F338664

General Info

Members Datasets Scaffolds Average Seq Length
226 141 452 140

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_101145068|Ga0070665_1011450682
Length 162
Sequence MRPRGPAAYASSPAPGWASSFGPMASRKARPADVEAICGSLPETWFGTSWGDVPTWLVPLRVKGDKGRGFVLHRKPHRSAVDPETGEQYDDLLVIRTANADDKQALVDADGPFFTIDHFNGYNAVLVQQSRLGEITRDELAEVITDAWVATAPKKLVKEFLA

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
25 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
28 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
29 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
36 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
41 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
42 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
44 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
66 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
67 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
69 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
70 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
71 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
72 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
73 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
74 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
75 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
76 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
77 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
78 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
79 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
80 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
81 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
82 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
83 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
84 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
85 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
86 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
87 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
88 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
89 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
90 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
91 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
92 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
93 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
94 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
95 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
96 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
97 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
98 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
99 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
100 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
101 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
102 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
103 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
104 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
105 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
106 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
118 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
119 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
120 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
121 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
122 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
123 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
124 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
125 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
128 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
129 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
130 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
131 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
132 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
133 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
134 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
135 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
136 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
137 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
138 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
139 2643221641 Nocardioides sp. Root122 Isolate Unclassified
140 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
141 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.23
Metatranscriptomes 0.44
Isolates 1.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.04
Nodule 0.44
Rhizoplane 6.19
Rhizosphere 72.12
Stem 0
Stem Tuber 0
Unclassified 2.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_101145068 3300005548 Bacteria 789
2 rootH2_10278876 3300003320 Bacteria 1090
3 rootL2_10224364 3300003322 Bacteria 1598
4 rootH1_10240128 3300003323 Bacteria 2078
5 Ga0070658_10039254 3300005327 Bacteria 3819
6 Ga0070660_101269201 3300005339 Bacteria 625
7 Ga0070660_101333806 3300005339 Unclassified 609
8 Ga0070668_100203852 3300005347 Bacteria 1624
9 Ga0070675_100298798 3300005354 Bacteria 1418
10 Ga0070675_101401191 3300005354 Bacteria 644
11 Ga0070674_101759585 3300005356 Bacteria 561
12 Ga0070659_100013213 3300005366 Bacteria 6141
13 Ga0070667_100263355 3300005367 Bacteria 1544
14 Ga0070663_100275536 3300005455 Bacteria 1339
15 Ga0070662_100151796 3300005457 Bacteria 1804
16 Ga0070662_100336717 3300005457 Bacteria 1233
17 Ga0068867_100469925 3300005459 Bacteria 1075
18 Ga0070699_101134938 3300005518 Bacteria 717
19 Ga0068853_100765409 3300005539 Unclassified 923
20 Ga0070672_101136253 3300005543 Bacteria 695
21 Ga0070702_100253714 3300005615 Bacteria 1194
22 Ga0070702_100565739 3300005615 Bacteria 846
23 Ga0070702_100948848 3300005615 Bacteria 677
24 Ga0068852_100326901 3300005616 Bacteria 1491
25 Ga0068861_100364451 3300005719 Bacteria 1272
26 Ga0068861_101860445 3300005719 Bacteria 598
27 Ga0068863_100713446 3300005841 Bacteria 997
28 Ga0081455_10067612 3300005937 Bacteria 2977
29 Ga0081455_10167307 3300005937 Bacteria 1678
30 Ga0075365_10030382 3300006038 Bacteria 3460
31 Ga0075365_10031946 3300006038 Bacteria 3381
32 Ga0075365_10091370 3300006038 Bacteria 2074
33 Ga0075365_10108057 3300006038 Bacteria 1910
34 Ga0075365_10192219 3300006038 Bacteria 1428
35 Ga0075365_10313530 3300006038 Bacteria 1104
36 Ga0075365_10327585 3300006038 Bacteria 1079
37 Ga0075365_10383516 3300006038 Bacteria 991
38 Ga0075365_11223481 3300006038 Bacteria 528
39 Ga0075368_10084739 3300006042 Bacteria 1292
40 Ga0075368_10180773 3300006042 Bacteria 889
41 Ga0075363_100025191 3300006048 Bacteria 3031
42 Ga0075363_100123620 3300006048 Bacteria 1447
43 Ga0075363_100368126 3300006048 Bacteria 841
44 Ga0075364_10012201 3300006051 Bacteria 5249
45 Ga0075364_10231439 3300006051 Bacteria 1255
46 Ga0075362_10646057 3300006177 Bacteria 549
47 Ga0075367_10092750 3300006178 Bacteria 1839
48 Ga0075370_10101672 3300006353 Bacteria 1664
49 Ga0111539_10617718 3300009094 Bacteria 1262
50 Ga0105245_11302471 3300009098 Bacteria 775
51 Ga0105243_10675092 3300009148 Bacteria 1004
52 Ga0105243_12023227 3300009148 Bacteria 611
53 Ga0105243_12333445 3300009148 Bacteria 573
54 Ga0105237_10327234 3300009545 Bacteria 1536
55 Ga0105239_10370221 3300010375 Bacteria 1619
56 Ga0105246_10259980 3300011119 Bacteria 1382
57 Ga0157322_1010106 3300012490 Bacteria 754
58 Ga0157372_11682327 3300013307 Bacteria 730
59 Ga0157375_10138116 3300013308 Bacteria 2562
