F338080

General Info

Members Datasets Scaffolds Average Seq Length
225 146 451 384

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0023069|Ga0451576_0023069_497_1735
Length 412
Sequence MMAEVFVRGLTPTAPEGKSMEPAATPATVRIRDLVAYFLRLGALGFGGPVALCGQMEKELVEERRWLTAEEMREGIAVCQSLPGPLAIQVGIFISYLRGGFWGAWAGGWAFILPNFLIVGLLGALYLRFGGLRPVTAIFYGVSPAVIALIFHSCYRLVKLGMEDWFQWGVAAVCFGVTVAVQAEIALLFLGAAMVGIAWYGSLFRGRGGSWLALLAVTPVPAEAVRVAGGSSLAKLFVFFLKAGSLTFGSGLVIVPFLEKGLVQQTGWIDERQFLVAVAIGMISPGPVVITATFVGYLVGGFWGALVATVGIFLPSFLLVLAAAPLLRRYGADPNVRGFVKGAYGAAIGTIFGASVLLGRIAIGDWLTALVAFGSLVALSYWKLPSAALVAASAVIGLIAFPLLMPSWVFLR

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
40 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
41 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
59 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
60 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
61 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
84 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
85 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
88 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
89 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
90 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
91 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
92 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
94 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
95 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
96 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
97 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
100 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
101 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
102 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
103 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
104 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
105 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
106 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
107 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
108 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
109 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
110 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
111 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
112 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
113 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
114 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
115 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
116 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
117 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
118 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
119 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
120 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
121 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
122 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
123 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
124 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
125 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
126 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
127 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
128 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
129 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
130 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
131 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
132 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
133 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
134 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
135 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
136 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
137 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
138 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
139 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
140 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
141 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
142 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
