F337935

General Info

Members Datasets Scaffolds Average Seq Length
225 180 450 334

Family's Representative Sequence

Representative Sequence 3300031616|Ga0307508_10130903|Ga0307508_101309032
Length 319
Sequence MAYVNPTGEFTRDQNYLTTRITADGRDGYPVEPGRYRLIVSRACPWANRAIIVRRLLGLEDALSMGVAGPTHDKRSWTFDLDPGGRDPVLGIERLQEAFFKRDPDYARGITVPAIVDVPTGQVVTNDFAQITIDLSLEWTKFHRPGAPALYPEHLRERIDKINRFVFADVNNGVYRAGFAGAQEAYDKLSELLSTQRYLVGDTITEADVRLFTTLARFDPVYHGHFKCNRQKLSEMPVLWAYARDLFQTPGFGDTIDFVHIKQHYYIVHKDINPTQIVPAGPDLANWLTEHGREALGGRPFGDGSGEEVLAGHGASPSV

Samples

Sample ID Description Type Environment
1 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
37 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
38 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
39 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
40 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
60 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
62 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
63 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
64 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
65 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
66 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
67 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
68 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
69 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
70 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
71 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
72 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
73 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
74 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
75 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
76 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
77 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
78 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
79 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
80 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
81 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
84 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
85 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
86 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
87 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
88 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
89 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
90 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
91 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
92 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
93 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
94 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
95 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
96 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
97 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
98 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
99 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
100 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
101 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
102 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
103 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
104 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
105 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
106 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
107 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
108 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
109 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
110 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
111 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
112 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
113 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
114 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
115 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
116 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
117 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
118 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
119 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
125 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
126 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
127 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
128 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
129 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
130 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
131 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
132 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
133 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
134 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
135 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
136 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
137 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
138 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
139 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
