F338064

General Info

Members Datasets Scaffolds Average Seq Length
225 166 450 162

Family's Representative Sequence

Representative Sequence 3300044673|Ga0453683_0037064|Ga0453683_0037064_852_1394
Length 180
Sequence MDAVSTRSEEADTMPTTKIAQTPAQKITPFLWFNDNAEEAMNFYASIFPNSKILSVTRYGDAGPGLKGTVMTASFQLHGQEFTALNGGPHFKFTEAISLVVHCQTQKEIDEYWEKLSEGGEKVECGWLKDKFGLSWQIVPDVLIEMLQDKDPEKVKRVTEAMLQMKKLDIAKLKQAYEQK

Samples

Sample ID Description Type Environment
1 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
89 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
90 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
127 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
128 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
129 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
130 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
131 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
132 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
133 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
134 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
135 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
139 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
140 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
141 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
142 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
143 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
144 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
145 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
146 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
147 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
148 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
149 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
150 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
151 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
152 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
153 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
154 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
155 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
156 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
157 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
158 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
159 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
160 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
161 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
162 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
163 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
164 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
165 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
166 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96
Metatranscriptomes 0
Isolates 4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.33
Nodule 0
Rhizoplane 0.44
Rhizosphere 94.22
Stem 0
Stem Tuber 0
Unclassified 25.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453683_0037064 3300044673 Bacteria 3068
2 MBSR1b_contig_11080172 2162886012 Unclassified 4042
3 JGI24740J21852_10032584 3300001979 Unclassified 1665
4 JGI24737J22298_10200315 3300001990 Unclassified 589
5 rootL2_10155668 3300003322 Bacteria 1508
6 rootH1_10221845 3300003323 Bacteria 3304
7 Ga0065704_10226330 3300005289 Bacteria 1057
8 Ga0065704_10254795 3300005289 Unclassified 980
9 Ga0065715_10091855 3300005293 Bacteria 5463
10 Ga0065707_10120619 3300005295 Unclassified 2130
11 Ga0065707_10338831 3300005295 Unclassified 937
12 Ga0070676_10505447 3300005328 Bacteria 859
13 Ga0070690_100016591 3300005330 Unclassified 4416
14 Ga0070670_100100061 3300005331 Bacteria 2495
15 Ga0068869_100333056 3300005334 Bacteria 1234
16 Ga0068869_100978363 3300005334 Bacteria 736
17 Ga0070682_100030806 3300005337 Bacteria 3241