143 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
144 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
145 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
146 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.56
Metatranscriptomes 0
Isolates 4.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 5.78
Rhizoplane 7.11
Rhizosphere 80.44
Stem 0
Stem Tuber 0
Unclassified 2.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_0023069 3300045051 Bacteria 6743
2 rootH1_10031475 3300003316 Bacteria 3164
3 rootH1_10031475 3300003323 Bacteria 3639
4 JGI25404J52841_10000473 3300003659 Bacteria 5770
5 JGI25404J52841_10009063 3300003659 Bacteria 2127
6 Ga0070683_100001477 3300005329 Bacteria 18108
7 Ga0070683_100012169 3300005329 Bacteria 7468
8 Ga0070680_100008506 3300005336 Bacteria 7861
9 Ga0070682_100003502 3300005337 Bacteria 8682
10 Ga0070671_100097616 3300005355 Bacteria 2464
11 Ga0070659_100129809 3300005366 Bacteria 2046
12 Ga0070667_100039876 3300005367 Bacteria 3937
13 Ga0070709_10002456 3300005434 Bacteria 10035
14 Ga0070709_10018239 3300005434 Bacteria 4038
15 Ga0070714_100011136 3300005435 Bacteria 7128
16 Ga0070714_100043879 3300005435 Bacteria 3784
17 Ga0070714_100089431 3300005435 Bacteria 2696
18 Ga0070713_100025561 3300005436 Bacteria 4618
19 Ga0070711_100011354 3300005439 Bacteria 5528
20 Ga0070711_100056812 3300005439 Unclassified 2708
21 Ga0070663_100061981 3300005455 Bacteria 2695
22 Ga0070681_10003118 3300005458 Bacteria 15399
23 Ga0070681_10042034 3300005458 Bacteria 4582
24 Ga0070681_10056820 3300005458 Bacteria 3894
25 Ga0070681_10210084 3300005458 Unclassified 1862
26 Ga0070679_100002575 3300005530 Bacteria 16471
27 Ga0070679_100010968 3300005530 Bacteria 8610
28 Ga0070679_100047357 3300005530 Bacteria 4285
29 Ga0070679_100135528 3300005530 Unclassified 2443
30 Ga0070679_100232520 3300005530 Bacteria 1803
31 Ga0070684_100011674 3300005535 Bacteria 7005
32 Ga0070697_100306510 3300005536 Bacteria 1366
33 Ga0068853_100271967 3300005539 Bacteria 1560
34 Ga0070693_100069100 3300005547 Bacteria 2075
35 Ga0068855_100010223 3300005563 Bacteria 11311
36 Ga0068855_100064021 3300005563 Bacteria 4289
37 Ga0070664_100013527 3300005564 Bacteria 6649
38 Ga0068857_100013592 3300005577 Bacteria 7092
39 Ga0068857_100054427 3300005577 Bacteria 3551
40 Ga0068856_100003853 3300005614 Bacteria 15056
41 Ga0068856_100010432 3300005614 Bacteria 9017
42 Ga0068856_100108606 3300005614 Bacteria 2770
43 Ga0068852_100009743 3300005616 Bacteria 7141
44 Ga0068863_100004006 3300005841 Bacteria 14544
45 Ga0068860_100008741 3300005843 Bacteria 10086
46 Ga0068862_100222808 3300005844 Bacteria 1708
47 Ga0081455_10001040 3300005937 Bacteria 35002
48 Ga0081540_1001020 3300005983 Bacteria 25114
49 Ga0081540_1001284 3300005983 Bacteria 21920
50 Ga0081540_1001569 3300005983 Bacteria 19528
51 Ga0081540_1001616 3300005983 Bacteria 19199
52 Ga0081540_1003883 3300005983 Bacteria 11645
53 Ga0081539_10009257 3300005985 Bacteria 8286
54 Ga0081539_10010758 3300005985 Bacteria 7369
55 Ga0070715_10001044 3300006163 Bacteria 7820
56 Ga0097621_100061090 3300006237 Bacteria 3090
57 Ga0075428_100220645 3300006844 Bacteria 2047
58 Ga0075430_100131061 3300006846 Bacteria 2089
59 Ga0075434_100025445 3300006871 Bacteria 5791
60 Ga0075434_100109422 3300006871 Bacteria 2774
61 Ga0075429_100051313 3300006880 Bacteria 3589
62 Ga0075436_100004218 3300006914 Bacteria 9865
63 Ga0099825_1027829 3300006941 Bacteria 2830
64 Ga0099824_1024323 3300006942 Bacteria 3572
65 Ga0099822_1000400 3300006943 Bacteria 38677
66 Ga0075435_100035035 3300007076 Bacteria 3982
67 Ga0075435_100066521 3300007076 Bacteria 2932
68 Ga0075435_100114765 3300007076 Bacteria 2242
69 Ga0099794_10063737 3300007265 Bacteria 1795
70 Ga0105240_10011289 3300009093 Bacteria 12449
71 Ga0105240_10038653 3300009093 Bacteria 6120
72 Ga0105240_10040816 3300009093 Bacteria 5930
73 Ga0105240_10223433 3300009093 Bacteria 2193
74 Ga0105247_10054545 3300009101 Bacteria 2466
75 Ga0114129_10030658 3300009147 Bacteria 7608
76 Ga0114129_10174086 3300009147 Bacteria 2932
