F338296

General Info

Members Datasets Scaffolds Average Seq Length
225 142 225 80

Family's Representative Sequence

Representative Sequence 3300053140|Ga0500573_0096350|Ga0500573_0096350_542_775
Length 77
Sequence MTESGDKKQLLHLVFGGELTSLTEVQFHDLSKLDIVGIFPDYATALTAWKAKAHQTVDNAHMRYFIVHMHRLLTPDV

Samples

Sample ID Description Type Environment
1 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
61 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
62 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
94 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
95 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
96 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
97 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
98 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
99 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
100 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
101 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
103 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
108 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
109 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
110 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
111 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
112 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
113 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
114 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
115 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
116 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
117 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
118 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
119 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
120 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
121 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
122 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
123 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
124 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
130 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
132 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
133 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
134 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
135 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
136 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
137 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
138 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
139 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
140 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
141 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
142 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.11
Nodule 0
Rhizoplane 3.11
Rhizosphere 79.11
Stem 0
Stem Tuber 0
Unclassified 2.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25157J39369_1030287 3300002741 Bacteria 618
2 JGI25153J46596_10056419 3300003215 Bacteria 1093
3 Ga0055530_10000597 3300003791 Bacteria 31200
4 Ga0055531_10001491 3300003794 Bacteria 17203
5 Ga0055531_10024174 3300003794 Bacteria 2251
6 Ga0055543_1024591 3300004625 Bacteria 1080
7 Ga0065165_1000216 3300005262 Bacteria 100208
8 Ga0070658_10053207 3300005327 Bacteria 3285
9 Ga0070658_11057283 3300005327 Bacteria 706
10 Ga0070666_10143226 3300005335 Bacteria 1665
11 Ga0070666_10256814 3300005335 Bacteria 1238
12 Ga0070666_10328205 3300005335 Bacteria 1092
13 Ga0070680_100034849 3300005336 Bacteria 4060
14 Ga0070660_101560291 3300005339 Bacteria 562
15 Ga0070689_100869901 3300005340 Bacteria 796
16 Ga0070668_100005176 3300005347 Bacteria 9673
17 Ga0070671_101092842 3300005355 Bacteria 700
18 Ga0070667_100008995 3300005367 Bacteria 8267
19 Ga0070662_100834653 3300005457 Bacteria 784
20 Ga0070681_10299083 3300005458 Bacteria 1519
21 Ga0070681_10772174 3300005458 Bacteria 878
22 Ga0070679_100078274 3300005530 Bacteria 3295
23 Ga0070679_101246700 3300005530 Bacteria 689
24 Ga0068853_101382712 3300005539 Bacteria 681
25 Ga0070672_101703666 3300005543 Bacteria 566
26 Ga0070665_100003128 3300005548 Bacteria 17825
27 Ga0070665_101448601 3300005548 Bacteria 696
28 Ga0068855_100081192 3300005563 Bacteria 3759
29 Ga0068855_100183081 3300005563 Bacteria 2367
30 Ga0068855_100574652 3300005563 Bacteria 1218
31 Ga0068854_100676780 3300005578 Bacteria 888
32 Ga0068856_100664385 3300005614 Bacteria 1063
33 Ga0068856_101492214 3300005614 Bacteria 690
34 Ga0068852_100029921 3300005616 Bacteria 4477
35 Ga0068852_100670090 3300005616 Bacteria 1046
