F338424

General Info

Members Datasets Scaffolds Average Seq Length
226 164 226 152

Family's Representative Sequence

Representative Sequence 3300003373|JGI25407J50210_10013989|JGI25407J50210_100139891
Length 177
Sequence MAALSAASSGDRARVSPVAFGRRVGPMPLKQGDKAPEFTLPDQDGNSVKLSDLKGRNVLVYFYPKADTPGCTTQACGLRDVLGDIGDTAVLGISPDKPEKQKRFDDKYGLGFPLLSDPDHAVADAYGAWGERSMYGRKFMGIVRSAFLVDEKGNLAEVWPKISPKDTPTKLLAALER

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
76 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
77 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
78 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
79 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
80 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
81 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
83 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
84 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
85 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
88 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
89 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
90 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
91 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
92 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
93 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
94 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
95 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
96 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
97 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
98 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
99 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
100 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
101 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
102 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
103 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
104 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
105 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
106 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
107 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
108 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
109 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
110 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
111 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
112 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
113 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
114 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
115 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
116 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
117 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
118 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
119 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
120 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
121 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
122 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
134 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
135 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
136 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
137 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
138 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
139 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
140 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
141 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
142 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
143 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
144 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
145 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
146 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
147 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
148 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
149 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
150 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
151 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
152 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
153 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
154 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
155 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
156 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
157 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
158 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
159 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
160 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
161 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
162 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
163 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
164 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.56
Metatranscriptomes 0.44
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.21
Nodule 0
Rhizoplane 9.73
Rhizosphere 88.05
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10001103 3300003373 Bacteria 5947
2 JGI25407J50210_10013989 3300003373 Unclassified 2065
3 JGI25405J52794_10078835 3300003911 Bacteria 723
4 Ga0065715_10003401 3300005293 Bacteria 7420
5 Ga0065715_10149048 3300005293 Bacteria 1751
6 Ga0070676_11212494 3300005328 Bacteria 574