18 Ga0068868_101382586 3300005338 Bacteria 656
19 Ga0070660_100764540 3300005339 Bacteria 812
20 Ga0070687_100341104 3300005343 Bacteria 964
21 Ga0070692_10247244 3300005345 Unclassified 1066
22 Ga0070692_10351156 3300005345 Bacteria 916
23 Ga0070692_10849912 3300005345 Bacteria 627
24 Ga0070668_100323682 3300005347 Bacteria 1298
25 Ga0070668_101043158 3300005347 Unclassified 736
26 Ga0070669_100020290 3300005353 Plasmid 4746
27 Ga0070671_100025212 3300005355 Unclassified 4878
28 Ga0070674_101604229 3300005356 Unclassified 587
29 Ga0070673_100589338 3300005364 Bacteria 1013
30 Ga0070659_101235432 3300005366 Unclassified 661
31 Ga0070713_100312313 3300005436 Unclassified 1450
32 Ga0070701_10106101 3300005438 Bacteria 1563
33 Ga0070711_100260269 3300005439 Bacteria 1365
34 Ga0070711_100367064 3300005439 Unclassified 1161
35 Ga0070711_100509650 3300005439 Bacteria 993
36 Ga0070705_100026353 3300005440 Unclassified 3163
37 Ga0070700_100006279 3300005441 Bacteria 6343
38 Ga0070700_100304377 3300005441 Unclassified 1165
39 Ga0070694_100184012 3300005444 Unclassified 1547
40 Ga0070708_100095527 3300005445 Bacteria 2714
41 Ga0068867_100435133 3300005459 Bacteria 1114
42 Ga0068867_101213507 3300005459 Bacteria 693
43 Ga0070706_100032681 3300005467 Unclassified 4800
44 Ga0070707_100474619 3300005468 Bacteria 1212
45 Ga0070698_100035804 3300005471 Bacteria 5130
46 Ga0070699_100136204 3300005518 Unclassified 2166
47 Ga0070699_100185785 3300005518 Bacteria 1845
48 Ga0070697_100007206 3300005536 Bacteria 8648
49 Ga0070697_101200938 3300005536 Unclassified 676
50 Ga0068853_100132694 3300005539 Bacteria 2231
51 Ga0068853_100471996 3300005539 Bacteria 1182
52 Ga0070686_100006532 3300005544 Bacteria 6489
53 Ga0070695_100074665 3300005545 Bacteria 2228
54 Ga0070695_100377649 3300005545 Unclassified 1069
55 Ga0070695_100743728 3300005545 Unclassified 782
56 Ga0070696_100114834 3300005546 Bacteria 1942
57 Ga0070696_101095643 3300005546 Bacteria 669
58 Ga0070693_100130585 3300005547 Bacteria 1570
59 Ga0070693_100624490 3300005547 Unclassified 781
60 Ga0070704_100047607 3300005549 Bacteria 2998
61 Ga0070704_100349355 3300005549 Bacteria 1248
62 Ga0068855_101706777 3300005563 Bacteria 642
63 Ga0068854_100429205 3300005578 Bacteria 1099
64 Ga0068856_100125689 3300005614 Bacteria 2568
65 Ga0070702_100029770 3300005615 Unclassified 2972
66 Ga0070702_100424903 3300005615 Bacteria 957
67 Ga0068852_100192963 3300005616 Bacteria 1923
68 Ga0068859_101673163 3300005617 Bacteria 703
69 Ga0068864_100481447 3300005618 Bacteria 1191
70 Ga0068866_10481956 3300005718 Bacteria 817
71 Ga0068861_100037585 3300005719 Bacteria 3600
72 Ga0068861_100243697 3300005719 Bacteria 1530
73 Ga0068863_100105615 3300005841 Bacteria 2679
74 Ga0068863_100261244 3300005841 Bacteria 1674
75 Ga0068863_101776845 3300005841 Unclassified 626
76 Ga0068858_100647034 3300005842 Bacteria 1027
77 Ga0068860_100038245 3300005843 Bacteria 4590
78 Ga0068860_100346731 3300005843 Bacteria 1461
79 Ga0068862_100038656 3300005844 Unclassified 4048
80 Ga0068862_100100930 3300005844 Bacteria 2524
81 Ga0070717_10003421 3300006028 Bacteria 11345
82 Ga0070717_10677295 3300006028 Bacteria 937
83 Ga0097621_100019438 3300006237 Bacteria 5213
84 Ga0068871_100009076 3300006358 Bacteria 7184
85 Ga0075433_10161758 3300006852 Bacteria 1993
86 Ga0075434_100008750 3300006871 Bacteria 9419
87 Ga0075436_100072385 3300006914 Bacteria 2385
88 Ga0075436_100088166 3300006914 Bacteria 2155
89 Ga0097620_101672312 3300006931 Bacteria 703
90 Ga0075435_100011162 3300007076 Bacteria 6590
91 Ga0105240_10055252 3300009093 Bacteria 4972
92 Ga0105240_10612277 3300009093 Unclassified 1198
93 Ga0111539_10000034 3300009094 Bacteria 154474
94 Ga0111539_10194841 3300009094 Unclassified 2364
95 Ga0111539_10200247 3300009094 Bacteria 2329
96 Ga0105245_10063480 3300009098 Unclassified 3335