60 Ga0163163_10253493 3300014325 Bacteria 1811
61 Ga0163163_10588707 3300014325 Bacteria 1176
62 Ga0163163_11231819 3300014325 Bacteria 811
63 Ga0157380_10564264 3300014326 Bacteria 1119
64 Ga0157380_10853133 3300014326 Bacteria 933
65 Ga0163161_10074928 3300017792 Bacteria 2483
66 Ga0206354_10982737 3300020081 Bacteria 1273
67 Ga0213875_10057095 3300021388 Bacteria 1829
68 Ga0207688_10071833 3300025901 Bacteria 1965
69 Ga0207647_10087934 3300025904 Bacteria 1856
70 Ga0207647_10101906 3300025904 Bacteria 1703
71 Ga0207705_10233153 3300025909 Bacteria 1401
72 Ga0207671_10372248 3300025914 Bacteria 1134
73 Ga0207662_10127174 3300025918 Bacteria 1603
74 Ga0207687_11286734 3300025927 Bacteria 629
75 Ga0207690_10779679 3300025932 Bacteria 789
76 Ga0207706_10484499 3300025933 Bacteria 1068
77 Ga0207706_11101733 3300025933 Bacteria 663
78 Ga0207709_11029596 3300025935 Bacteria 674
79 Ga0207669_10144073 3300025937 Bacteria 1659
80 Ga0207669_10571350 3300025937 Bacteria 915
81 Ga0207691_10078658 3300025940 Bacteria 2968
82 Ga0207667_10453763 3300025949 Bacteria 1302
83 Ga0207712_10819104 3300025961 Unclassified 819
84 Ga0207658_10168811 3300025986 Bacteria 1800
85 Ga0207703_12244685 3300026035 Bacteria 522
86 Ga0207678_10084904 3300026067 Bacteria 2707
87 Ga0207678_11414589 3300026067 Unclassified 615
88 Ga0207708_10337956 3300026075 Bacteria 1233
89 Ga0207708_10366798 3300026075 Bacteria 1185
90 Ga0207676_10896407 3300026095 Bacteria 870
91 Ga0207675_100024703 3300026118 Bacteria 5588
92 Ga0207675_100248722 3300026118 Bacteria 1720
93 Ga0207683_10259580 3300026121 Bacteria 1586
94 Ga0207698_10083864 3300026142 Bacteria 2581
95 Ga0207698_10747274 3300026142 Bacteria 977
96 Ga0207698_11386533 3300026142 Unclassified 718
97 Ga0209813_10130270 3300027866 Bacteria 884
98 Ga0207428_10256728 3300027907 Bacteria 1302
99 Ga0268266_11008214 3300028379 Bacteria 806
100 Ga0268266_11958791 3300028379 Bacteria 560
101 Ga0307405_11062026 3300031731 Bacteria 694
102 Ga0307410_10571403 3300031852 Bacteria 940
103 Ga0307410_11502824 3300031852 Bacteria 593
104 Ga0307412_10685455 3300031911 Bacteria 878
105 Ga0307412_12116656 3300031911 Bacteria 523
106 Ga0307409_100187427 3300031995 Bacteria 1838
107 Ga0307409_100234215 3300031995 Bacteria 1667
108 Ga0307409_100528340 3300031995 Bacteria 1154
109 Ga0307409_101944745 3300031995 Bacteria 618
110 Ga0307414_10836768 3300032004 Bacteria 841
111 Ga0307411_11126132 3300032005 Bacteria 709
112 Ga0395905_0543610 3300037471 Bacteria 1063
113 Ga0395905_0939608 3300037471 Bacteria 768
114 Ga0436364_0821285 3300037853 Bacteria 6996
115 Ga0395901_0713621 3300038443 Bacteria 999
116 Ga0395901_0924220 3300038443 Bacteria 853
117 Ga0451789_0173960 3300041443 Bacteria 507
118 Ga0451802_0622836 3300041460 Bacteria 529
119 Ga0451807_0919280 3300041486 Bacteria 803
120 Ga0451837_0025075 3300041494 Bacteria 1282
121 Ga0451851_0662726 3300041507 Bacteria 551
122 Ga0451843_0876072 3300041509 Bacteria 1127
123 Ga0451843_0951857 3300041509 Bacteria 577
124 Ga0451853_1378446 3300041512 Bacteria 2016
125 Ga0451853_3210711 3300041512 Bacteria 1230
126 Ga0439458_0100706 3300042157 Bacteria 750
127 Ga0466972_0017865 3300044658 Bacteria 3549
128 Ga0466965_0080465 3300044683 Bacteria 1646
129 Ga0466961_0417768 3300044693 Bacteria 813
130 Ga0466971_0550649 3300044719 Bacteria 572
131 Ga0466968_0067737 3300044735 Bacteria 1549
132 Ga0466970_0042346 3300044765 Bacteria 2421
133 Ga0466957_0024737 3300044842 Bacteria 3555
134 Ga0466957_0119508 3300044842 Bacteria 1679
135 Ga0466957_0278914 3300044842 Bacteria 1118
136 Ga0466960_0039011 3300044901 Bacteria 2238
137 Ga0466960_0654744 3300044901 Bacteria 627