7 Ga0070690_100375900 3300005330 Bacteria 1038
8 Ga0068869_100195916 3300005334 Bacteria 1591
9 Ga0070692_10423080 3300005345 Bacteria 846
10 Ga0070668_100431952 3300005347 Bacteria 1129
11 Ga0070674_100062164 3300005356 Bacteria 2608
12 Ga0070674_101083278 3300005356 Bacteria 707
13 Ga0070674_101775990 3300005356 Bacteria 559
14 Ga0070667_100702416 3300005367 Bacteria 936
15 Ga0070714_100135615 3300005435 Bacteria 2204
16 Ga0070701_10664870 3300005438 Bacteria 697
17 Ga0070700_100429398 3300005441 Bacteria 1000
18 Ga0070694_100311429 3300005444 Bacteria 1209
19 Ga0070708_100961779 3300005445 Bacteria 801
20 Ga0070678_100913273 3300005456 Bacteria 803
21 Ga0070662_100031632 3300005457 Bacteria 3715
22 Ga0070681_10019683 3300005458 Bacteria 6760
23 Ga0070695_100055278 3300005545 Bacteria 2558
24 Ga0070696_100083733 3300005546 Bacteria 2262
25 Ga0070665_100214693 3300005548 Bacteria 1925
26 Ga0070702_100020067 3300005615 Bacteria 3496
27 Ga0070702_101734247 3300005615 Bacteria 520
28 Ga0068859_100053391 3300005617 Bacteria 4065
29 Ga0068864_101710192 3300005618 Bacteria 634
30 Ga0068851_10034643 3300005834 Bacteria 2520
31 Ga0068863_100040265 3300005841 Bacteria 4443
32 Ga0068858_100066921 3300005842 Bacteria 3326
33 Ga0068860_100456380 3300005843 Bacteria 1271
34 Ga0068860_101795118 3300005843 Bacteria 635
35 Ga0068860_102075413 3300005843 Bacteria 590
36 Ga0068862_100575156 3300005844 Bacteria 1079
37 Ga0081455_10001185 3300005937 Bacteria 32662
38 Ga0081455_10005863 3300005937 Bacteria 13357
39 Ga0081455_10006725 3300005937 Bacteria 12279
40 Ga0081455_10515145 3300005937 Bacteria 800
41 Ga0081538_10000131 3300005981 Bacteria 77253
42 Ga0081538_10001569 3300005981 Bacteria 23451
43 Ga0081538_10096431 3300005981 Bacteria 1507
44 Ga0081539_10001052 3300005985 Bacteria 50554
45 Ga0075365_10276997 3300006038 Bacteria 1180
46 Ga0075368_10224423 3300006042 Unclassified 799
47 Ga0075428_100089138 3300006844 Bacteria 3365
48 Ga0075428_100321897 3300006844 Bacteria 1662
49 Ga0075430_100068943 3300006846 Bacteria 2967
50 Ga0075431_100009239 3300006847 Bacteria 9895
51 Ga0075433_10000857 3300006852 Bacteria 21328
52 Ga0075434_100152538 3300006871 Bacteria 2330
53 Ga0075434_100194595 3300006871 Bacteria 2048
54 Ga0075434_100736915 3300006871 Bacteria 1003
55 Ga0075436_100434975 3300006914 Bacteria 954
56 Ga0097620_100053391 3300006931 Bacteria 4065
57 Ga0105251_10077357 3300009011 Bacteria 1543
58 Ga0111539_10235141 3300009094 Bacteria 2133
59 Ga0105245_10254575 3300009098 Bacteria 1707
60 Ga0105245_11293406 3300009098 Bacteria 778
61 Ga0105247_10343037 3300009101 Bacteria 1048
62 Ga0114129_10212331 3300009147 Bacteria 2615
63 Ga0114129_11405480 3300009147 Bacteria 861
64 Ga0105243_10773460 3300009148 Bacteria 944
65 Ga0105241_10196139 3300009174 Bacteria 1684
66 Ga0105241_12291184 3300009174 Bacteria 537
67 Ga0105242_10206158 3300009176 Bacteria 1749
68 Ga0105248_10643837 3300009177 Bacteria 1196
69 Ga0105238_11918296 3300009551 Bacteria 625
70 Ga0105239_10084793 3300010375 Bacteria 3490
71 Ga0157378_10988326 3300013297 Bacteria 875
72 Ga0157378_11222990 3300013297 Bacteria 791
73 Ga0163162_10474545 3300013306 Bacteria 1382
74 Ga0163162_11788018 3300013306 Bacteria 702
75 Ga0157375_10004006 3300013308 Bacteria 12778
76 Ga0163163_10021885 3300014325 Bacteria 6042
77 Ga0157380_10979831 3300014326 Bacteria 877
78 Ga0157379_10072274 3300014968 Bacteria 3086
79 Ga0157379_10733462 3300014968 Bacteria 929
80 Ga0207656_10032423 3300025321 Bacteria 2170
81 Ga0207645_10508062 3300025907 Bacteria 816
82 Ga0207694_10305274 3300025924 Bacteria 1311
83 Ga0207687_11102405 3300025927 Bacteria 682
84 Ga0207709_10786278 3300025935 Bacteria 767
85 Ga0207669_10047533 3300025937 Bacteria 2543
86 Ga0207711_10475720 3300025941 Bacteria 1164
87 Ga0207679_11367651 3300025945 Bacteria 650
88 Ga0207668_10647110 3300025972 Bacteria 925
89 Ga0207658_11446324 3300025986 Bacteria 629
90 Ga0207703_10296273 3300026035 Bacteria 1474
91 Ga0207641_10092229 3300026088 Unclassified 2653
92 Ga0207641_10582783 3300026088 Bacteria 1094
93 Ga0207428_10596723 3300027907 Bacteria 796
94 Ga0268266_10171747 3300028379 Bacteria 1968
95 Ga0268265_10379250 3300028380 Bacteria 1300
96 Ga0268264_10645384 3300028381 Bacteria 1047
97 Ga0268264_11097621 3300028381 Bacteria 804
98 Ga0265319_1000037 3300028563 Bacteria 115642
99 Ga0265336_10078399 3300028666 Bacteria 986
100 Ga0265338_10000051 3300028800 Bacteria 211202
101 Ga0265325_10025890 3300031241 Bacteria 3182
102 Ga0307410_10124085 3300031852 Bacteria 1888
103 Ga0307412_10418787 3300031911 Bacteria 1095
104 Ga0307412_10733780 3300031911 Bacteria 851
105 Ga0316593_10035695 3300032168 Unclassified 1636
106 Ga0373931_0239578 3300035691 Bacteria 1099
107 Ga0316584_0093282 3300036712 Unclassified 2254
108 Ga0395898_1495492 3300037466 Bacteria 601
109 Ga0395905_0162725 3300037471 Bacteria 2097
110 Ga0395901_0221626 3300038443 Bacteria 1977
111 Ga0439439_0084026 3300041406 Bacteria 864
112 Ga0451797_0612370 3300041453 Bacteria 915
113 Ga0451802_1818980 3300041460 Bacteria 796
114 Ga0439443_011466 3300042003 Bacteria 1299
115 Ga0439451_052367 3300042009 Bacteria 817
116 Ga0439454_020415 3300042011 Bacteria 971