77 Ga0105241_10185744 3300009174 Bacteria 1727
78 Ga0105237_10026789 3300009545 Bacteria 5892
79 Ga0105237_10043308 3300009545 Unclassified 4535
80 Ga0105238_10013128 3300009551 Bacteria 8361
81 Ga0105238_10015263 3300009551 Bacteria 7778
82 Ga0105239_10007844 3300010375 Bacteria 12210
83 Ga0105239_10014555 3300010375 Bacteria 8728
84 Ga0105239_10092397 3300010375 Bacteria 3340
85 Ga0105246_10058147 3300011119 Bacteria 2678
86 Ga0157373_10017166 3300013100 Bacteria 5270
87 Ga0157370_10102599 3300013104 Bacteria 2678
88 Ga0157370_10128741 3300013104 Bacteria 2362
89 Ga0157369_10002340 3300013105 Bacteria 22809
90 Ga0157369_10004833 3300013105 Bacteria 15823
91 Ga0163162_10027750 3300013306 Bacteria 5599
92 Ga0163162_10076582 3300013306 Plasmid 3407
93 Ga0157372_10021316 3300013307 Bacteria 7000
94 Ga0157372_10037135 3300013307 Bacteria 5370
95 Ga0157372_10042696 3300013307 Bacteria 5017
96 Ga0157372_10100494 3300013307 Bacteria 3300
97 Ga0157379_10202710 3300014968 Bacteria 1794
98 Ga0157379_10237360 3300014968 Bacteria 1653
99 Ga0213872_10001126 3300021361 Bacteria 18260
100 Ga0213876_10000601 3300021384 Bacteria 26713
101 Ga0213876_10014418 3300021384 Bacteria 4187
102 Ga0228598_1003048 3300024227 Bacteria 3630
103 Ga0207692_10060953 3300025898 Bacteria 1953
104 Ga0207699_10014750 3300025906 Bacteria 4039
105 Ga0207705_10005467 3300025909 Bacteria 9502
106 Ga0207684_10033285 3300025910 Bacteria 4382
107 Ga0207654_10114434 3300025911 Bacteria 1683
108 Ga0207707_10000173 3300025912 Bacteria 67122
109 Ga0207707_10040883 3300025912 Bacteria 4049
110 Ga0207707_10049550 3300025912 Bacteria 3659
111 Ga0207707_10087201 3300025912 Bacteria 2727
112 Ga0207695_10050042 3300025913 Bacteria 4398
113 Ga0207695_10094370 3300025913 Bacteria 2999
114 Ga0207695_10133459 3300025913 Unclassified 2438
115 Ga0207663_10000515 3300025916 Bacteria 16967
116 Ga0207663_10029111 3300025916 Bacteria 3240
117 Ga0207652_10019404 3300025921 Bacteria 5591
118 Ga0207652_10058927 3300025921 Unclassified 3309
119 Ga0207652_10066595 3300025921 Bacteria 3122
120 Ga0207652_10144791 3300025921 Bacteria 2126
121 Ga0207694_10035803 3300025924 Bacteria 3808
122 Ga0207664_10009036 3300025929 Bacteria 6978
123 Ga0207664_10018591 3300025929 Bacteria 5120
124 Ga0207690_10011305 3300025932 Bacteria 5334
125 Ga0207665_10000398 3300025939 Bacteria 29930
126 Ga0207661_10005022 3300025944 Bacteria 9276
127 Ga0207661_10034527 3300025944 Bacteria 3934
128 Ga0207679_10009188 3300025945 Bacteria 6319
129 Ga0207667_10032136 3300025949 Bacteria 5658
130 Ga0207639_10048529 3300026041 Bacteria 3214
131 Ga0207678_10007891 3300026067 Bacteria 9390
132 Ga0207702_10016743 3300026078 Bacteria 6068
133 Ga0207702_10030975 3300026078 Bacteria 4458
134 Ga0207641_10000135 3300026088 Bacteria 108689
135 Ga0207674_10051603 3300026116 Bacteria 4197
136 Ga0207698_10046121 3300026142 Bacteria 3289
137 Ga0207698_10096805 3300026142 Bacteria 2433
138 Ga0209589_1000030 3300027357 Bacteria 147457
139 Ga0209489_100056 3300027361 Bacteria 147457
140 Ga0209700_100059 3300027363 Bacteria 147457
141 Ga0268264_10000391 3300028381 Bacteria 63117
142 Ga0307511_10000374 3300030521 Bacteria 47666
143 Ga0307508_10000114 3300031616 Bacteria 95098
144 Ga0307516_10000679 3300031730 Bacteria 46117
145 Ga0373936_0022661 3300035113 Bacteria 2446
146 Ga0373945_0073662 3300035116 Bacteria 1297
147 Ga0373937_0009868 3300036401 Bacteria 8324
148 Ga0373925_0065313 3300037068 Bacteria 2741
149 Ga0395899_0013326 3300037312 Bacteria 6290
150 Ga0395899_0014150 3300037312 Bacteria 6089
151 Ga0395899_0208738 3300037312 Bacteria 1358
152 Ga0395900_0003191 3300037418 Bacteria 17763
153 Ga0395900_0005409 3300037418 Bacteria 13379
154 Ga0395900_0015497 3300037418 Bacteria 7771
155 Ga0395900_0209240 3300037418 Bacteria 1970
156 Ga0395898_0004241 3300037466 Bacteria 15720
157 Ga0395898_0076439 3300037466 Bacteria 3233
158 Ga0395898_0103641 3300037466 Bacteria 2729
159 Ga0395898_0152283 3300037466 Bacteria 2212
160 Ga0436364_0563270 3300037853 Bacteria 6601
161 Ga0395901_0001301 3300038443 Bacteria 26316
