049575 Bacteria 7892
166 Ga0501039_0112403 3300049575 Bacteria 2129
167 Ga0501040_0001909 3300049576 Bacteria 13402
168 Ga0501040_0044413 3300049576 Bacteria 3029
169 Ga0501040_0408145 3300049576 Bacteria 976
170 Ga0501040_0608759 3300049576 Bacteria 789
171 Ga0501041_0003730 3300049577 Bacteria 8760
172 Ga0501042_0000383 3300049578 Bacteria 22452
173 Ga0501042_0102976 3300049578 Bacteria 2054
174 Ga0501042_1371140 3300049578 Bacteria 516
175 Ga0501043_0014563 3300049579 Bacteria 6158
176 Ga0501046_0001197 3300049580 Bacteria 25219
177 Ga0501046_0074681 3300049580 Bacteria 2630
178 Ga0501047_0904845 3300049581 Bacteria 696
179 Ga0501048_0003180 3300049582 Bacteria 12522
180 Ga0501069_0203767 3300049585 Unclassified 1147
181 Ga0501070_0071252 3300049586 Bacteria 2878
182 Ga0501070_1442117 3300049586 Bacteria 522
183 Ga0501071_0011854 3300049587 Bacteria 5886
184 Ga0501071_0040299 3300049587 Bacteria 3342
185 Ga0501072_0002470 3300049588 Bacteria 13847
186 Ga0501072_0183703 3300049588 Bacteria 1668
187 Ga0501072_1254773 3300049588 Bacteria 575
188 Ga0501074_0014399 3300049590 Bacteria 5757
189 Ga0501074_0796604 3300049590 Bacteria 666
190 Ga0501075_0000525 3300049591 Bacteria 23161
191 Ga0501075_0004827 3300049591 Bacteria 9175
192 Ga0501076_0003062 3300049592 Bacteria 11635
193 Ga0501076_0226776 3300049592 Bacteria 1527
194 Ga0501077_0003141 3300049593 Bacteria 9932
195 Ga0501077_0063081 3300049593 Bacteria 2351
196 Ga0501219_022486 3300049703 Unclassified 556
197 Ga0501079_0000625 3300049741 Bacteria 23469
198 Ga0501079_0309651 3300049741 Bacteria 1236
199 Ga0501080_0140635 3300049742 Bacteria 2232
200 Ga0501081_0000055 3300049743 Bacteria 43227
201 Ga0501083_0091714 3300049744 Bacteria 2006
202 Ga0501044_0645072 3300049823 Unclassified 948
203 Ga0501045_0000901 3300049824 Bacteria 19335
204 Ga0501045_0006242 3300049824 Bacteria 8246
205 nmdc:mga0qj67_830399_c1 3300050509 Unclassified 730
206 nmdc:mga0rr50_353980_c1 3300050513 Bacteria 1235
207 nmdc:mga08x19_24702_c1 3300050514 Bacteria 3738
208 nmdc:mga08x19_280842_c1 3300050514 Bacteria 1154
209 nmdc:mga08x19_55_c1 3300050514 Bacteria 120851
210 nmdc:mga08x19_8450_c2 3300050514 Bacteria 4236
211 Ga0500644_0406895 3300053088 Unclassified 593
212 Ga0500562_024293 3300053108 Bacteria 1584
213 Ga0500569_186241 3300053109 Unclassified 705
214 Ga0500568_0155052 3300053139 Unclassified 847
215 Ga0500568_0203737 3300053139 Bacteria 724
216 Ga0500573_0439805 3300053140 Bacteria 606
217 Ga0500586_038374 3300053145 Bacteria 1614
218 Ga0500616_0111141 3300053153 Bacteria 1323
219 Ga0501084_0002498 3300054114 Bacteria 14797
220 Ga0501084_0262367 3300054114 Bacteria 1458
221 Ga0501084_0336148 3300054114 Unclassified 1276
222 Ga0590071_098329 3300059421 Bacteria 736
223 Ga0501082_0008950 3300060353 Bacteria 8640
224 Ga0501082_0168639 3300060353 Bacteria 1903
225 Ga0530510_0001004 3300061734 Bacteria 18744
226 2511297232 2511231011 Bacteria 6149768
227 Ga0068857_101989182
228 rootH2_10177928
229 rootL2_10274398
230 Ga0055542_1021962
231 Ga0065715_10725993
232 Ga0070690_101261054
233 Ga0070689_100129722
234 Ga0070687_100296443
235 Ga0070692_11233144
236 Ga0070675_102198044
237 Ga0070701_10069844
238 Ga0070705_100002794
239 Ga0070705_100132881
240 Ga0070694_100048913
241 Ga0070694_100373691
242 Ga0070708_100293065
243 Ga0070681_10010768
244 Ga0068867_100517593
245 Ga0070699_100286255
246 Ga0070679_100063599
247 Ga0070697_100033481
248 Ga0070697_100371666
249 Ga0068853_100958369
250 Ga0070686_100238610
251 Ga0070686_100476645
252 Ga0070686_100864614
253 Ga0070695_100005760
254 Ga0070695_100189653
255 Ga0070695_100200493
256 Ga0070695_100994094
257 Ga0070696_100003968
258 Ga0070696_100458666
259 Ga0070696_100570431
260 Ga0070704_100071494
261 Ga0070704_100606051
262 Ga0070704_101273364
263 Ga0068859_101719822
264 Ga0075432_10003325
265 Ga0075432_10011491
266 Ga0097621_100955388
267 Ga0075430_100235711
268 Ga0075436_100000050
269 Ga0075436_100030060
270 Ga0075436_100040298
271 Ga0075436_100064043