117 Ga0439456_037194 3300042013 Bacteria 1051
118 Ga0439463_027265 3300042016 Bacteria 1437
119 Ga0439444_0024574 3300042437 Bacteria 1090
120 Ga0466960_0070254 3300044901 Unclassified 1742
121 Ga0495629_0000201 3300046459 Bacteria 53022
122 Ga0495629_0112807 3300046459 Bacteria 1895
123 Ga0495629_0442670 3300046459 Bacteria 880
124 Ga0495662_0043209 3300046476 Bacteria 2175
125 Ga0495608_0000042 3300046511 Bacteria 115906
126 Ga0495652_0000009 3300046529 Bacteria 311000
127 Ga0495640_0114908 3300046533 Bacteria 1755
128 Ga0495645_0004517 3300046543 Bacteria 9499
129 Ga0495667_0159649 3300046559 Bacteria 1450
130 Ga0495634_0153894 3300046642 Bacteria 1452
131 Ga0495657_0000040 3300046675 Bacteria 115899
132 Ga0495647_0278085 3300046681 Bacteria 750
133 Ga0495674_0000024 3300047319 Bacteria 141746
134 Ga0495675_0000036 3300047444 Bacteria 91842
135 Ga0495593_0097056 3300047673 Bacteria 1514
136 Ga0496101_0284850 3300048904 Bacteria 1292
137 Ga0496102_0003440 3300048905 Bacteria 13423
138 Ga0496102_0044889 3300048905 Bacteria 4011
139 Ga0496102_0292178 3300048905 Bacteria 1536
140 Ga0496103_0005548 3300048906 Bacteria 7540
141 Ga0496103_0103702 3300048906 Bacteria 1802
142 Ga0496105_0058375 3300048908 Bacteria 3185
143 Ga0496105_0102402 3300048908 Bacteria 2364
144 Ga0496107_0024157 3300048910 Bacteria 4299
145 Ga0496107_1058975 3300048910 Bacteria 587
146 Ga0496108_0154623 3300048911 Bacteria 1980
147 Ga0496109_0006581 3300048912 Bacteria 9782
148 Ga0496110_0001749 3300048913 Bacteria 16015
149 Ga0496110_0015869 3300048913 Bacteria 6280
150 Ga0496111_0005292 3300048914 Bacteria 8242
151 Ga0496111_0188715 3300048914 Bacteria 1532
152 Ga0496112_0037679 3300048915 Bacteria 4720
153 Ga0496114_0314918 3300048917 Bacteria 1382
154 Ga0496115_0414191 3300048918 Bacteria 1092
155 Ga0496115_0544556 3300048918 Bacteria 928
156 Ga0501032_0230148 3300049569 Bacteria 1205
157 Ga0501033_0046249 3300049570 Bacteria 3236
158 Ga0501036_0007101 3300049572 Bacteria 9110
159 Ga0501036_0222145 3300049572 Bacteria 1586
160 Ga0501036_1054583 3300049572 Bacteria 664
161 Ga0501037_0739624 3300049573 Bacteria 652
162 Ga0501038_0106374 3300049574 Bacteria 2329
163 Ga0501039_0007028 3300049575 Bacteria 8568
164 Ga0501039_0294857 3300049575 Bacteria 1275
165 Ga0501040_0104875 3300049576 Bacteria 1974
166 Ga0501041_0010837 3300049577 Bacteria 5378
167 Ga0501041_0201588 3300049577 Bacteria 1247
168 Ga0501042_0015395 3300049578 Bacteria 5237
169 Ga0501042_0035171 3300049578 Bacteria 3554
170 Ga0501042_0049879 3300049578 Bacteria 2987
171 Ga0501046_0024237 3300049580 Bacteria 4981
172 Ga0501048_0006451 3300049582 Bacteria 8917
173 Ga0501048_0075798 3300049582 Bacteria 2374
174 Ga0501068_0031308 3300049584 Bacteria 3160
175 Ga0501069_0032095 3300049585 Bacteria 2891
176 Ga0501069_0397516 3300049585 Bacteria 815
177 Ga0501069_0561024 3300049585 Bacteria 684
178 Ga0501070_0054589 3300049586 Bacteria 3313
179 Ga0501070_0130798 3300049586 Bacteria 2073
180 Ga0501071_0024801 3300049587 Bacteria 4195
181 Ga0501071_0029494 3300049587 Bacteria 3873
182 Ga0501071_0171646 3300049587 Bacteria 1623
183 Ga0501072_0000649 3300049588 Bacteria 25023
184 Ga0501072_0011389 3300049588 Bacteria 6797
185 Ga0501072_0067822 3300049588 Bacteria 2815
186 Ga0501073_0023764 3300049589 Bacteria 4401
187 Ga0501074_0279397 3300049590 Bacteria 1187
188 Ga0501075_0059356 3300049591 Bacteria 2881
189 Ga0501075_0146138 3300049591 Bacteria 1802
190 Ga0501076_0033949 3300049592 Bacteria 3985
191 Ga0501076_0087156 3300049592 Bacteria 2509
192 Ga0501076_0109346 3300049592 Bacteria 2234
193 Ga0501076_0113256 3300049592 Bacteria 2194
194 Ga0501077_0001509 3300049593 Bacteria 14036
195 Ga0501077_0145740 3300049593 Bacteria 1502
196 Ga0501247_014495 3300049677 Bacteria 978
197 Ga0501079_0026294 3300049741 Bacteria 4462
198 Ga0501079_0094887 3300049741 Bacteria 2312
199 Ga0501080_0019767 3300049742 Bacteria 6236
200 Ga0501080_0797446 3300049742 Bacteria 828
201 Ga0501083_0042383 3300049744 Bacteria 3086
202 Ga0501083_0129194 3300049744 Bacteria 1656
203 Ga0501045_0002729 3300049824 Bacteria 12055
204 nmdc:mga03n38_585467_c1 3300050490 Bacteria 634
205 nmdc:mga0yw44_245281_c1 3300050492 Bacteria 1191
206 nmdc:mga05p37_1250223_c1 3300050507 Bacteria 762
207 nmdc:mga06r32_263351_c1 3300050510 Bacteria 1712
208 nmdc:mga08y16_165338_c1 3300050511 Bacteria 2299
209 nmdc:mga08y16_80049_c1 3300050511 Bacteria 3406
210 nmdc:mga0n895_1096492_c1 3300050512 Bacteria 774
211 nmdc:mga0n895_43590_c2 3300050512 Bacteria 3288
212 nmdc:mga0n895_78035_c1 3300050512 Bacteria 3295
213 nmdc:mga0rr50_20318_c1 3300050513 Bacteria 4506
214 nmdc:mga0a205_1_c2 3300050515 Bacteria 266330
215 Ga0495601_0138213 3300053077 Bacteria 1589
216 Ga0495601_0331841 3300053077 Bacteria 990
217 Ga0495612_0140707 3300053078 Bacteria 1046
218 Ga0495595_0000009 3300053084 Bacteria 193039
219 Ga0495595_0432648 3300053084 Bacteria 668
220 Ga0495619_0000057 3300053085 Bacteria 93948
221 Ga0500641_0001250 3300053096 Bacteria 9041
222 Ga0501084_0002302 3300054114 Bacteria 15350
223 Ga0501084_0139776 3300054114 Bacteria 2039
224 Ga0590071_107869 3300059421 Bacteria 705
225 Ga0501082_0169575 3300060353 Bacteria 1897
226 Ga0530510_0021666 3300061734 Bacteria 4572