97 Ga0105245_10837227 3300009098 Unclassified 959
98 Ga0114129_10049713 3300009147 Bacteria 5890
99 Ga0114129_10367117 3300009147 Bacteria 1903
100 Ga0114129_11460756 3300009147 Bacteria 841
101 Ga0105243_10823963 3300009148 Bacteria 917
102 Ga0105241_10362657 3300009174 Bacteria 1261
103 Ga0105242_10017459 3300009176 Bacteria 5594
104 Ga0105248_10784632 3300009177 Unclassified 1075
105 Ga0105237_10081020 3300009545 Bacteria 3236
106 Ga0105237_11640020 3300009545 Unclassified 650
107 Ga0105238_10034511 3300009551 Bacteria 5147
108 Ga0105249_10014335 3300009553 Bacteria 7010
109 Ga0105246_10950929 3300011119 Bacteria 774
110 Ga0157371_10609351 3300013102 Bacteria 813
111 Ga0157370_10025343 3300013104 Bacteria 5871
112 Ga0157369_10012906 3300013105 Bacteria 9468
113 Ga0157374_10099178 3300013296 Bacteria 2790
114 Ga0157378_10066889 3300013297 Unclassified 3219
115 Ga0157378_10612610 3300013297 Bacteria 1101
116 Ga0163162_10022721 3300013306 Bacteria 6184
117 Ga0163162_10699612 3300013306 Bacteria 1135
118 Ga0163162_10967599 3300013306 Bacteria 962
119 Ga0157372_10028067 3300013307 Bacteria 6139
120 Ga0157372_10259047 3300013307 Bacteria 2020
121 Ga0157372_10438283 3300013307 Bacteria 1523
122 Ga0157375_11654432 3300013308 Unclassified 757
123 Ga0157375_11891363 3300013308 Bacteria 708
124 Ga0163163_10440940 3300014325 Bacteria 1362
125 Ga0157380_10108273 3300014326 Unclassified 2329
126 Ga0157380_10127302 3300014326 Bacteria 2167
127 Ga0157380_10180195 3300014326 Bacteria 1855
128 Ga0157376_10632946 3300014969 Unclassified 1068
129 Ga0182007_10054798 3300015262 Bacteria 1311
130 Ga0213873_10152465 3300021358 Bacteria 696
131 Ga0209675_1079913 3300025291 Bacteria 607
132 Ga0207647_10014713 3300025904 Bacteria 5388
133 Ga0207695_10111940 3300025913 Bacteria 2708
134 Ga0207671_10391468 3300025914 Bacteria 1105
135 Ga0207671_11157776 3300025914 Unclassified 606
136 Ga0207663_11100779 3300025916 Unclassified 639
137 Ga0207657_10168889 3300025919 Bacteria 1773
138 Ga0207657_10611444 3300025919 Bacteria 850
139 Ga0207646_10087691 3300025922 Bacteria 2784
140 Ga0207681_10038466 3300025923 Plasmid 3170
141 Ga0207681_11068430 3300025923 Unclassified 678
142 Ga0207694_10305759 3300025924 Unclassified 1310
143 Ga0207650_10080806 3300025925 Bacteria 2465
144 Ga0207700_10292778 3300025928 Bacteria 1404
145 Ga0207644_10019822 3300025931 Unclassified 4566
146 Ga0207706_10335805 3300025933 Unclassified 1315
147 Ga0207709_10757672 3300025935 Bacteria 781
148 Ga0207669_11948358 3300025937 Unclassified 502
149 Ga0207665_10154570 3300025939 Bacteria 1645
150 Ga0207691_10853785 3300025940 Bacteria 763
151 Ga0207711_10190015 3300025941 Unclassified 1871
152 Ga0207711_10869205 3300025941 Unclassified 839
153 Ga0207689_10363179 3300025942 Bacteria 1204
154 Ga0207651_10466500 3300025960 Bacteria 1086
155 Ga0207712_10655722 3300025961 Unclassified 912
156 Ga0207712_11111468 3300025961 Bacteria 704
157 Ga0207668_10606751 3300025972 Unclassified 954
158 Ga0207668_10667638 3300025972 Unclassified 911
159 Ga0207677_10234406 3300026023 Bacteria 1481
160 Ga0207703_10193519 3300026035 Bacteria 1803
161 Ga0207639_10795098 3300026041 Unclassified 881
162 Ga0207708_10012531 3300026075 Bacteria 6321
163 Ga0207702_10557161 3300026078 Bacteria 1122
164 Ga0207641_10149447 3300026088 Bacteria 2115
165 Ga0207641_10583654 3300026088 Bacteria 1093
166 Ga0207641_11643721 3300026088 Unclassified 644
167 Ga0207648_10133438 3300026089 Bacteria 2186
168 Ga0207648_10227913 3300026089 Unclassified 1657
169 Ga0207676_10617963 3300026095 Bacteria 1043
170 Ga0207674_10036487 3300026116 Bacteria 5120
171 Ga0207675_100057177 3300026118 Bacteria 3639
172 Ga0207698_10058705 3300026142 Bacteria 2983
173 Ga0207428_10000062 3300027907 Bacteria 154492
174 Ga0207428_10018105 3300027907 Bacteria 6027