36 Ga0068852_101633844 3300005616 Bacteria 667
37 Ga0068859_100794880 3300005617 Bacteria 1034
38 Ga0068864_100107704 3300005618 Bacteria 2479
39 Ga0068861_100353788 3300005719 Bacteria 1289
40 Ga0068863_100722867 3300005841 Bacteria 990
41 Ga0068858_100098945 3300005842 Bacteria 2719
42 Ga0068862_100021389 3300005844 Bacteria 5405
43 Ga0068862_101230199 3300005844 Bacteria 748
44 Ga0075368_10001166 3300006042 Bacteria 8293
45 Ga0075363_100148456 3300006048 Bacteria 1322
46 Ga0075364_10005215 3300006051 Bacteria 7543
47 Ga0075362_10131113 3300006177 Bacteria 1192
48 Ga0075362_10183522 3300006177 Bacteria 1014
49 Ga0075367_10003778 3300006178 Bacteria 7297
50 Ga0075366_10167526 3300006195 Unclassified 1332
51 Ga0075370_10227014 3300006353 Unclassified 1104
52 Ga0097620_100794713 3300006931 Bacteria 1034
53 Ga0105240_10025626 3300009093 Bacteria 7745
54 Ga0105240_10032588 3300009093 Bacteria 6746
55 Ga0105240_10114507 3300009093 Bacteria 3257
56 Ga0105240_10223974 3300009093 Bacteria 2189
57 Ga0105240_10388086 3300009093 Bacteria 1575
58 Ga0105240_10621033 3300009093 Bacteria 1188
59 Ga0105240_10877315 3300009093 Bacteria 967
60 Ga0105240_11113389 3300009093 Bacteria 840
61 Ga0105240_12403770 3300009093 Bacteria 545
62 Ga0105247_10331948 3300009101 Bacteria 1064
63 Ga0105243_10769766 3300009148 Bacteria 946
64 Ga0105241_10945717 3300009174 Bacteria 803
65 Ga0105242_10017982 3300009176 Bacteria 5522
66 Ga0105248_10027415 3300009177 Bacteria 6342
67 Ga0105248_10126944 3300009177 Bacteria 2877
68 Ga0105237_10104220 3300009545 Bacteria 2828
69 Ga0105237_10991681 3300009545 Bacteria 847
70 Ga0105237_11770266 3300009545 Bacteria 625
71 Ga0105238_10011022 3300009551 Bacteria 9089
72 Ga0105238_10017364 3300009551 Bacteria 7309
73 Ga0105238_10358699 3300009551 Bacteria 1447
74 Ga0105238_10598866 3300009551 Bacteria 1110
75 Ga0105238_10826378 3300009551 Bacteria 943
76 Ga0105249_10122229 3300009553 Bacteria 2476
77 Ga0105249_10888897 3300009553 Bacteria 957
78 Ga0105239_10100806 3300010375 Bacteria 3194
79 Ga0105239_10734887 3300010375 Bacteria 1129
80 Ga0157373_10298225 3300013100 Bacteria 1144
81 Ga0157369_10742999 3300013105 Bacteria 1010
82 Ga0157374_11756448 3300013296 Bacteria 645
83 Ga0163162_10966732 3300013306 Bacteria 962
84 Ga0157372_10040416 3300013307 Bacteria 5152
85 Ga0157375_13407846 3300013308 Bacteria 529
86 Ga0163163_10342928 3300014325 Bacteria 1549
87 Ga0163163_10398445 3300014325 Bacteria 1434
88 Ga0157380_10918692 3300014326 Bacteria 903
89 Ga0157379_12054270 3300014968 Bacteria 565
90 Ga0157376_10810589 3300014969 Bacteria 949
91 Ga0163161_10657969 3300017792 Bacteria 869
92 Ga0209026_1001727 3300025250 Bacteria 9097
93 Ga0209758_1000516 3300025297 Bacteria 62036
94 Ga0209050_1000090 3300025298 Bacteria 253783
95 Ga0209257_1000059 3300025304 Bacteria 378097
96 Ga0209257_1001000 3300025304 Bacteria 38276
97 Ga0207656_10606615 3300025321 Bacteria 559
98 Ga0207710_10695991 3300025900 Bacteria 533
99 Ga0207680_10324018 3300025903 Bacteria 1078
100 Ga0207680_10914663 3300025903 Bacteria 629
101 Ga0207705_10085410 3300025909 Bacteria 2305
102 Ga0207654_10313649 3300025911 Bacteria 1070
103 Ga0207654_10583122 3300025911 Bacteria 797
104 Ga0207707_10095609 3300025912 Bacteria 2597
105 Ga0207695_10002571 3300025913 Bacteria 26664
106 Ga0207695_10003047 3300025913 Bacteria 24012
107 Ga0207695_10023882 3300025913 Bacteria 6898
108 Ga0207695_10144280 3300025913 Bacteria 2326
109 Ga0207695_10615376 3300025913 Bacteria 967
110 Ga0207695_11201045 3300025913 Bacteria 639
111 Ga0207671_11338366 3300025914 Bacteria 557
112 Ga0207660_10138243 3300025917 Bacteria 1860
113 Ga0207657_10829398 3300025919 Bacteria 714
114 Ga0207657_11014122 3300025919 Bacteria 636
115 Ga0207694_10007350 3300025924 Bacteria 8355
116 Ga0207694_10043773 3300025924 Bacteria 3455
117 Ga0207694_10629019 3300025924 Bacteria 904
118 Ga0207694_10645078 3300025924 Bacteria 892
119 Ga0207694_11044498 3300025924 Bacteria 691
120 Ga0207644_10582786 3300025931 Bacteria 928
121 Ga0207706_10447083 3300025933 Bacteria 1118
122 Ga0207711_10011798 3300025941 Bacteria 7260
123 Ga0207711_10926770 3300025941 Bacteria 809
124 Ga0207679_10934521 3300025945 Bacteria 794
125 Ga0207667_10051460 3300025949 Bacteria 4342
126 Ga0207667_10266504 3300025949 Bacteria 1751
127 Ga0207712_10079191 3300025961 Bacteria 2386
128 Ga0207712_10333134 3300025961 Bacteria 1256
129 Ga0207668_10000019 3300025972 Bacteria 152108
130 Ga0207640_11969331 3300025981 Bacteria 529