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037466 Ga0395898_1495492 Ga0395898_1495492_68_538 132
2 3300037471 Ga0395905_0162725 Ga0395905_0162725_343_813 132
3 3300038443 Ga0395901_0221626 Ga0395901_0221626_795_1265 132
4 3300049592 Ga0501076_0113256 Ga0501076_0113256_69_494 138
5 3300025945 Ga0207679_11367651 Ga0207679_113676511 145
6 3300005356 Ga0070674_101083278 Ga0070674_1010832781 149
7 3300005458 Ga0070681_10019683 Ga0070681_100196834 149
8 3300041453 Ga0451797_0612370 Ga0451797_0612370_15_464 149
9 3300005293 Ga0065715_10149048 Ga0065715_101490482 150
10 3300005345 Ga0070692_10423080 Ga0070692_104230801 150
11 3300005356 Ga0070674_100062164 Ga0070674_1000621642 150
12 3300005367 Ga0070667_100702416 Ga0070667_1007024162 150
13 3300005435 Ga0070714_100135615 Ga0070714_1001356153 150
14 3300005444 Ga0070694_100311429 Ga0070694_1003114291 150
15 3300005445 Ga0070708_100961779 Ga0070708_1009617791 150
16 3300005456 Ga0070678_100913273 Ga0070678_1009132731 150
17 3300005546 Ga0070696_100083733 Ga0070696_1000837333 150
18 3300005548 Ga0070665_100214693 Ga0070665_1002146933 150
19 3300005615 Ga0070702_101734247 Ga0070702_1017342471 150
20 3300005834 Ga0068851_10034643 Ga0068851_100346432 150
21 3300005841 Ga0068863_100040265 Ga0068863_1000402653 150
22 3300005842 Ga0068858_100066921 Ga0068858_1000669212 150
23 3300005843 Ga0068860_101795118 Ga0068860_1017951181 150
24 3300005843 Ga0068860_102075413 Ga0068860_1020754131 150
25 3300005844 Ga0068862_100575156 Ga0068862_1005751562 150
26 3300006038 Ga0075365_10276997 Ga0075365_102769972 150
27 3300006042 Ga0075368_10224423 Ga0075368_102244231 150
28 3300006844 Ga0075428_100089138 Ga0075428_1000891385 150
29 3300006852 Ga0075433_10000857 Ga0075433_1000085718 150
30 3300006871 Ga0075434_100152538 Ga0075434_1001525382 150
31 3300006871 Ga0075434_100194595 Ga0075434_1001945953 150
32 3300009011 Ga0105251_10077357 Ga0105251_100773572 150
33 3300009094 Ga0111539_10235141 Ga0111539_102351412 150
34 3300009098 Ga0105245_11293406 Ga0105245_112934062 150
35 3300009101 Ga0105247_10343037 Ga0105247_103430372 150
36 3300009147 Ga0114129_11405480 Ga0114129_114054801 150
37 3300009148 Ga0105243_10773460 Ga0105243_107734602 150
38 3300009177 Ga0105248_10643837 Ga0105248_106438371 150
39 3300009551 Ga0105238_11918296 Ga0105238_119182961 150
40 3300013306 Ga0163162_10474545 Ga0163162_104745453 150
41 3300013306 Ga0163162_11788018 Ga0163162_117880181 150
42 3300013308 Ga0157375_10004006 Ga0157375_100040068 150
43 3300014325 Ga0163163_10021885 Ga0163163_100218858 150
44 3300014326 Ga0157380_10979831 Ga0157380_109798312 150
45 3300014968 Ga0157379_10072274 Ga0157379_100722743 150
46 3300014968 Ga0157379_10733462 Ga0157379_107334622 150
47 3300025321 Ga0207656_10032423 Ga0207656_100324232 150
48 3300025907 Ga0207645_10508062 Ga0207645_105080622 150
49 3300025924 Ga0207694_10305274 Ga0207694_103052742 150
50 3300025935 Ga0207709_10786278 Ga0207709_107862782 150
51 3300025937 Ga0207669_10047533 Ga0207669_100475334 150
52 3300025941 Ga0207711_10475720 Ga0207711_104757202 150
53 3300025986 Ga0207658_11446324 Ga0207658_114463241 150
54 3300026035 Ga0207703_10296273 Ga0207703_102962732 150
55 3300026088 Ga0207641_10582783 Ga0207641_105827831 150
56 3300027907 Ga0207428_10596723 Ga0207428_105967232 150
57 3300028379 Ga0268266_10171747 Ga0268266_101717472 150
58 3300028380 Ga0268265_10379250 Ga0268265_103792502 150
59 3300028381 Ga0268264_11097621 Ga0268264_110976212 150
60 3300028563 Ga0265319_1000037 Ga0265319_100003771 150