162 Ga0395901_0002798 3300038443 Bacteria 17603
163 Ga0395901_0006199 3300038443 Bacteria 12117
164 Ga0395901_0226398 3300038443 Bacteria 1953
165 Ga0436365_0064527 3300039437 Bacteria 32229
166 Ga0436365_0247948 3300039437 Bacteria 48555
167 Ga0436365_1715076 3300039437 Bacteria 4998
168 Ga0436361_0570744 3300039447 Bacteria 12080
169 Ga0436363_1266481 3300039450 Bacteria 29395
170 Ga0436362_0658847 3300039453 Bacteria 8395
171 Ga0466969_0003920 3300044656 Bacteria 7901
172 Ga0466969_0020135 3300044656 Bacteria 3459
173 Ga0466966_0002362 3300044684 Bacteria 12327
174 Ga0466966_0029013 3300044684 Bacteria 3602
175 Ga0466961_0012241 3300044693 Bacteria 5485
176 Ga0466964_0000048 3300044706 Bacteria 25333
177 Ga0466971_0000547 3300044719 Bacteria 14886
178 Ga0466971_0026953 3300044719 Bacteria 2572
179 Ga0466957_0030068 3300044842 Bacteria 3242
180 Ga0466957_0036412 3300044842 Bacteria 2958
181 Ga0466957_0183524 3300044842 Bacteria 1367
182 Ga0466959_0006493 3300045049 Bacteria 8105
183 Ga0466959_0006992 3300045049 Bacteria 7884
184 Ga0466959_0143114 3300045049 Bacteria 1688
185 Ga0466958_0119245 3300045836 Bacteria 1651
186 Ga0495629_0031603 3300046459 Bacteria 3748
187 Ga0495580_0002994 3300046472 Bacteria 14487
188 Ga0495634_0084321 3300046642 Bacteria 2072
189 Ga0495647_0112932 3300046681 Bacteria 1135
190 Ga0495658_0087856 3300046683 Bacteria 1836
191 Ga0496100_0066033 3300048903 Bacteria 2399
192 Ga0496101_0205926 3300048904 Bacteria 1522
193 Ga0496102_0094910 3300048905 Bacteria 2764
194 Ga0496104_0003590 3300048907 Bacteria 13401
195 Ga0496104_0006360 3300048907 Bacteria 10390
196 Ga0496104_0009735 3300048907 Bacteria 8567
197 Ga0496105_0048532 3300048908 Bacteria 3504
198 Ga0496108_0001572 3300048911 Bacteria 18069
199 Ga0496108_0055408 3300048911 Bacteria 3329
200 Ga0496109_0001938 3300048912 Bacteria 17205
201 Ga0496110_0010620 3300048913 Bacteria 7495
202 Ga0496111_0003248 3300048914 Bacteria 10038
203 Ga0496111_0126512 3300048914 Bacteria 1889
204 Ga0496112_0002723 3300048915 Bacteria 14308
205 Ga0496113_0065295 3300048916 Bacteria 2754
206 Ga0496114_0014539 3300048917 Bacteria 6322
207 Ga0496126_0028904 3300048929 Bacteria 5273
208 nmdc:mga05p37_21772_c1 3300050507 Bacteria 7766
209 nmdc:mga09592_18714_c1 3300050508 Bacteria 5681
210 nmdc:mga0qj67_69898_c1 3300050509 Bacteria 2800
211 nmdc:mga06r32_267020_c1 3300050510 Bacteria 1699
212 nmdc:mga0n895_39958_c1 3300050512 Bacteria 4556
213 nmdc:mga0n895_6825_c1 3300050512 Bacteria 9746
214 nmdc:mga0rr50_143912_c1 3300050513 Bacteria 1920
215 Ga0495619_0027748 3300053085 Bacteria 3650
216 Ga0466962_0000397 3300061719 Bacteria 18814
217 2509149998 2508501128 Bacteria 8613869
218 2513672438 2513237098 Bacteria 9902361
219 2513894594 2513237141 Bacteria 8496279
220 2728754576 2728368998 Bacteria 8720350
221 2876765793 2876761206 Bacteria 10111113
222 2885375869 2885374607 Bacteria 8927485
223 2885383810 2885383462 Bacteria 9473874
224 2903770231 2903768456 Bacteria 9749579
225 2908746579 2908739725 Bacteria 8628932
226 2935767973 2935760218 Bacteria 9817913
227 Ga0451576_0023069
228 rootH1_10031475
229 JGI25404J52841_10000473
230 JGI25404J52841_10009063
231 Ga0070683_100001477
232 Ga0070683_100012169
233 Ga0070680_100008506
234 Ga0070682_100003502
235 Ga0070671_100097616
236 Ga0070659_100129809
237 Ga0070667_100039876
238 Ga0070709_10002456
239 Ga0070709_10018239
240 Ga0070714_100011136
241 Ga0070714_100043879
242 Ga0070714_100089431
243 Ga0070713_100025561
244 Ga0070711_100011354
245 Ga0070711_100056812
246 Ga0070663_100061981
247 Ga0070681_10003118
248 Ga0070681_10042034
249 Ga0070681_10056820
250 Ga0070681_10210084
251 Ga0070679_100002575
252 Ga0070679_100010968
253 Ga0070679_100047357
254 Ga0070679_100135528
255 Ga0070679_100232520
256 Ga0070684_100011674
257 Ga0070697_100306510
258 Ga0068853_100271967
259 Ga0070693_100069100
260 Ga0068855_100010223
261 Ga0068855_100064021
262 Ga0070664_100013527
263 Ga0068857_100013592
264 Ga0068857_100054427
265 Ga0068856_100003853
266 Ga0068856_100010432
267 Ga0068856_100108606
268 Ga0068852_100009743
269 Ga0068863_100004006