131 Ga0207658_10007356 3300025986 Bacteria 7505
132 Ga0207639_12166776 3300026041 Bacteria 517
133 Ga0207641_10173264 3300026088 Bacteria 1971
134 Ga0207648_11613675 3300026089 Bacteria 610
135 Ga0207676_10085959 3300026095 Bacteria 2568
136 Ga0207675_100437454 3300026118 Bacteria 1294
137 Ga0207698_10059650 3300026142 Bacteria 2963
138 Ga0207698_11486166 3300026142 Bacteria 693
139 Ga0209813_10006319 3300027866 Bacteria 2921
140 Ga0268266_10002885 3300028379 Bacteria 17854
141 Ga0268266_10207645 3300028379 Bacteria 1795
142 Ga0268265_10065846 3300028380 Bacteria 2798
143 Ga0307517_10006713 3300028786 Bacteria 16943
144 Ga0265338_10212999 3300028800 Bacteria 1449
145 Ga0307511_10015098 3300030521 Bacteria 7493
146 Ga0307513_10210810 3300031456 Bacteria 1774
147 Ga0307412_11159021 3300031911 Bacteria 690
148 Ga0307412_11429698 3300031911 Unclassified 627
149 Ga0307415_101590769 3300032126 Bacteria 628
150 Ga0373936_0267654 3300035113 Bacteria 766
151 Ga0373935_0010713 3300035692 Bacteria 5507
152 Ga0373925_0033849 3300037068 Bacteria 3765
153 Ga0373925_0714585 3300037068 Unclassified 826
154 Ga0395899_0000091 3300037312 Bacteria 154780
155 Ga0395899_0025887 3300037312 Bacteria 4428
156 Ga0395899_0043189 3300037312 Bacteria 3363
157 Ga0395899_0378933 3300037312 Bacteria 940
158 Ga0395899_0934298 3300037312 Bacteria 527
159 Ga0395900_0000008 3300037418 Bacteria 480459
160 Ga0395900_0007219 3300037418 Bacteria 11511
161 Ga0395900_0811791 3300037418 Bacteria 863
162 Ga0395900_1641647 3300037418 Bacteria 554
163 Ga0395898_0011923 3300037466 Bacteria 9004
164 Ga0395898_0485993 3300037466 Bacteria 1175
165 Ga0395905_0053492 3300037471 Bacteria 3778
166 Ga0395905_0066489 3300037471 Bacteria 3376
167 Ga0395905_0070543 3300037471 Bacteria 3274
168 Ga0395905_0274547 3300037471 Bacteria 1572
169 Ga0395905_0428644 3300037471 Bacteria 1219
170 Ga0395905_0465106 3300037471 Bacteria 1163
171 Ga0395905_1106606 3300037471 Bacteria 695
172 Ga0395905_1345890 3300037471 Bacteria 618
173 Ga0395905_1652102 3300037471 Bacteria 546
174 Ga0395901_0000008 3300038443 Bacteria 495962
175 Ga0395901_0139293 3300038443 Bacteria 2550
176 Ga0395901_0327721 3300038443 Bacteria 1583
177 Ga0395901_1363326 3300038443 Bacteria 669
178 Ga0436363_1583560 3300039450 Bacteria 975
179 Ga0451789_0557030 3300041443 Bacteria 565
180 Ga0466966_0860014 3300044684 Bacteria 547
181 Ga0453684_0672011 3300044712 Bacteria 1128
182 Ga0466968_0605979 3300044735 Bacteria 553
183 Ga0495643_0375256 3300046522 Bacteria 632
184 Ga0495665_0264082 3300046531 Bacteria 885
185 Ga0495598_0419467 3300046537 Bacteria 526
186 Ga0495621_0037772 3300046539 Bacteria 1681
187 Ga0495668_0126981 3300046616 Bacteria 1396
188 Ga0495668_0312946 3300046616 Bacteria 861
189 Ga0495668_0624780 3300046616 Bacteria 595
190 Ga0495635_0873747 3300046663 Bacteria 577
191 Ga0495669_0111031 3300046684 Bacteria 1280
192 Ga0495686_0031217 3300047472 Bacteria 3456
193 Ga0496104_1822201 3300048907 Bacteria 511
194 Ga0496110_1790287 3300048913 Unclassified 524
195 Ga0496112_0182913 3300048915 Bacteria 2060
196 Ga0496112_1395331 3300048915 Bacteria 615
197 Ga0496115_0025192 3300048918 Bacteria 4630
198 Ga0496115_0142217 3300048918 Bacteria 1980
199 Ga0501034_0443957 3300049571 Bacteria 1216
200 Ga0501036_1604889 3300049572 Bacteria 525
201 Ga0501037_0499823 3300049573 Bacteria 825
202 Ga0501047_0000963 3300049581 Bacteria 29103
203 Ga0501047_0138026 3300049581 Bacteria 2318
204 Ga0501047_0632008 3300049581 Bacteria 891
205 Ga0501048_0063483 3300049582 Bacteria 2612
206 Ga0501080_0537712 3300049742 Bacteria 1042
207 Ga0501035_0058907 3300049822 Bacteria 3421
208 Ga0501035_0852431 3300049822 Bacteria 725
209 Ga0501044_0001576 3300049823 Bacteria 26677
210 Ga0501044_1369140 3300049823 Bacteria 573
211 nmdc:mga03683_122117_c1 3300050489 Bacteria 1159
212 nmdc:mga00v17_1418_c1 3300050491 Bacteria 12587
213 nmdc:mga0k408_31876_c1 3300050493 Bacteria 3012
214 nmdc:mga0k408_56820_c1 3300050493 Bacteria 2271
215 nmdc:mga06z11_831716_c1 3300050494 Unclassified 563
216 nmdc:mga04h51_11900_c1 3300050495 Bacteria 2428
217 nmdc:mga07m45_4224_c1 3300050496 Bacteria 7028
218 nmdc:mga07m45_76625_c1 3300050496 Bacteria 1907
219 nmdc:mga07m45_85902_c1 3300050496 Bacteria 1799
220 Ga0500643_009820 3300053087 Bacteria 3622
221 Ga0500562_000468 3300053108 Bacteria 9787
222 Ga0500595_035805 3300053119 Bacteria 1632
223 Ga0500595_077867 3300053119 Bacteria 975
224 Ga0500573_0096350 3300053140 Bacteria 1667
225 Ga0500645_136336 3300053730 Bacteria 680