61 3300028666 Ga0265336_10078399 Ga0265336_100783991 150
62 3300028800 Ga0265338_10000051 Ga0265338_10000051172 150
63 3300031241 Ga0265325_10025890 Ga0265325_100258903 150
64 3300046459 Ga0495629_0000201 Ga0495629_0000201_19146_19616 150
65 3300046459 Ga0495629_0112807 Ga0495629_0112807_1290_1769 150
66 3300046459 Ga0495629_0442670 Ga0495629_0442670_69_539 150
67 3300046476 Ga0495662_0043209 Ga0495662_0043209_150_614 150
68 3300046511 Ga0495608_0000042 Ga0495608_0000042_96937_97401 150
69 3300046529 Ga0495652_0000009 Ga0495652_0000009_108184_108654 150
70 3300046533 Ga0495640_0114908 Ga0495640_0114908_259_720 150
71 3300046543 Ga0495645_0004517 Ga0495645_0004517_2007_2477 150
72 3300046559 Ga0495667_0159649 Ga0495667_0159649_376_843 150
73 3300046642 Ga0495634_0153894 Ga0495634_0153894_300_770 150
74 3300046675 Ga0495657_0000040 Ga0495657_0000040_96937_97401 150
75 3300046681 Ga0495647_0278085 Ga0495647_0278085_195_656 150
76 3300047319 Ga0495674_0000024 Ga0495674_0000024_123083_123544 150
77 3300047444 Ga0495675_0000036 Ga0495675_0000036_16523_16987 150
78 3300047673 Ga0495593_0097056 Ga0495593_0097056_19_489 150
79 3300048905 Ga0496102_0044889 Ga0496102_0044889_2027_2485 150
80 3300048905 Ga0496102_0292178 Ga0496102_0292178_476_928 150
81 3300048906 Ga0496103_0103702 Ga0496103_0103702_796_1248 150
82 3300048908 Ga0496105_0102402 Ga0496105_0102402_767_1219 150
83 3300048910 Ga0496107_1058975 Ga0496107_1058975_37_489 150
84 3300048911 Ga0496108_0154623 Ga0496108_0154623_1474_1926 150
85 3300048913 Ga0496110_0015869 Ga0496110_0015869_998_1450 150
86 3300048914 Ga0496111_0188715 Ga0496111_0188715_629_1081 150
87 3300048917 Ga0496114_0314918 Ga0496114_0314918_444_896 150
88 3300048918 Ga0496115_0414191 Ga0496115_0414191_459_911 150
89 3300049569 Ga0501032_0230148 Ga0501032_0230148_687_1139 150
90 3300049570 Ga0501033_0046249 Ga0501033_0046249_646_1098 150
91 3300049572 Ga0501036_0007101 Ga0501036_0007101_5620_6072 150
92 3300049573 Ga0501037_0739624 Ga0501037_0739624_181_633 150
93 3300049574 Ga0501038_0106374 Ga0501038_0106374_109_561 150
94 3300049575 Ga0501039_0007028 Ga0501039_0007028_4159_4611 150
95 3300049575 Ga0501039_0294857 Ga0501039_0294857_302_754 150
96 3300049576 Ga0501040_0104875 Ga0501040_0104875_770_1222 150
97 3300049577 Ga0501041_0201588 Ga0501041_0201588_712_1164 150
98 3300049578 Ga0501042_0015395 Ga0501042_0015395_602_1054 150
99 3300049580 Ga0501046_0024237 Ga0501046_0024237_4243_4695 150
100 3300049582 Ga0501048_0006451 Ga0501048_0006451_3053_3505 150
101 3300049584 Ga0501068_0031308 Ga0501068_0031308_2026_2490 150
102 3300049585 Ga0501069_0032095 Ga0501069_0032095_17_481 150
103 3300049585 Ga0501069_0561024 Ga0501069_0561024_167_619 150
104 3300049586 Ga0501070_0054589 Ga0501070_0054589_2038_2508 150
105 3300049586 Ga0501070_0130798 Ga0501070_0130798_1414_1878 150
106 3300049587 Ga0501071_0024801 Ga0501071_0024801_102_554 150
107 3300049587 Ga0501071_0171646 Ga0501071_0171646_902_1366 150
108 3300049588 Ga0501072_0000649 Ga0501072_0000649_759_1211 150
109 3300049588 Ga0501072_0067822 Ga0501072_0067822_195_659 150
110 3300049589 Ga0501073_0023764 Ga0501073_0023764_3562_4026 150
111 3300049590 Ga0501074_0279397 Ga0501074_0279397_101_553 150
112 3300049591 Ga0501075_0059356 Ga0501075_0059356_229_687 150
113 3300049592 Ga0501076_0087156 Ga0501076_0087156_1192_1644 150
114 3300049593 Ga0501077_0001509 Ga0501077_0001509_7889_8341 150
115 3300049741 Ga0501079_0026294 Ga0501079_0026294_1053_1505 150