140 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
141 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
142 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
143 2582580736 Prauserella sp. Am3 Isolate Unclassified
144 2643221548 Streptomyces sp. Root55 Isolate Unclassified
145 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
146 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
147 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
148 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
149 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
150 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
151 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
152 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
153 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
154 2858882152 Micromonospora noduli MED15 Isolate Nodule
155 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
156 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
157 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
158 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
159 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
160 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
161 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
162 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
163 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
164 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
165 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
166 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
167 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
168 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
169 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
170 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
171 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
172 2922554459 Rhodococcus sp. 66b Isolate Unclassified
173 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
174 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
175 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
176 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
177 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
178 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
179 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
180 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.67
Metatranscriptomes 0.44
Isolates 16.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4
Nodule 2.67
Rhizoplane 5.33
Rhizosphere 68.89
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307508_10130903 3300031616 Bacteria 2112
2 Ga0070683_100116524 3300005329 Bacteria 2522
3 Ga0070683_100186141 3300005329 Bacteria 1971
4 Ga0068868_100007727 3300005338 Bacteria 7673
5 Ga0070668_100000137 3300005347 Bacteria 46061
6 Ga0070675_100001623 3300005354 Bacteria 16596
7 Ga0070675_100348102 3300005354 Bacteria 1314
8 Ga0070674_100077615 3300005356 Bacteria 2365
9 Ga0070674_100285968 3300005356 Bacteria 1309
10 Ga0070673_100283475 3300005364 Bacteria 1454
11 Ga0070659_100385609 3300005366 Bacteria 1181
12 Ga0070714_100001361 3300005435 Bacteria 17691
13 Ga0070713_100066378 3300005436 Bacteria 3034
14 Ga0070700_100003454 3300005441 Bacteria 8151
15 Ga0070678_100338705 3300005456 Bacteria 1290
16 Ga0070662_100061908 3300005457 Bacteria 2733
17 Ga0070681_10076878 3300005458 Bacteria 3296
18 Ga0070679_100270237 3300005530 Bacteria 1654
19 Ga0070684_100036478 3300005535 Bacteria 4213
20 Ga0070684_100036588 3300005535 Bacteria 4206
21 Ga0068853_100006182 3300005539 Bacteria 9481
22 Ga0070664_100000319 3300005564 Bacteria 34990
23 Ga0068856_100338034 3300005614 Bacteria 1524
24 Ga0068852_100156418 3300005616 Bacteria 2124
25 Ga0068861_100193028 3300005719 Bacteria 1704
26 Ga0068862_100013590 3300005844 Bacteria 6743
27 Ga0068862_100181026 3300005844 Bacteria 1892
28 Ga0081455_10036102 3300005937 Bacteria 4405
29 Ga0081539_10002456 3300005985 Bacteria 26129
30 Ga0075365_10007433 3300006038 Bacteria 6134
31 Ga0075364_10313658 3300006051 Bacteria 1068
32 Ga0075428_100000084 3300006844 Bacteria 78189
33 Ga0075430_100229599 3300006846 Bacteria 1539
34 Ga0075430_100318020 3300006846 Bacteria 1287
35 Ga0111539_10003045 3300009094 Bacteria 22217
36 Ga0105245_10268704 3300009098 Bacteria 1662
37 Ga0114129_10000017 3300009147 Bacteria 126216
38 Ga0105237_10081245 3300009545 Bacteria 3232
39 Ga0105238_10034678 3300009551 Bacteria 5134
40 Ga0105239_10207666 3300010375 Bacteria 2195
41 Ga0157372_10216496 3300013307 Bacteria 2220
42 Ga0163163_10457319 3300014325 Bacteria 1337
43 Ga0157377_10003572 3300014745 Bacteria 7039
44 Ga0157379_10004373 3300014968 Bacteria 12089
45 Ga0213875_10000333 3300021388 Bacteria 44800
46 Ga0213875_10007027 3300021388 Bacteria 5857
47 Ga0224712_10007197 3300022467 Bacteria 3225
48 Ga0207643_10139318 3300025908 Bacteria 1448
49 Ga0207695_10057780 3300025913 Bacteria 4029
50 Ga0207649_10010772 3300025920 Bacteria 5028
51 Ga0207681_10112080 3300025923 Bacteria 1986
52 Ga0207694_10046875 3300025924 Bacteria 3341
53 Ga0207659_10062264 3300025926 Bacteria 2692