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005844 Ga0068862_101230199 Ga0068862_1012301992 72
2 3300009551 Ga0105238_10826378 Ga0105238_108263782 72
3 3300013296 Ga0157374_11756448 Ga0157374_117564482 72
4 3300025924 Ga0207694_10645078 Ga0207694_106450782 72
5 3300009174 Ga0105241_10945717 Ga0105241_109457172 73
6 3300025911 Ga0207654_10313649 Ga0207654_103136492 73
7 3300049581 Ga0501047_0632008 Ga0501047_0632008_252_503 73
8 3300049823 Ga0501044_1369140 Ga0501044_1369140_289_540 73
9 3300053140 Ga0500573_0096350 Ga0500573_0096350_542_775 73
10 3300009177 Ga0105248_10027415 Ga0105248_100274154 74
11 3300025941 Ga0207711_10011798 Ga0207711_100117984 74
12 3300013306 Ga0163162_10966732 Ga0163162_109667322 75
13 3300014326 Ga0157380_10918692 Ga0157380_109186922 75
14 3300005335 Ga0070666_10328205 Ga0070666_103282051 76
15 3300005617 Ga0068859_100794880 Ga0068859_1007948803 76
16 3300006042 Ga0075368_10001166 Ga0075368_100011667 76
17 3300006051 Ga0075364_10005215 Ga0075364_100052153 76
18 3300006178 Ga0075367_10003778 Ga0075367_100037788 76
19 3300006195 Ga0075366_10167526 Ga0075366_101675263 76
20 3300006353 Ga0075370_10227014 Ga0075370_102270142 76
21 3300006931 Ga0097620_100794713 Ga0097620_1007947132 76
22 3300027866 Ga0209813_10006319 Ga0209813_100063192 76
23 3300037068 Ga0373925_0714585 Ga0373925_0714585_63_296 76
24 3300037312 Ga0395899_0000091 Ga0395899_0000091_84165_84416 76
25 3300037418 Ga0395900_0000008 Ga0395900_0000008_409844_410095 76
26 3300037466 Ga0395898_0011923 Ga0395898_0011923_2442_2693 76
27 3300037471 Ga0395905_0070543 Ga0395905_0070543_2250_2501 76
28 3300038443 Ga0395901_0000008 Ga0395901_0000008_70365_70616 76
29 3300044735 Ga0466968_0605979 Ga0466968_0605979_115_348 76
30 3300046684 Ga0495669_0111031 Ga0495669_0111031_954_1187 76
31 3300050491 nmdc:mga00v17_1418_c1 nmdc:mga00v17_1418_c1_10075_10308 76
32 3300050493 nmdc:mga0k408_31876_c1 nmdc:mga0k408_31876_c1_2567_2800 76
33 3300050493 nmdc:mga0k408_56820_c1 nmdc:mga0k408_56820_c1_415_648 76
34 3300050494 nmdc:mga06z11_831716_c1 nmdc:mga06z11_831716_c1_139_372 76
35 3300050495 nmdc:mga04h51_11900_c1 nmdc:mga04h51_11900_c1_953_1186 76
36 3300050496 nmdc:mga07m45_4224_c1 nmdc:mga07m45_4224_c1_3515_3748 76
37 3300050496 nmdc:mga07m45_76625_c1 nmdc:mga07m45_76625_c1_1579_1812 76
38 3300049571 Ga0501034_0443957 Ga0501034_0443957_892_1131 77
39 3300053119 Ga0500595_077867 Ga0500595_077867_373_627 77
40 3300005335 Ga0070666_10143226 Ga0070666_101432261 78
41 3300005347 Ga0070668_100005176 Ga0070668_10000517610 78
42 3300005367 Ga0070667_100008995 Ga0070667_1000089956 78
43 3300005548 Ga0070665_100003128 Ga0070665_1000031284 78
44 3300005618 Ga0068864_100107704 Ga0068864_1001077043 78
45 3300005719 Ga0068861_100353788 Ga0068861_1003537882 78
46 3300005842 Ga0068858_100098945 Ga0068858_1000989453 78
47 3300005844 Ga0068862_100021389 Ga0068862_1000213895 78
48 3300009101 Ga0105247_10331948 Ga0105247_103319483 78
49 3300009177 Ga0105248_10126944 Ga0105248_101269443 78
50 3300009553 Ga0105249_10122229 Ga0105249_101222293 78
51 3300014325 Ga0163163_10398445 Ga0163163_103984452 78
52 3300014968 Ga0157379_12054270 Ga0157379_120542702 78
53 3300025900 Ga0207710_10695991 Ga0207710_106959912 78
54 3300025903 Ga0207680_10914663 Ga0207680_109146632 78
55 3300025941 Ga0207711_10926770 Ga0207711_109267702 78