175 Ga0207428_10116602 3300027907 Unclassified 2050
176 Ga0268265_10290527 3300028380 Bacteria 1467
177 Ga0268265_10738321 3300028380 Bacteria 954
178 Ga0268265_11881705 3300028380 Unclassified 605
179 Ga0268264_10153943 3300028381 Bacteria 2064
180 Ga0268264_10971095 3300028381 Unclassified 855
181 Ga0265338_10079040 3300028800 Bacteria 2770
182 Ga0265325_10020456 3300031241 Bacteria 3647
183 Ga0265316_10871656 3300031344 Unclassified 630
184 Ga0307509_10000380 3300031507 Bacteria 74877
185 Ga0265313_10072755 3300031595 Unclassified 1579
186 Ga0265314_10046298 3300031711 Bacteria 3070
187 Ga0265342_10170781 3300031712 Bacteria 1196
188 Ga0307516_10044734 3300031730 Bacteria 4378
189 Ga0307405_10394317 3300031731 Bacteria 1082
190 Ga0316585_10175102 3300032137 Bacteria 709
191 Ga0395900_0064718 3300037418 Bacteria 3757
192 Ga0395898_0033711 3300037466 Bacteria 5107
193 Ga0436361_1101389 3300039447 Bacteria 1121
194 Ga0436362_0771156 3300039453 Bacteria 3150
195 Ga0436362_1231941 3300039453 Bacteria 840
196 Ga0495580_0005148 3300046472 Bacteria 10877
197 Ga0496102_1049813 3300048905 Unclassified 735
198 Ga0495682_0092188 3300049460 Bacteria 1088
199 nmdc:mga05p37_239050_c1 3300050507 Bacteria 1724
200 nmdc:mga09592_876256_c1 3300050508 Bacteria 756
201 nmdc:mga06r32_1154735_c1 3300050510 Bacteria 722
202 nmdc:mga08y16_18692_c1 3300050511 Bacteria 7300
203 nmdc:mga08y16_36_c1 3300050511 Bacteria 155927
204 nmdc:mga0n895_12043_c1 3300050512 Bacteria 7742
205 nmdc:mga0rr50_110902_c1 3300050513 Bacteria 2171
206 nmdc:mga0rr50_932146_c1 3300050513 Unclassified 740
207 nmdc:mga08x19_48071_c1 3300050514 Bacteria 2732
208 nmdc:mga0a205_3942_c1 3300050515 Bacteria 13284
209 nmdc:mga0a205_46942_c1 3300050515 Bacteria 4166
210 Ga0495601_0381551 3300053077 Bacteria 915
211 Ga0500641_0002199 3300053096 Bacteria 6903
212 Ga0500559_0010687 3300053136 Bacteria 3935
213 Ga0590071_006243 3300059421 Bacteria 2838
214 Ga0590074_019427 3300059423 Bacteria 1165
215 Ga0590075_045416 3300059424 Bacteria 1125
216 Ga0590077_017269 3300059426 Bacteria 1516
217 2511389809 2511231027 Bacteria 5013807
218 2645721366 2643221961 Bacteria 3919167
219 2645724637 2643221962 Bacteria 3874254
220 2686537021 2684623035 Bacteria 8032739
221 2739204006 2738543005 Bacteria 5278128
222 2842871911 2842871566 Bacteria 4827117
223 2928145741 2928142448 Bacteria 5288925
224 2954009148 2954002825 Bacteria 9173742
225 8008581423 8008574985 Bacteria 7815457
226 Ga0453683_0037064
227 MBSR1b_contig_11080172
228 JGI24740J21852_10032584
229 JGI24737J22298_10200315
230 rootL2_10155668
231 rootH1_10221845
232 Ga0065704_10226330
233 Ga0065704_10254795
234 Ga0065715_10091855
235 Ga0065707_10120619
236 Ga0065707_10338831
237 Ga0070676_10505447
238 Ga0070690_100016591
239 Ga0070670_100100061
240 Ga0068869_100333056
241 Ga0068869_100978363
242 Ga0070682_100030806
243 Ga0068868_101382586
244 Ga0070660_100764540
245 Ga0070687_100341104
246 Ga0070692_10247244
247 Ga0070692_10351156
248 Ga0070692_10849912
249 Ga0070668_100323682
250 Ga0070668_101043158
251 Ga0070669_100020290
252 Ga0070671_100025212
253 Ga0070674_101604229
254 Ga0070673_100589338
255 Ga0070659_101235432
256 Ga0070713_100312313
257 Ga0070701_10106101
258 Ga0070711_100260269
259 Ga0070711_100367064
260 Ga0070711_100509650
261 Ga0070705_100026353
262 Ga0070700_100006279
263 Ga0070700_100304377
264 Ga0070694_100184012
265 Ga0070708_100095527
266 Ga0068867_100435133
267 Ga0068867_101213507
268 Ga0070706_100032681
269 Ga0070707_100474619
270 Ga0070698_100035804
271 Ga0070699_100136204
272 Ga0070699_100185785
273 Ga0070697_100007206
274 Ga0070697_101200938
275 Ga0068853_100132694
276 Ga0068853_100471996
277 Ga0070686_100006532
278 Ga0070695_100074665
279 Ga0070695_100377649
280 Ga0070695_100743728
281 Ga0070696_100114834
282 Ga0070696_101095643
283 Ga0070693_100130585