270 Ga0068860_100008741
271 Ga0068862_100222808
272 Ga0081455_10001040
273 Ga0081540_1001020
274 Ga0081540_1001284
275 Ga0081540_1001569
276 Ga0081540_1001616
277 Ga0081540_1003883
278 Ga0081539_10009257
279 Ga0081539_10010758
280 Ga0070715_10001044
281 Ga0097621_100061090
282 Ga0075428_100220645
283 Ga0075430_100131061
284 Ga0075434_100025445
285 Ga0075434_100109422
286 Ga0075429_100051313
287 Ga0075436_100004218
288 Ga0099825_1027829
289 Ga0099824_1024323
290 Ga0099822_1000400
291 Ga0075435_100035035
292 Ga0075435_100066521
293 Ga0075435_100114765
294 Ga0099794_10063737
295 Ga0105240_10011289
296 Ga0105240_10038653
297 Ga0105240_10040816
298 Ga0105240_10223433
299 Ga0105247_10054545
300 Ga0114129_10030658
301 Ga0114129_10174086
302 Ga0105241_10185744
303 Ga0105237_10026789
304 Ga0105237_10043308
305 Ga0105238_10013128
306 Ga0105238_10015263
307 Ga0105239_10007844
308 Ga0105239_10014555
309 Ga0105239_10092397
310 Ga0105246_10058147
311 Ga0157373_10017166
312 Ga0157370_10102599
313 Ga0157370_10128741
314 Ga0157369_10002340
315 Ga0157369_10004833
316 Ga0163162_10027750
317 Ga0163162_10076582
318 Ga0157372_10021316
319 Ga0157372_10037135
320 Ga0157372_10042696
321 Ga0157372_10100494
322 Ga0157379_10202710
323 Ga0157379_10237360
324 Ga0213872_10001126
325 Ga0213876_10000601
326 Ga0213876_10014418
327 Ga0228598_1003048
328 Ga0207692_10060953
329 Ga0207699_10014750
330 Ga0207705_10005467
331 Ga0207684_10033285
332 Ga0207654_10114434
333 Ga0207707_10000173
334 Ga0207707_10040883
335 Ga0207707_10049550
336 Ga0207707_10087201
337 Ga0207695_10050042
338 Ga0207695_10094370
339 Ga0207695_10133459
340 Ga0207663_10000515
341 Ga0207663_10029111
342 Ga0207652_10019404
343 Ga0207652_10058927
344 Ga0207652_10066595
345 Ga0207652_10144791
346 Ga0207694_10035803
347 Ga0207664_10009036
348 Ga0207664_10018591
349 Ga0207690_10011305
350 Ga0207665_10000398
351 Ga0207661_10005022
352 Ga0207661_10034527
353 Ga0207679_10009188
354 Ga0207667_10032136
355 Ga0207639_10048529
356 Ga0207678_10007891
357 Ga0207702_10016743
358 Ga0207702_10030975
359 Ga0207641_10000135
360 Ga0207674_10051603
361 Ga0207698_10046121
362 Ga0207698_10096805
363 Ga0209589_1000030
364 Ga0209489_100056
365 Ga0209700_100059
366 Ga0268264_10000391
367 Ga0307511_10000374
368 Ga0307508_10000114
369 Ga0307516_10000679
370 Ga0373936_0022661
371 Ga0373945_0073662
372 Ga0373937_0009868
373 Ga0373925_0065313
374 Ga0395899_0013326
375 Ga0395899_0014150
376 Ga0395899_0208738
377 Ga0395900_0003191
378 Ga0395900_0005409
379 Ga0395900_0015497
380 Ga0395900_0209240
381 Ga0395898_0004241
382 Ga0395898_0076439
383 Ga0395898_0103641
384 Ga0395898_0152283
385 Ga0436364_0563270
386 Ga0395901_0001301
387 Ga0395901_0002798
388 Ga0395901_0006199
389 Ga0395901_0226398
390 Ga0436365_0064527
391 Ga0436365_0247948
392 Ga0436365_1715076
393 Ga0436361_0570744
394 Ga0436363_1266481
395 Ga0436362_0658847
396 Ga0466969_0003920
397 Ga0466969_0020135
398 Ga0466966_0002362
399 Ga0466966_0029013
400 Ga0466961_0012241
401 Ga0466964_0000048
402 Ga0466971_0000547
403 Ga0466971_0026953
404 Ga0466957_0030068
405 Ga0466957_0036412
406 Ga0466957_0183524
407 Ga0466959_0006493
408 Ga0466959_0006992
409 Ga0466959_0143114
410 Ga0466958_0119245
411 Ga0495629_0031603
412 Ga0495580_0002994
413 Ga0495634_0084321
414 Ga0495647_0112932
415 Ga0495658_0087856
416 Ga0496100_0066033
417 Ga0496101_0205926
418 Ga0496102_0094910
419 Ga0496104_0003590
420 Ga0496104_0006360
421 Ga0496104_0009735
422 Ga0496105_0048532
423 Ga0496108_0001572
424 Ga0496108_0055408
425 Ga0496109_0001938
426 Ga0496110_0010620
427 Ga0496111_0003248
428 Ga0496111_0126512
429 Ga0496112_0002723
430 Ga0496113_0065295
431 Ga0496114_0014539
432 Ga0496126_0028904
433 nmdc:mga05p37_21772_c1
434 nmdc:mga09592_18714_c1
435 nmdc:mga0qj67_69898_c1
436 nmdc:mga06r32_267020_c1
437 nmdc:mga0n895_39958_c1
438 nmdc:mga0n895_6825_c1
439 nmdc:mga0rr50_143912_c1
440 Ga0495619_0027748
441 Ga0466962_0000397
442 2509149998
443 2513672438
444 2513894594
445 2728754576
446 2876765793
447 2885375869
448 2885383810
449 2903770231
450 2908746579
451 2935767973