56 3300025961 Ga0207712_10079191 Ga0207712_100791913 78
57 3300025972 Ga0207668_10000019 Ga0207668_1000001921 78
58 3300025986 Ga0207658_10007356 Ga0207658_100073565 78
59 3300026095 Ga0207676_10085959 Ga0207676_100859593 78
60 3300026118 Ga0207675_100437454 Ga0207675_1004374542 78
61 3300028379 Ga0268266_10002885 Ga0268266_100028854 78
62 3300028380 Ga0268265_10065846 Ga0268265_100658462 78
63 3300037312 Ga0395899_0025887 Ga0395899_0025887_151_390 78
64 3300037418 Ga0395900_0007219 Ga0395900_0007219_2029_2268 78
65 3300037418 Ga0395900_0811791 Ga0395900_0811791_509_745 78
66 3300037471 Ga0395905_0053492 Ga0395905_0053492_2093_2332 78
67 3300037471 Ga0395905_0428644 Ga0395905_0428644_314_550 78
68 3300037471 Ga0395905_1106606 Ga0395905_1106606_158_397 78
69 3300038443 Ga0395901_0139293 Ga0395901_0139293_1186_1425 78
70 3300039450 Ga0436363_1583560 Ga0436363_1583560_439_684 78
71 3300048915 Ga0496112_1395331 Ga0496112_1395331_313_552 78
72 3300049822 Ga0501035_0058907 Ga0501035_0058907_1535_1774 78
73 3300049823 Ga0501044_0001576 Ga0501044_0001576_13899_14138 78
74 3300053087 Ga0500643_009820 Ga0500643_009820_2122_2358 78
75 3300005327 Ga0070658_11057283 Ga0070658_110572833 79
76 3300005335 Ga0070666_10256814 Ga0070666_102568142 79
77 3300005548 Ga0070665_101448601 Ga0070665_1014486012 79
78 3300005563 Ga0068855_100574652 Ga0068855_1005746521 79
79 3300009093 Ga0105240_11113389 Ga0105240_111133891 79
80 3300009545 Ga0105237_11770266 Ga0105237_117702661 79
81 3300009551 Ga0105238_10598866 Ga0105238_105988662 79
82 3300025903 Ga0207680_10324018 Ga0207680_103240182 79
83 3300025913 Ga0207695_11201045 Ga0207695_112010452 79
84 3300025924 Ga0207694_10629019 Ga0207694_106290192 79
85 3300025924 Ga0207694_11044498 Ga0207694_110444982 79
86 3300028379 Ga0268266_10207645 Ga0268266_102076452 79
87 3300028800 Ga0265338_10212999 Ga0265338_102129993 79
88 3300031911 Ga0307412_11429698 Ga0307412_114296981 79
89 3300037466 Ga0395898_0485993 Ga0395898_0485993_605_847 79
90 3300037471 Ga0395905_0465106 Ga0395905_0465106_853_1095 79
91 3300038443 Ga0395901_1363326 Ga0395901_1363326_132_374 79
92 3300046663 Ga0495635_0873747 Ga0495635_0873747_182_424 79
93 3300002741 JGI25157J39369_1030287 JGI25157J39369_10302872 80
94 3300003215 JGI25153J46596_10056419 JGI25153J46596_100564192 80
95 3300003791 Ga0055530_10000597 Ga0055530_100005978 80
96 3300003794 Ga0055531_10001491 Ga0055531_100014919 80
97 3300003794 Ga0055531_10024174 Ga0055531_100241742 80
98 3300004625 Ga0055543_1024591 Ga0055543_10245912 80
99 3300005262 Ga0065165_1000216 Ga0065165_10002162 80
100 3300005327 Ga0070658_10053207 Ga0070658_100532074 80
101 3300005336 Ga0070680_100034849 Ga0070680_1000348493 80
102 3300005339 Ga0070660_101560291 Ga0070660_1015602911 80
103 3300005340 Ga0070689_100869901 Ga0070689_1008699012 80
104 3300005355 Ga0070671_101092842 Ga0070671_1010928421 80
105 3300005457 Ga0070662_100834653 Ga0070662_1008346531 80
106 3300005458 Ga0070681_10299083 Ga0070681_102990832 80
107 3300005458 Ga0070681_10772174 Ga0070681_107721743 80
108 3300005530 Ga0070679_100078274 Ga0070679_1000782742 80
109 3300005530 Ga0070679_101246700 Ga0070679_1012467001 80
110 3300005539 Ga0068853_101382712 Ga0068853_1013827121 80
111 3300005543 Ga0070672_101703666 Ga0070672_1017036662 80
112 3300005563 Ga0068855_100081192 Ga0068855_1000811923 80