284 Ga0070693_100624490
285 Ga0070704_100047607
286 Ga0070704_100349355
287 Ga0068855_101706777
288 Ga0068854_100429205
289 Ga0068856_100125689
290 Ga0070702_100029770
291 Ga0070702_100424903
292 Ga0068852_100192963
293 Ga0068859_101673163
294 Ga0068864_100481447
295 Ga0068866_10481956
296 Ga0068861_100037585
297 Ga0068861_100243697
298 Ga0068863_100105615
299 Ga0068863_100261244
300 Ga0068863_101776845
301 Ga0068858_100647034
302 Ga0068860_100038245
303 Ga0068860_100346731
304 Ga0068862_100038656
305 Ga0068862_100100930
306 Ga0070717_10003421
307 Ga0070717_10677295
308 Ga0097621_100019438
309 Ga0068871_100009076
310 Ga0075433_10161758
311 Ga0075434_100008750
312 Ga0075436_100072385
313 Ga0075436_100088166
314 Ga0097620_101672312
315 Ga0075435_100011162
316 Ga0105240_10055252
317 Ga0105240_10612277
318 Ga0111539_10000034
319 Ga0111539_10194841
320 Ga0111539_10200247
321 Ga0105245_10063480
322 Ga0105245_10837227
323 Ga0114129_10049713
324 Ga0114129_10367117
325 Ga0114129_11460756
326 Ga0105243_10823963
327 Ga0105241_10362657
328 Ga0105242_10017459
329 Ga0105248_10784632
330 Ga0105237_10081020
331 Ga0105237_11640020
332 Ga0105238_10034511
333 Ga0105249_10014335
334 Ga0105246_10950929
335 Ga0157371_10609351
336 Ga0157370_10025343
337 Ga0157369_10012906
338 Ga0157374_10099178
339 Ga0157378_10066889
340 Ga0157378_10612610
341 Ga0163162_10022721
342 Ga0163162_10699612
343 Ga0163162_10967599
344 Ga0157372_10028067
345 Ga0157372_10259047
346 Ga0157372_10438283
347 Ga0157375_11654432
348 Ga0157375_11891363
349 Ga0163163_10440940
350 Ga0157380_10108273
351 Ga0157380_10127302
352 Ga0157380_10180195
353 Ga0157376_10632946
354 Ga0182007_10054798
355 Ga0213873_10152465
356 Ga0209675_1079913
357 Ga0207647_10014713
358 Ga0207695_10111940
359 Ga0207671_10391468
360 Ga0207671_11157776
361 Ga0207663_11100779
362 Ga0207657_10168889
363 Ga0207657_10611444
364 Ga0207646_10087691
365 Ga0207681_10038466
366 Ga0207681_11068430
367 Ga0207694_10305759
368 Ga0207650_10080806
369 Ga0207700_10292778
370 Ga0207644_10019822
371 Ga0207706_10335805
372 Ga0207709_10757672
373 Ga0207669_11948358
374 Ga0207665_10154570
375 Ga0207691_10853785
376 Ga0207711_10190015
377 Ga0207711_10869205
378 Ga0207689_10363179
379 Ga0207651_10466500
380 Ga0207712_10655722
381 Ga0207712_11111468
382 Ga0207668_10606751
383 Ga0207668_10667638
384 Ga0207677_10234406
385 Ga0207703_10193519
386 Ga0207639_10795098
387 Ga0207708_10012531
388 Ga0207702_10557161
389 Ga0207641_10149447
390 Ga0207641_10583654
391 Ga0207641_11643721
392 Ga0207648_10133438
393 Ga0207648_10227913
394 Ga0207676_10617963
395 Ga0207674_10036487
396 Ga0207675_100057177
397 Ga0207698_10058705
398 Ga0207428_10000062
399 Ga0207428_10018105
400 Ga0207428_10116602
401 Ga0268265_10290527
402 Ga0268265_10738321
403 Ga0268265_11881705
404 Ga0268264_10153943
405 Ga0268264_10971095
406 Ga0265338_10079040
407 Ga0265325_10020456
408 Ga0265316_10871656
409 Ga0307509_10000380
410 Ga0265313_10072755
411 Ga0265314_10046298
412 Ga0265342_10170781
413 Ga0307516_10044734
414 Ga0307405_10394317
415 Ga0316585_10175102
416 Ga0395900_0064718
417 Ga0395898_0033711
418 Ga0436361_1101389
419 Ga0436362_0771156
420 Ga0436362_1231941
421 Ga0495580_0005148
422 Ga0496102_1049813
423 Ga0495682_0092188
424 nmdc:mga05p37_239050_c1
425 nmdc:mga09592_876256_c1
426 nmdc:mga06r32_1154735_c1
427 nmdc:mga08y16_18692_c1
428 nmdc:mga08y16_36_c1
429 nmdc:mga0n895_12043_c1
430 nmdc:mga0rr50_110902_c1
431 nmdc:mga0rr50_932146_c1
432 nmdc:mga08x19_48071_c1
433 nmdc:mga0a205_3942_c1
434 nmdc:mga0a205_46942_c1
435 Ga0495601_0381551
436 Ga0500641_0002199
437 Ga0500559_0010687
438 Ga0590071_006243
439 Ga0590074_019427
440 Ga0590075_045416
441 Ga0590077_017269
442 2511389809
443 2645721366
444 2645724637
445 2686537021
446 2739204006
447 2842871911
448 2928145741
449 2954009148
450 8008581423