138 Ga0466958_0085896 3300045836 Bacteria 1941
139 Ga0466967_0160523 3300045976 Bacteria 2109
140 Ga0466967_0640267 3300045976 Bacteria 1051
141 Ga0466967_0951976 3300045976 Bacteria 854
142 Ga0495582_0484349 3300046473 Bacteria 715
143 Ga0495620_0188432 3300046515 Bacteria 796
144 Ga0495658_0634930 3300046683 Bacteria 684
145 Ga0495613_0997692 3300046689 Bacteria 538
146 Ga0495680_0232298 3300047322 Bacteria 1313
147 Ga0496108_0158102 3300048911 Bacteria 1958
148 Ga0496108_0202512 3300048911 Bacteria 1723
149 Ga0496108_0561010 3300048911 Bacteria 996
150 Ga0496109_0190589 3300048912 Bacteria 1927
151 Ga0496109_0586040 3300048912 Bacteria 1051
152 Ga0496110_0536064 3300048913 Bacteria 1064
153 Ga0496110_0552954 3300048913 Bacteria 1046
154 Ga0496111_0284428 3300048914 Bacteria 1227
155 Ga0496114_0099382 3300048917 Bacteria 2482
156 Ga0496114_0106993 3300048917 Bacteria 2393
157 Ga0496114_0437882 3300048917 Bacteria 1158
158 Ga0496126_0002538 3300048929 Bacteria 24425
159 Ga0496126_0041116 3300048929 Bacteria 4281
160 Ga0501031_0331795 3300049568 Bacteria 985
161 Ga0501031_0640362 3300049568 Bacteria 683
162 Ga0501032_0000526 3300049569 Bacteria 31167
163 Ga0501032_0369223 3300049569 Bacteria 923
164 Ga0501032_0506031 3300049569 Bacteria 772
165 Ga0501034_1102953 3300049571 Bacteria 675
166 Ga0501036_0075207 3300049572 Bacteria 2857
167 Ga0501036_0251230 3300049572 Bacteria 1482
168 Ga0501036_0512312 3300049572 Bacteria 998
169 Ga0501037_0003113 3300049573 Bacteria 12027
170 Ga0501038_0030669 3300049574 Bacteria 4755
171 Ga0501038_0070529 3300049574 Bacteria 2966
172 Ga0501038_0080560 3300049574 Bacteria 2744
173 Ga0501038_0313120 3300049574 Bacteria 1229
174 Ga0501038_0377282 3300049574 Bacteria 1100
175 Ga0501038_0559875 3300049574 Bacteria 869
176 Ga0501039_0001026 3300049575 Bacteria 20381
177 Ga0501039_0016482 3300049575 Bacteria 5660
178 Ga0501039_0101363 3300049575 Bacteria 2247
179 Ga0501040_0228748 3300049576 Bacteria 1324
180 Ga0501040_0762673 3300049576 Bacteria 700
181 Ga0501042_0022820 3300049578 Bacteria 4373
182 Ga0501042_0509554 3300049578 Bacteria 874
183 Ga0501043_0019118 3300049579 Bacteria 5377
184 Ga0501048_0263029 3300049582 Bacteria 1226
185 Ga0501067_0013469 3300049583 Bacteria 4532
186 Ga0501067_0019229 3300049583 Bacteria 3780
187 Ga0501067_0044421 3300049583 Bacteria 2469
188 Ga0501068_0094795 3300049584 Bacteria 1845
189 Ga0501068_0187079 3300049584 Bacteria 1311
190 Ga0501069_0020426 3300049585 Bacteria 3589
191 Ga0501069_0431644 3300049585 Bacteria 782
192 Ga0501070_0167246 3300049586 Bacteria 1812
193 Ga0501070_0299768 3300049586 Bacteria 1309
194 Ga0501070_0340819 3300049586 Bacteria 1218
195 Ga0501070_0673117 3300049586 Bacteria 820
196 Ga0501071_0056606 3300049587 Bacteria 2833
197 Ga0501071_0322206 3300049587 Bacteria 1174
198 Ga0501073_0218697 3300049589 Bacteria 1316
199 Ga0501076_1279879 3300049592 Bacteria 603
200 Ga0501079_0343670 3300049741 Bacteria 1169
201 Ga0501035_0565706 3300049822 Bacteria 930
202 Ga0501044_0945432 3300049823 Bacteria 735
203 Ga0501045_0250014 3300049824 Bacteria 1320
204 nmdc:mga03n38_472049_c1 3300050490 Bacteria 700
205 nmdc:mga03n38_48571_c1 3300050490 Bacteria 1883
206 nmdc:mga03n38_607243_c1 3300050490 Bacteria 624
207 nmdc:mga00v17_114367_c1 3300050491 Bacteria 1714
208 nmdc:mga00v17_80542_c1 3300050491 Bacteria 2032
209 nmdc:mga0yw44_207144_c1 3300050492 Bacteria 1297
210 nmdc:mga0yw44_296262_c1 3300050492 Bacteria 1083
211 nmdc:mga0yw44_31647_c1 3300050492 Bacteria 3078
212 nmdc:mga0yw44_355540_c1 3300050492 Bacteria 987
213 nmdc:mga0yw44_848826_c1 3300050492 Bacteria 620
214 nmdc:mga06z11_81155_c1 3300050494 Bacteria 1740