113 3300005563 Ga0068855_100183081 Ga0068855_1001830813 80
114 3300005578 Ga0068854_100676780 Ga0068854_1006767802 80
115 3300005614 Ga0068856_100664385 Ga0068856_1006643852 80
116 3300005614 Ga0068856_101492214 Ga0068856_1014922142 80
117 3300005616 Ga0068852_100029921 Ga0068852_1000299214 80
118 3300005616 Ga0068852_100670090 Ga0068852_1006700902 80
119 3300005616 Ga0068852_101633844 Ga0068852_1016338442 80
120 3300005841 Ga0068863_100722867 Ga0068863_1007228672 80
121 3300006048 Ga0075363_100148456 Ga0075363_1001484562 80
122 3300006177 Ga0075362_10131113 Ga0075362_101311132 80
123 3300006177 Ga0075362_10183522 Ga0075362_101835222 80
124 3300009093 Ga0105240_10025626 Ga0105240_100256262 80
125 3300009093 Ga0105240_10032588 Ga0105240_100325884 80
126 3300009093 Ga0105240_10114507 Ga0105240_101145073 80
127 3300009093 Ga0105240_10223974 Ga0105240_102239743 80
128 3300009093 Ga0105240_10388086 Ga0105240_103880862 80
129 3300009093 Ga0105240_10621033 Ga0105240_106210331 80
130 3300009093 Ga0105240_10877315 Ga0105240_108773152 80
131 3300009093 Ga0105240_12403770 Ga0105240_124037701 80
132 3300009148 Ga0105243_10769766 Ga0105243_107697662 80
133 3300009176 Ga0105242_10017982 Ga0105242_100179826 80
134 3300009545 Ga0105237_10104220 Ga0105237_101042202 80
135 3300009545 Ga0105237_10991681 Ga0105237_109916812 80
136 3300009551 Ga0105238_10011022 Ga0105238_100110223 80
137 3300009551 Ga0105238_10017364 Ga0105238_100173644 80
138 3300009551 Ga0105238_10358699 Ga0105238_103586992 80
139 3300009553 Ga0105249_10888897 Ga0105249_108888972 80
140 3300010375 Ga0105239_10100806 Ga0105239_101008064 80
141 3300010375 Ga0105239_10734887 Ga0105239_107348871 80
142 3300013100 Ga0157373_10298225 Ga0157373_102982253 80
143 3300013105 Ga0157369_10742999 Ga0157369_107429991 80
144 3300013307 Ga0157372_10040416 Ga0157372_100404165 80
145 3300013308 Ga0157375_13407846 Ga0157375_134078462 80
146 3300014325 Ga0163163_10342928 Ga0163163_103429282 80
147 3300014969 Ga0157376_10810589 Ga0157376_108105892 80
148 3300017792 Ga0163161_10657969 Ga0163161_106579692 80
149 3300025250 Ga0209026_1001727 Ga0209026_10017276 80
150 3300025297 Ga0209758_1000516 Ga0209758_100051641 80
151 3300025298 Ga0209050_1000090 Ga0209050_100009075 80
152 3300025304 Ga0209257_1000059 Ga0209257_100005922 80
153 3300025304 Ga0209257_1001000 Ga0209257_100100038 80
154 3300025321 Ga0207656_10606615 Ga0207656_106066152 80
155 3300025909 Ga0207705_10085410 Ga0207705_100854102 80
156 3300025911 Ga0207654_10583122 Ga0207654_105831222 80
157 3300025912 Ga0207707_10095609 Ga0207707_100956093 80
158 3300025913 Ga0207695_10002571 Ga0207695_100025714 80
159 3300025913 Ga0207695_10003047 Ga0207695_1000304710 80
160 3300025913 Ga0207695_10023882 Ga0207695_100238826 80
161 3300025913 Ga0207695_10144280 Ga0207695_101442802 80
162 3300025913 Ga0207695_10615376 Ga0207695_106153762 80
163 3300025914 Ga0207671_11338366 Ga0207671_113383661 80
164 3300025917 Ga0207660_10138243 Ga0207660_101382433 80
165 3300025919 Ga0207657_10829398 Ga0207657_108293982 80
166 3300025919 Ga0207657_11014122 Ga0207657_110141222 80
167 3300025924 Ga0207694_10007350 Ga0207694_100073505 80
168 3300025924 Ga0207694_10043773 Ga0207694_100437732 80
169 3300025931 Ga0207644_10582786 Ga0207644_105827862 80
170 3300025933 Ga0207706_10447083 Ga0207706_104470832 80
171 3300025945 Ga0207679_10934521 Ga0207679_109345212 80