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06983

3-dmu-9_3-mt

3-demethylubiquinone-9 3-methyltransferase

25

139

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u69-assembly3.cif.gz_C crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.96 20 174
1u69-assembly2.cif.gz_D crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9595 20 174
1u69-assembly3.cif.gz_C crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9537 20 174
1u69-assembly2.cif.gz_D crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9532 20 174
1u69-assembly1.cif.gz_A crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9364 20 174
ID Description Score Start End Superfamily
1u69D00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9538 20 174 3.10.180.10
1u69D00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9474 20 174 3.10.180.10
af_Q2G1U2_73_132_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8927 91 136 3.30.720.110
3omsA01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8407 25 88 3.30.720.100
3omsA01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8166 25 88 3.30.720.100
ID Description Score Start End GO Terms
AF-A0A4V1SQP6-F1-model_v4 VOC family protein 1.002 119 175
AF-A0A2V7U7S1-F1-model_v4 PhnB-like domain-containing protein 0.9994 105 174
AF-A0A537CIB8-F1-model_v4 VOC family protein 0.9981 100 174
AF-S4MYN5-F1-model_v4 PhnB-like domain-containing protein 0.9968 96 173
AF-A0A1H7K5H5-F1-model_v4 3-demethylubiquinone-9 3-methyltransferase 0.994 105 176 GO:0008168
GO:0032259

Map