116 3300049742 Ga0501080_0019767 Ga0501080_0019767_4988_5452 150
117 3300049742 Ga0501080_0797446 Ga0501080_0797446_187_639 150
118 3300049744 Ga0501083_0042383 Ga0501083_0042383_289_741 150
119 3300049744 Ga0501083_0129194 Ga0501083_0129194_677_1141 150
120 3300049824 Ga0501045_0002729 Ga0501045_0002729_10924_11376 150
121 3300050492 nmdc:mga0yw44_245281_c1 nmdc:mga0yw44_245281_c1_90_542 150
122 3300050511 nmdc:mga08y16_165338_c1 nmdc:mga08y16_165338_c1_614_1069 150
123 3300050512 nmdc:mga0n895_1096492_c1 nmdc:mga0n895_1096492_c1_222_680 150
124 3300050512 nmdc:mga0n895_78035_c1 nmdc:mga0n895_78035_c1_2727_3185 150
125 3300050513 nmdc:mga0rr50_20318_c1 nmdc:mga0rr50_20318_c1_1274_1732 150
126 3300050515 nmdc:mga0a205_1_c2 nmdc:mga0a205_1_c2_251156_251626 150
127 3300053077 Ga0495601_0138213 Ga0495601_0138213_273_752 150
128 3300053077 Ga0495601_0331841 Ga0495601_0331841_374_844 150
129 3300053078 Ga0495612_0140707 Ga0495612_0140707_161_631 150
130 3300053084 Ga0495595_0000009 Ga0495595_0000009_95639_96103 150
131 3300053084 Ga0495595_0432648 Ga0495595_0432648_41_499 150
132 3300053085 Ga0495619_0000057 Ga0495619_0000057_18498_18962 150
133 3300054114 Ga0501084_0002302 Ga0501084_0002302_190_642 150
134 3300059421 Ga0590071_107869 Ga0590071_107869_183_635 150
135 3300060353 Ga0501082_0169575 Ga0501082_0169575_671_1123 150
136 3300061734 Ga0530510_0021666 Ga0530510_0021666_3324_3776 150
137 3300003373 JGI25407J50210_10001103 JGI25407J50210_100011037 151
138 3300003373 JGI25407J50210_10013989 JGI25407J50210_100139891 151
139 3300003911 JGI25405J52794_10078835 JGI25405J52794_100788351 151
140 3300005293 Ga0065715_10003401 Ga0065715_100034015 151
141 3300005328 Ga0070676_11212494 Ga0070676_112124941 151
142 3300005330 Ga0070690_100375900 Ga0070690_1003759002 151
143 3300005334 Ga0068869_100195916 Ga0068869_1001959163 151
144 3300005347 Ga0070668_100431952 Ga0070668_1004319521 151
145 3300005356 Ga0070674_101775990 Ga0070674_1017759901 151
146 3300005438 Ga0070701_10664870 Ga0070701_106648701 151
147 3300005441 Ga0070700_100429398 Ga0070700_1004293982 151
148 3300005457 Ga0070662_100031632 Ga0070662_1000316325 151
149 3300005545 Ga0070695_100055278 Ga0070695_1000552783 151
150 3300005615 Ga0070702_100020067 Ga0070702_1000200672 151
151 3300005617 Ga0068859_100053391 Ga0068859_1000533915 151
152 3300005618 Ga0068864_101710192 Ga0068864_1017101921 151
153 3300005843 Ga0068860_100456380 Ga0068860_1004563802 151
154 3300005937 Ga0081455_10001185 Ga0081455_1000118537 151
155 3300005937 Ga0081455_10005863 Ga0081455_1000586315 151
156 3300005937 Ga0081455_10006725 Ga0081455_100067253 151
157 3300005937 Ga0081455_10515145 Ga0081455_105151452 151
158 3300005981 Ga0081538_10000131 Ga0081538_1000013124 151
159 3300005981 Ga0081538_10001569 Ga0081538_100015698 151
160 3300005981 Ga0081538_10096431 Ga0081538_100964312 151
161 3300005985 Ga0081539_10001052 Ga0081539_1000105245 151
162 3300006844 Ga0075428_100321897 Ga0075428_1003218973 151
163 3300006846 Ga0075430_100068943 Ga0075430_1000689433 151
164 3300006847 Ga0075431_100009239 Ga0075431_1000092397 151
165 3300006871 Ga0075434_100736915 Ga0075434_1007369152 151
166 3300006914 Ga0075436_100434975 Ga0075436_1004349751 151
167 3300006931 Ga0097620_100053391 Ga0097620_1000533915 151
168 3300009098 Ga0105245_10254575 Ga0105245_102545753 151
169 3300009147 Ga0114129_10212331 Ga0114129_102123312 151
170 3300009174 Ga0105241_10196139 Ga0105241_101961392 151
171 3300009174 Ga0105241_12291184 Ga0105241_122911841 151