272 Ga0097620_101720099
273 Ga0075435_100084763
274 Ga0105250_10000660
275 Ga0111539_11444680
276 Ga0105237_12074457
277 Ga0209148_1001033
278 Ga0209455_1001082
279 Ga0207696_1001262
280 Ga0207655_1000051
281 Ga0207713_1001405
282 Ga0207688_10218438
283 Ga0207707_10000581
284 Ga0207662_10351207
285 Ga0207652_10061105
286 Ga0207670_10316364
287 Ga0207639_10905477
288 Ga0207708_10707266
289 Ga0207674_11311058
290 Ga0209389_1000116
291 Ga0209981_1037264
292 Ga0207428_10027034
293 Ga0207428_10061920
294 Ga0265327_10206120
295 Ga0307513_10000104
296 Ga0307513_10510654
297 Ga0307408_100375443
298 Ga0307408_100497894
299 Ga0307405_10002191
300 Ga0307406_10444472
301 Ga0307412_12245902
302 Ga0307416_100601098
303 Ga0307411_10012674
304 Ga0373928_0040559
305 Ga0373928_0124266
306 Ga0373932_0224876
307 Ga0373960_0016434
308 Ga0373942_0007927
309 Ga0373942_0250048
310 Ga0373942_0349666
311 Ga0373961_0019528
312 Ga0395905_0030746
313 Ga0436365_1574643
314 Ga0436361_0584111
315 Ga0439462_0047614
316 Ga0450912_002034
317 Ga0450890_053900
318 Ga0450893_0002044
319 Ga0466965_0281738
320 Ga0466957_0397425
321 Ga0451576_0092484
322 Ga0495603_0035087
323 Ga0495603_0163882
324 Ga0495591_172216
325 Ga0495629_0031162
326 Ga0495651_0178460
327 Ga0495653_0006242
328 Ga0495580_0015193
329 Ga0495582_0072130
330 Ga0495594_0203387
331 Ga0495596_0011002
332 Ga0495610_0000297
333 Ga0495628_0000464
334 Ga0495630_0085425
335 Ga0495643_0000578
336 Ga0495648_0007865
337 Ga0495666_0019982
338 Ga0495652_0001163
339 Ga0495652_0635931
340 Ga0495665_0000748
341 Ga0495640_0007938
342 Ga0495586_0045261
343 Ga0495633_0040873
344 Ga0495634_0002384
345 Ga0495611_0255266
346 Ga0495661_0031139
347 Ga0495588_0121549
348 Ga0495599_0165603
349 Ga0495623_0069714
350 Ga0495646_0000186
351 Ga0495613_0003595
352 Ga0495624_0005675
353 Ga0495671_0040170
354 Ga0495589_0020564
355 Ga0495600_0035481
356 Ga0495604_0002252
357 Ga0495674_0003301
358 Ga0495676_0064159
359 Ga0495680_0023370
360 Ga0495683_0073392
361 Ga0495675_0008463
362 Ga0495679_000266
363 Ga0495673_0005347
364 Ga0495593_0000185
365 Ga0495602_0028667
366 Ga0495614_0000384
367 Ga0496105_0803059
368 Ga0496112_1306464
369 Ga0496116_0011047
370 Ga0496117_0317254
371 Ga0496118_0444350
372 Ga0496119_0029001
373 Ga0496120_0023347
374 Ga0496121_0092763
375 Ga0496122_0011215
376 Ga0496123_0000376
377 Ga0496124_0019168
378 Ga0496125_0000216
379 Ga0496125_0258319
380 Ga0496126_0009055
381 Ga0495682_0126035
382 Ga0501031_0021833
383 Ga0501032_0038648
384 Ga0501032_0911354
385 Ga0501033_0004223
386 Ga0501034_1569603
387 Ga0501036_0003271
388 Ga0501037_0015985
389 Ga0501037_0837449
390 Ga0501038_0001109
391 Ga0501039_0008351
392 Ga0501039_0112403
393 Ga0501040_0001909
394 Ga0501040_0044413
395 Ga0501040_0408145
396 Ga0501040_0608759
397 Ga0501041_0003730
398 Ga0501042_0000383
399 Ga0501042_0102976
400 Ga0501042_1371140
401 Ga0501043_0014563
402 Ga0501046_0001197
403 Ga0501046_0074681
404 Ga0501047_0904845
405 Ga0501048_0003180
406 Ga0501069_0203767
407 Ga0501070_0071252
408 Ga0501070_1442117
409 Ga0501071_0011854
410 Ga0501071_0040299
411 Ga0501072_0002470
412 Ga0501072_0183703
413 Ga0501072_1254773
414 Ga0501074_0014399
415 Ga0501074_0796604
416 Ga0501075_0000525
417 Ga0501075_0004827
418 Ga0501076_0003062
419 Ga0501076_0226776
420 Ga0501077_0003141
421 Ga0501077_0063081
422 Ga0501219_022486
423 Ga0501079_0000625
424 Ga0501079_0309651
425 Ga0501080_0140635
426 Ga0501081_0000055
427 Ga0501083_0091714
428 Ga0501044_0645072
429 Ga0501045_0000901
430 Ga0501045_0006242
431 nmdc:mga0qj67_830399_c1
432 nmdc:mga0rr50_353980_c1
433 nmdc:mga08x19_24702_c1
434 nmdc:mga08x19_280842_c1
435 nmdc:mga08x19_55_c1
436 nmdc:mga08x19_8450_c2
437 Ga0500644_0406895
438 Ga0500562_024293
439 Ga0500569_186241
440 Ga0500568_0155052
441 Ga0500568_0203737
442 Ga0500573_0439805
443 Ga0500586_038374
444 Ga0500616_0111141
445 Ga0501084_0002498
446 Ga0501084_0262367
447 Ga0501084_0336148
448 Ga0590071_098329
449 Ga0501082_0008950
450 Ga0501082_0168639
451 Ga0530510_0001004
452 2511297232