215 nmdc:mga04h51_136787_c1 3300050495 Bacteria 926
216 nmdc:mga08y16_599172_c1 3300050511 Bacteria 1111
217 Ga0495619_0012418 3300053085 Bacteria 5364
218 Ga0500573_0062188 3300053140 Bacteria 2138
219 Ga0500573_0121702 3300053140 Bacteria 1452
220 Ga0501082_0700767 3300060353 Bacteria 886
221 Ga0466962_0070116 3300061719 Bacteria 1674
222 Ga0530510_0116515 3300061734 Bacteria 1959
223 Ga0530510_1438757 3300061734 Bacteria 529
224 2644230358 2643221641 Bacteria 4490190
225 2946041226 2946037020 Bacteria 4900426
226 8054611198 8054609563 Bacteria 5170090
227 Ga0070665_101145068
228 rootH2_10278876
229 rootL2_10224364
230 rootH1_10240128
231 Ga0070658_10039254
232 Ga0070660_101269201
233 Ga0070660_101333806
234 Ga0070668_100203852
235 Ga0070675_100298798
236 Ga0070675_101401191
237 Ga0070674_101759585
238 Ga0070659_100013213
239 Ga0070667_100263355
240 Ga0070663_100275536
241 Ga0070662_100151796
242 Ga0070662_100336717
243 Ga0068867_100469925
244 Ga0070699_101134938
245 Ga0068853_100765409
246 Ga0070672_101136253
247 Ga0070702_100253714
248 Ga0070702_100565739
249 Ga0070702_100948848
250 Ga0068852_100326901
251 Ga0068861_100364451
252 Ga0068861_101860445
253 Ga0068863_100713446
254 Ga0081455_10067612
255 Ga0081455_10167307
256 Ga0075365_10030382
257 Ga0075365_10031946
258 Ga0075365_10091370
259 Ga0075365_10108057
260 Ga0075365_10192219
261 Ga0075365_10313530
262 Ga0075365_10327585
263 Ga0075365_10383516
264 Ga0075365_11223481
265 Ga0075368_10084739
266 Ga0075368_10180773
267 Ga0075363_100025191
268 Ga0075363_100123620
269 Ga0075363_100368126
270 Ga0075364_10012201
271 Ga0075364_10231439
272 Ga0075362_10646057
273 Ga0075367_10092750
274 Ga0075370_10101672
275 Ga0111539_10617718
276 Ga0105245_11302471
277 Ga0105243_10675092
278 Ga0105243_12023227
279 Ga0105243_12333445
280 Ga0105237_10327234
281 Ga0105239_10370221
282 Ga0105246_10259980
283 Ga0157322_1010106
284 Ga0157372_11682327
285 Ga0157375_10138116
286 Ga0163163_10253493
287 Ga0163163_10588707
288 Ga0163163_11231819
289 Ga0157380_10564264
290 Ga0157380_10853133
291 Ga0163161_10074928
292 Ga0206354_10982737
293 Ga0213875_10057095
294 Ga0207688_10071833
295 Ga0207647_10087934
296 Ga0207647_10101906
297 Ga0207705_10233153
298 Ga0207671_10372248
299 Ga0207662_10127174
300 Ga0207687_11286734
301 Ga0207690_10779679
302 Ga0207706_10484499
303 Ga0207706_11101733
304 Ga0207709_11029596
305 Ga0207669_10144073
306 Ga0207669_10571350
307 Ga0207691_10078658
308 Ga0207667_10453763
309 Ga0207712_10819104
310 Ga0207658_10168811
311 Ga0207703_12244685
312 Ga0207678_10084904
313 Ga0207678_11414589
314 Ga0207708_10337956
315 Ga0207708_10366798
316 Ga0207676_10896407
317 Ga0207675_100024703
318 Ga0207675_100248722
319 Ga0207683_10259580
320 Ga0207698_10083864
321 Ga0207698_10747274
322 Ga0207698_11386533
323 Ga0209813_10130270
324 Ga0207428_10256728
325 Ga0268266_11008214
326 Ga0268266_11958791
327 Ga0307405_11062026
328 Ga0307410_10571403
329 Ga0307410_11502824
330 Ga0307412_10685455
331 Ga0307412_12116656
332 Ga0307409_100187427
333 Ga0307409_100234215
334 Ga0307409_100528340
335 Ga0307409_101944745
336 Ga0307414_10836768
337 Ga0307411_11126132
338 Ga0395905_0543610
339 Ga0395905_0939608
340 Ga0436364_0821285
341 Ga0395901_0713621
342 Ga0395901_0924220
343 Ga0451789_0173960
344 Ga0451802_0622836
345 Ga0451807_0919280
346 Ga0451837_0025075
347 Ga0451851_0662726
348 Ga0451843_0876072
349 Ga0451843_0951857
350 Ga0451853_1378446
351 Ga0451853_3210711
352 Ga0439458_0100706
353 Ga0466972_0017865
354 Ga0466965_0080465
355 Ga0466961_0417768
356 Ga0466971_0550649
357 Ga0466968_0067737
358 Ga0466970_0042346
359 Ga0466957_0024737
360 Ga0466957_0119508
361 Ga0466957_0278914
362 Ga0466960_0039011