172 3300009176 Ga0105242_10206158 Ga0105242_102061582 151
173 3300010375 Ga0105239_10084793 Ga0105239_100847932 151
174 3300013297 Ga0157378_10988326 Ga0157378_109883261 151
175 3300013297 Ga0157378_11222990 Ga0157378_112229902 151
176 3300025927 Ga0207687_11102405 Ga0207687_111024052 151
177 3300025972 Ga0207668_10647110 Ga0207668_106471102 151
178 3300026088 Ga0207641_10092229 Ga0207641_100922293 151
179 3300028381 Ga0268264_10645384 Ga0268264_106453842 151
180 3300031852 Ga0307410_10124085 Ga0307410_101240853 151
181 3300031911 Ga0307412_10418787 Ga0307412_104187872 151
182 3300031911 Ga0307412_10733780 Ga0307412_107337802 151
183 3300032168 Ga0316593_10035695 Ga0316593_100356953 151
184 3300035691 Ga0373931_0239578 Ga0373931_0239578_420_881 151
185 3300036712 Ga0316584_0093282 Ga0316584_0093282_344_817 151
186 3300041406 Ga0439439_0084026 Ga0439439_0084026_41_496 151
187 3300041460 Ga0451802_1818980 Ga0451802_1818980_255_719 151
188 3300042003 Ga0439443_011466 Ga0439443_011466_492_947 151
189 3300042009 Ga0439451_052367 Ga0439451_052367_130_585 151
190 3300042011 Ga0439454_020415 Ga0439454_020415_160_615 151
191 3300042013 Ga0439456_037194 Ga0439456_037194_432_887 151
192 3300042016 Ga0439463_027265 Ga0439463_027265_283_738 151
193 3300042437 Ga0439444_0024574 Ga0439444_0024574_486_941 151
194 3300044901 Ga0466960_0070254 Ga0466960_0070254_1186_1641 151
195 3300048904 Ga0496101_0284850 Ga0496101_0284850_740_1201 151
196 3300048905 Ga0496102_0003440 Ga0496102_0003440_1766_2227 151
197 3300048906 Ga0496103_0005548 Ga0496103_0005548_4503_4964 151
198 3300048908 Ga0496105_0058375 Ga0496105_0058375_803_1264 151
199 3300048910 Ga0496107_0024157 Ga0496107_0024157_3708_4169 151
200 3300048912 Ga0496109_0006581 Ga0496109_0006581_9049_9510 151
201 3300048913 Ga0496110_0001749 Ga0496110_0001749_9037_9498 151
202 3300048914 Ga0496111_0005292 Ga0496111_0005292_734_1195 151
203 3300048915 Ga0496112_0037679 Ga0496112_0037679_1643_2104 151
204 3300048918 Ga0496115_0544556 Ga0496115_0544556_195_656 151
205 3300049572 Ga0501036_0222145 Ga0501036_0222145_351_806 151
206 3300049572 Ga0501036_1054583 Ga0501036_1054583_164_619 151
207 3300049577 Ga0501041_0010837 Ga0501041_0010837_4713_5168 151
208 3300049578 Ga0501042_0035171 Ga0501042_0035171_2584_3039 151
209 3300049578 Ga0501042_0049879 Ga0501042_0049879_338_811 151
210 3300049582 Ga0501048_0075798 Ga0501048_0075798_1880_2335 151
211 3300049585 Ga0501069_0397516 Ga0501069_0397516_310_765 151
212 3300049587 Ga0501071_0029494 Ga0501071_0029494_2665_3120 151
213 3300049588 Ga0501072_0011389 Ga0501072_0011389_5946_6401 151
214 3300049591 Ga0501075_0146138 Ga0501075_0146138_886_1341 151
215 3300049592 Ga0501076_0033949 Ga0501076_0033949_884_1339 151
216 3300049592 Ga0501076_0109346 Ga0501076_0109346_153_608 151
217 3300049593 Ga0501077_0145740 Ga0501077_0145740_676_1131 151
218 3300049677 Ga0501247_014495 Ga0501247_014495_157_627 151
219 3300049741 Ga0501079_0094887 Ga0501079_0094887_769_1224 151
220 3300050490 nmdc:mga03n38_585467_c1 nmdc:mga03n38_585467_c1_150_605 151
221 3300050507 nmdc:mga05p37_1250223_c1 nmdc:mga05p37_1250223_c1_50_511 151
222 3300050510 nmdc:mga06r32_263351_c1 nmdc:mga06r32_263351_c1_1039_1494 151
223 3300050511 nmdc:mga08y16_80049_c1 nmdc:mga08y16_80049_c1_2083_2538 151
224 3300050512 nmdc:mga0n895_43590_c2 nmdc:mga0n895_43590_c2_313_774 151
225 3300053096 Ga0500641_0001250 Ga0500641_0001250_7091_7573 151
226 3300054114 Ga0501084_0139776 Ga0501084_0139776_572_1027 151