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07876

Dabb

Stress responsive A/B Barrel Domain

2

99

0.97

PF03992

ABM

Antibiotic biosynthesis monooxygenase

5

84

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
5b0g-assembly1.cif.gz_A-2 polyketide cyclase oac from cannabis sativa, h78s mutant 0.9116 1 95
5b0d-assembly1.cif.gz_B polyketide cyclase oac from cannabis sativa, y27w mutant 0.9086 1 95
5b0c-assembly1.cif.gz_B polyketide cyclase oac from cannabis sativa, y27f mutant 0.9066 1 95
5b0d-assembly1.cif.gz_A polyketide cyclase oac from cannabis sativa, y27w mutant 0.9047 1 95
5b0b-assembly2.cif.gz_B polyketide cyclase oac from cannabis sativa, i7f mutant 0.9043 1 95
ID Description Score Start End Superfamily
af_Q67XD6_47_155_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9128 2 93 3.30.70.100
5b0bD00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9038 1 95 3.30.70.100
af_C0HHH9_33_145_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8926 2 95 3.30.70.100
1si9C00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8842 2 93 3.30.70.100
af_I1LY42_1_101_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8797 2 93 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A521Z4Q9-F1-model_v4 Dabb family protein 0.9937 1 95
AF-R6XVB0-F1-model_v4 deleted 0.9598 1 95
AF-A0A2N2WB01-F1-model_v4 Stress responsive protein 0.9562 1 95
AF-A0A2N2BBC6-F1-model_v4 deleted 0.9525 1 95
AF-A0A239QKN8-F1-model_v4 Stress responsive A/B Barrel Domain 0.9513 1 95

Map