363 Ga0466960_0654744
364 Ga0466958_0085896
365 Ga0466967_0160523
366 Ga0466967_0640267
367 Ga0466967_0951976
368 Ga0495582_0484349
369 Ga0495620_0188432
370 Ga0495658_0634930
371 Ga0495613_0997692
372 Ga0495680_0232298
373 Ga0496108_0158102
374 Ga0496108_0202512
375 Ga0496108_0561010
376 Ga0496109_0190589
377 Ga0496109_0586040
378 Ga0496110_0536064
379 Ga0496110_0552954
380 Ga0496111_0284428
381 Ga0496114_0099382
382 Ga0496114_0106993
383 Ga0496114_0437882
384 Ga0496126_0002538
385 Ga0496126_0041116
386 Ga0501031_0331795
387 Ga0501031_0640362
388 Ga0501032_0000526
389 Ga0501032_0369223
390 Ga0501032_0506031
391 Ga0501034_1102953
392 Ga0501036_0075207
393 Ga0501036_0251230
394 Ga0501036_0512312
395 Ga0501037_0003113
396 Ga0501038_0030669
397 Ga0501038_0070529
398 Ga0501038_0080560
399 Ga0501038_0313120
400 Ga0501038_0377282
401 Ga0501038_0559875
402 Ga0501039_0001026
403 Ga0501039_0016482
404 Ga0501039_0101363
405 Ga0501040_0228748
406 Ga0501040_0762673
407 Ga0501042_0022820
408 Ga0501042_0509554
409 Ga0501043_0019118
410 Ga0501048_0263029
411 Ga0501067_0013469
412 Ga0501067_0019229
413 Ga0501067_0044421
414 Ga0501068_0094795
415 Ga0501068_0187079
416 Ga0501069_0020426
417 Ga0501069_0431644
418 Ga0501070_0167246
419 Ga0501070_0299768
420 Ga0501070_0340819
421 Ga0501070_0673117
422 Ga0501071_0056606
423 Ga0501071_0322206
424 Ga0501073_0218697
425 Ga0501076_1279879
426 Ga0501079_0343670
427 Ga0501035_0565706
428 Ga0501044_0945432
429 Ga0501045_0250014
430 nmdc:mga03n38_472049_c1
431 nmdc:mga03n38_48571_c1
432 nmdc:mga03n38_607243_c1
433 nmdc:mga00v17_114367_c1
434 nmdc:mga00v17_80542_c1
435 nmdc:mga0yw44_207144_c1
436 nmdc:mga0yw44_296262_c1
437 nmdc:mga0yw44_31647_c1
438 nmdc:mga0yw44_355540_c1
439 nmdc:mga0yw44_848826_c1
440 nmdc:mga06z11_81155_c1
441 nmdc:mga04h51_136787_c1
442 nmdc:mga08y16_599172_c1
443 Ga0495619_0012418
444 Ga0500573_0062188
445 Ga0500573_0121702
446 Ga0501082_0700767
447 Ga0466962_0070116
448 Ga0530510_0116515
449 Ga0530510_1438757
450 2644230358
451 2946041226
452 8054611198

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2a1v-assembly1.cif.gz_A crystal structure of deinococcus radiodurans protein dr2400, pfam domain duf419 0.7588 4 122
3h9x-assembly1.cif.gz_A crystal structure of the pspto_3016 protein from pseudomonas syringae, northeast structural genomics consortium target psr293 0.6733 4 121
3h9x-assembly1.cif.gz_A crystal structure of the pspto_3016 protein from pseudomonas syringae, northeast structural genomics consortium target psr293 0.6452 4 121
2a1v-assembly1.cif.gz_A crystal structure of deinococcus radiodurans protein dr2400, pfam domain duf419 0.5963 4 122
3p1t-assembly2.cif.gz_D crystal structure of a putative aminotransferase (bpsl1724) from burkholderia pseudomallei k96243 at 2.60 a resolution 0.5695 63 120
ID Description Score Start End Superfamily
af_P9WL91_4_123_3.30.70.1230 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.815 8 132 3.30.70.1230
af_P9WL91_4_123_3.30.70.1230 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.7967 8 132 3.30.70.1230
af_P0AAT2_2_121_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7745 8 122 3.90.1150.30
2a1vA00 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7588 4 122 3.90.1150.30
af_P0AF50_1_117_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.679 5 135 3.90.1150.30
ID Description Score Start End GO Terms
AF-A0A3E0VHV1-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9969 4 137
AF-A0A542GE57-F1-model_v4 YjbR protein 0.9875 45 137
AF-A0A0A0J2G8-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9863 2 136
AF-A0A1V1W3S1-F1-model_v4 YjbR protein 0.9818 1 138
AF-A0A0A0J2S1-F1-model_v4 deleted 0.9787 1 135

Map