172 3300025949 Ga0207667_10051460 Ga0207667_100514604 80
173 3300025949 Ga0207667_10266504 Ga0207667_102665043 80
174 3300025961 Ga0207712_10333134 Ga0207712_103331342 80
175 3300025981 Ga0207640_11969331 Ga0207640_119693311 80
176 3300026041 Ga0207639_12166776 Ga0207639_121667761 80
177 3300026088 Ga0207641_10173264 Ga0207641_101732642 80
178 3300026089 Ga0207648_11613675 Ga0207648_116136752 80
179 3300026142 Ga0207698_10059650 Ga0207698_100596503 80
180 3300026142 Ga0207698_11486166 Ga0207698_114861662 80
181 3300028786 Ga0307517_10006713 Ga0307517_100067135 80
182 3300030521 Ga0307511_10015098 Ga0307511_100150982 80
183 3300031456 Ga0307513_10210810 Ga0307513_102108104 80
184 3300031911 Ga0307412_11159021 Ga0307412_111590212 80
185 3300032126 Ga0307415_101590769 Ga0307415_1015907691 80
186 3300035113 Ga0373936_0267654 Ga0373936_0267654_240_482 80
187 3300035692 Ga0373935_0010713 Ga0373935_0010713_1163_1405 80
188 3300037068 Ga0373925_0033849 Ga0373925_0033849_3327_3569 80
189 3300037312 Ga0395899_0043189 Ga0395899_0043189_365_625 80
190 3300037312 Ga0395899_0378933 Ga0395899_0378933_446_706 80
191 3300037312 Ga0395899_0934298 Ga0395899_0934298_246_491 80
192 3300037418 Ga0395900_1641647 Ga0395900_1641647_208_453 80
193 3300037471 Ga0395905_0066489 Ga0395905_0066489_2597_2839 80
194 3300037471 Ga0395905_0274547 Ga0395905_0274547_337_579 80
195 3300037471 Ga0395905_1345890 Ga0395905_1345890_294_536 80
196 3300037471 Ga0395905_1652102 Ga0395905_1652102_91_333 80
197 3300038443 Ga0395901_0327721 Ga0395901_0327721_790_1050 80
198 3300041443 Ga0451789_0557030 Ga0451789_0557030_232_474 80
199 3300044684 Ga0466966_0860014 Ga0466966_0860014_212_469 80
200 3300044712 Ga0453684_0672011 Ga0453684_0672011_669_911 80
201 3300046522 Ga0495643_0375256 Ga0495643_0375256_285_527 80
202 3300046531 Ga0495665_0264082 Ga0495665_0264082_342_584 80
203 3300046537 Ga0495598_0419467 Ga0495598_0419467_230_472 80
204 3300046539 Ga0495621_0037772 Ga0495621_0037772_73_315 80
205 3300046616 Ga0495668_0126981 Ga0495668_0126981_1104_1346 80
206 3300046616 Ga0495668_0312946 Ga0495668_0312946_387_629 80
207 3300046616 Ga0495668_0624780 Ga0495668_0624780_310_552 80
208 3300047472 Ga0495686_0031217 Ga0495686_0031217_2954_3196 80
209 3300048907 Ga0496104_1822201 Ga0496104_1822201_178_420 80
210 3300048913 Ga0496110_1790287 Ga0496110_1790287_180_425 80
211 3300048915 Ga0496112_0182913 Ga0496112_0182913_588_833 80
212 3300048918 Ga0496115_0025192 Ga0496115_0025192_3503_3745 80
213 3300048918 Ga0496115_0142217 Ga0496115_0142217_311_553 80
214 3300049572 Ga0501036_1604889 Ga0501036_1604889_75_323 80
215 3300049573 Ga0501037_0499823 Ga0501037_0499823_343_588 80
216 3300049581 Ga0501047_0000963 Ga0501047_0000963_16807_17055 80
217 3300049581 Ga0501047_0138026 Ga0501047_0138026_2035_2283 80
218 3300049582 Ga0501048_0063483 Ga0501048_0063483_195_443 80
219 3300049742 Ga0501080_0537712 Ga0501080_0537712_522_770 80
220 3300049822 Ga0501035_0852431 Ga0501035_0852431_24_269 80
221 3300050489 nmdc:mga03683_122117_c1 nmdc:mga03683_122117_c1_712_954 80
222 3300050496 nmdc:mga07m45_85902_c1 nmdc:mga07m45_85902_c1_717_959 80
223 3300053108 Ga0500562_000468 Ga0500562_000468_6066_6308 80
224 3300053119 Ga0500595_035805 Ga0500595_035805_1352_1594 80
225 3300053730 Ga0500645_136336 Ga0500645_136336_338_580 80