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02417

Chromate_transp

Chromate transporter

234

398

0.98

PF02417

Chromate_transp

Chromate transporter

32

197

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2r6a-assembly1.cif.gz_A crystal form bh1 0.2727 11 132
8amw-assembly1.cif.gz_C aqp7 dimer of tetramers_c1 0.2126 11 297
8amw-assembly1.cif.gz_C aqp7 dimer of tetramers_c1 0.2013 11 297
4f35-assembly2.cif.gz_B crystal structure of a bacterial dicarboxylate/sodium symporter 0.1697 15 297
4f35-assembly2.cif.gz_B crystal structure of a bacterial dicarboxylate/sodium symporter 0.1527 15 297
ID Description Score Start End Superfamily
af_Q57871_202_427_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.3148 6 106 3.40.50.720
4k71D05 Mainly Alpha;Orthogonal Bundle;Serum Albumin; Chain A, Domain 1; 0.284 8 117 1.10.246.10
af_Q9LM25_87_200_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.2435 30 129 1.25.40.10
4k71D05 Mainly Alpha;Orthogonal Bundle;Serum Albumin; Chain A, Domain 1; 0.2424 8 117 1.10.246.10
af_Q9LM25_87_200_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.2273 30 129 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A7C4MGT6-F1-model_v4 Chromate transporter 0.9187 12 181 GO:0005886
GO:0015109
AF-A0A2V2EPQ9-F1-model_v4 Chromate transporter 0.9166 8 181 GO:0005886
GO:0015109
AF-V9HS70-F1-model_v4 Chromate transport protein 0.9046 12 181 GO:0005886
GO:0015109
AF-A0A7C4MGT6-F1-model_v4 Chromate transporter 0.8989 12 181 GO:0005886
GO:0015109
AF-A0A3D4YHQ7-F1-model_v4 Chromate transporter 0.8952 3 184 GO:0005886
GO:0015109

Map