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

31

158

0.98

PF08534

Redoxin

Redoxin

30

175

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ixr-assembly1.cif.gz_A crystal structure of xylella fastidiosa prxq c47s mutant 0.9272 1 150
5iph-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - c84s mutant 0.9254 5 150
5io2-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - c48s mutant 0.9216 5 150
3gkm-assembly1.cif.gz_A insights into the alkyl peroxide reduction activity of xanthomonas campestris bacterioferritin comigratory protein from the trapped intermediate/ligand complex structures 0.9169 4 150
5enu-assembly2.cif.gz_B crystal structure of an alkyl hyroperoxide reductase from burkholderia ambifaria 0.9167 1 150
ID Description Score Start End Superfamily
af_P0AE52_4_156_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9577 3 150 3.40.30.10
af_Q2G280_3_151_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9552 4 149 3.40.30.10
af_P9WIE1_7_157_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9523 3 151 3.40.30.10
af_Q5A7P9_48_194_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9417 7 150 3.40.30.10
5iphA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9406 12 150 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7C5ZL42-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9862 14 149 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A136LJL8-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9858 1 150 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A1F8SL95-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9843 1 128 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A3M1LPF9-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9834 1 150 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A5C6AGX7-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9815 1 150 GO:0005737
GO:0008379
GO:0034599
GO:0045454

Feature Viewer

pLDDT pTM Quality
96.88 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map