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13773

DUF4170

Domain of unknown function (DUF4170)

10

69

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2mhe-assembly1.cif.gz_B nmr structure of the protein np_419126.1 from caulobacter crescentus 0.7619 1 73
2mhe-assembly1.cif.gz_B nmr structure of the protein np_419126.1 from caulobacter crescentus 0.736 1 73
7d8b-assembly2.cif.gz_C engineering disulphide-free autonomous antibody vh domains to modulate intracellular pathways 0.677 5 65
7wq5-assembly2.cif.gz_B crystal structure of arabidopsis transcriptional factor wrinkled1 with dsdna 0.6544 12 52
5zk7-assembly1.cif.gz_A stapled-peptides tailored against initiation of translation 0.6209 5 47
ID Description Score Start End Superfamily
af_K7UQ19_118_172_3.30.730.10 Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain 0.8557 27 52 3.30.730.10
af_Q2TQ39_75_158_3.30.730.10 Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain 0.8408 29 54 3.30.730.10
af_B4FET9_33_90_3.30.730.10 Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain 0.7744 30 58 3.30.730.10
af_V5QQR7_1_86_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7644 2 69 2.60.40.10
2mheB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Uncharacterised protein PF13773, DUF4170 0.7619 1 73 3.30.70.2400
ID Description Score Start End GO Terms
AF-A0A7U3CKN1-F1-model_v4 deleted 0.9237 2 67
AF-A0A258DDP0-F1-model_v4 Inositol monophosphatase 0.9225 1 72
AF-U6B3L5-F1-model_v4 Inositol monophosphatase 0.918 1 66
AF-A0A2E9XXY0-F1-model_v4 DUF4170 domain-containing protein 0.9126 2 66
AF-A0A1Y5ED99-F1-model_v4 Inositol monophosphatase 0.9029 1 66

Feature Viewer

pLDDT pTM Quality
75.58 0.58 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map