54 Ga0207687_10083235 3300025927 Bacteria 2316
55 Ga0207690_10203079 3300025932 Bacteria 1506
56 Ga0207706_10085296 3300025933 Bacteria 2777
57 Ga0207689_10015269 3300025942 Bacteria 6502
58 Ga0207661_10050412 3300025944 Bacteria 3316
59 Ga0207661_10211857 3300025944 Bacteria 1708
60 Ga0207679_10011272 3300025945 Bacteria 5781
61 Ga0207712_10171460 3300025961 Bacteria 1696
62 Ga0207677_10090851 3300026023 Bacteria 2220
63 Ga0207639_10029184 3300026041 Bacteria 4036
64 Ga0207708_10030280 3300026075 Bacteria 4103
65 Ga0207683_10053479 3300026121 Bacteria 3541
66 Ga0207683_10134651 3300026121 Bacteria 2224
67 Ga0207683_10375689 3300026121 Bacteria 1306
68 Ga0207698_10096118 3300026142 Bacteria 2441
69 Ga0207428_10066438 3300027907 Bacteria 2842
70 Ga0268265_10013602 3300028380 Bacteria 5533
71 Ga0268265_10140813 3300028380 Bacteria 2019
72 Ga0307515_10021178 3300028794 Bacteria 11544
73 Ga0307511_10000322 3300030521 Bacteria 51191
74 Ga0307512_10017823 3300030522 Bacteria 6501
75 Ga0307513_10022232 3300031456 Bacteria 7459
76 Ga0307508_10203737 3300031616 Bacteria 1579
77 Ga0307405_10056206 3300031731 Bacteria 2467
78 Ga0307405_10081630 3300031731 Bacteria 2114
79 Ga0307413_10118746 3300031824 Bacteria 1786
80 Ga0307410_10002501 3300031852 Bacteria 8880
81 Ga0307410_10149907 3300031852 Bacteria 1735
82 Ga0307406_10001982 3300031901 Bacteria 11189
83 Ga0307406_10041550 3300031901 Bacteria 2866
84 Ga0307407_10007817 3300031903 Bacteria 4868
85 Ga0307412_10144406 3300031911 Bacteria 1747
86 Ga0307409_100000875 3300031995 Bacteria 13927
87 Ga0307409_100003446 3300031995 Bacteria 8589
88 Ga0307409_100085123 3300031995 Bacteria 2569
89 Ga0307416_100000423 3300032002 Bacteria 21567
90 Ga0307416_100204597 3300032002 Bacteria 1877
91 Ga0307416_100750098 3300032002 Bacteria 1069
92 Ga0307411_10225272 3300032005 Bacteria 1458
93 Ga0307415_100000035 3300032126 Bacteria 58950
94 Ga0307510_10138624 3300033180 Bacteria 2083
95 Ga0373956_0003735 3300035119 Bacteria 6133
96 Ga0395899_0073855 3300037312 Bacteria 2493
97 Ga0395900_0411311 3300037418 Bacteria 1315
98 Ga0395898_0036943 3300037466 Bacteria 4848
99 Ga0395905_0177070 3300037471 Bacteria 2002
100 Ga0436364_0265841 3300037853 Bacteria 68488
101 Ga0436364_0971903 3300037853 Bacteria 128436
102 Ga0395901_0014609 3300038443 Bacteria 7981
103 Ga0451853_0895170 3300041512 Bacteria 2692
104 Ga0466969_0006776 3300044656 Bacteria 6094
105 Ga0466969_0017855 3300044656 Bacteria 3700
106 Ga0466972_0010230 3300044658 Bacteria 4711
107 Ga0466965_0051769 3300044683 Bacteria 2037
108 Ga0466966_0044120 3300044684 Bacteria 2855
109 Ga0466961_0007273 3300044693 Bacteria 7044
110 Ga0466961_0173694 3300044693 Bacteria 1340
111 Ga0466963_0044138 3300044694 Bacteria 2934
112 Ga0466963_0062983 3300044694 Bacteria 2481
113 Ga0466964_0066582 3300044706 Bacteria 1512
114 Ga0466964_0124566 3300044706 Bacteria 1166
115 Ga0466968_0000520 3300044735 Bacteria 13079
116 Ga0466968_0044155 3300044735 Bacteria 1889
117 Ga0466970_0030733 3300044765 Bacteria 2833
118 Ga0466957_0050715 3300044842 Bacteria 2525
119 Ga0466960_0001803 3300044901 Bacteria 7860
120 Ga0466960_0013195 3300044901 Bacteria 3504
121 Ga0466959_0015653 3300045049 Bacteria 5529
122 Ga0466959_0157361 3300045049 Bacteria 1598
123 Ga0466958_0037401 3300045836 Bacteria 2908
124 Ga0466958_0106266 3300045836 Bacteria 1750
125 Ga0466967_0002802 3300045976 Bacteria 11058
126 Ga0466967_0022788 3300045976 Bacteria 5120
127 Ga0466967_0027820 3300045976 Bacteria 4709
128 Ga0466967_0067276 3300045976 Bacteria 3195
129 Ga0466967_0090389 3300045976 Bacteria 2781
130 Ga0466967_0105351 3300045976 Bacteria 2583
131 Ga0495629_0102406 3300046459 Bacteria 1998
132 Ga0495606_0000578 3300046507 Bacteria 58225
133 Ga0495668_0000293 3300046616 Bacteria 68641
134 Ga0495668_0000340 3300046616 Bacteria 62442
135 Ga0495625_0003796 3300046660 Bacteria 14639
136 Ga0495635_0123229 3300046663 Bacteria 1768
137 Ga0495658_0208721 3300046683 Bacteria 1220
138 Ga0495683_0017096 3300047323 Bacteria 3762
139 Ga0495626_0000046 3300048091 Bacteria 162660
140 Ga0496100_0002680 3300048903 Bacteria 9078
141 Ga0496102_0133621 3300048905 Bacteria 2324
142 Ga0496104_0011748 3300048907 Bacteria 7856
143 Ga0496104_0039881 3300048907 Bacteria 4399
144 Ga0496104_0108874 3300048907 Bacteria 2656
145 Ga0496105_0013333 3300048908 Bacteria 6523
146 Ga0496105_0122819 3300048908 Bacteria 2141
147 Ga0496110_0015562 3300048913 Bacteria 6335
148 Ga0496114_0070863 3300048917 Bacteria 2929
149 Ga0496114_0076088 3300048917 Bacteria 2828
150 Ga0496114_0101686 3300048917 Bacteria 2454
151 Ga0496114_0351601 3300048917 Bacteria 1303
152 Ga0496119_0004059 3300048922 Bacteria 14771
153 Ga0496120_0003308 3300048923 Bacteria 14812
154 Ga0496120_0042418 3300048923 Bacteria 2657
155 Ga0496121_0009757 3300048924 Bacteria 10977
156 Ga0496122_0022359 3300048925 Bacteria 5624
157 Ga0496123_0009759 3300048926 Bacteria 8584
158 Ga0496124_0009325 3300048927 Bacteria 10113
159 Ga0496126_0011660 3300048929 Bacteria 9069
160 Ga0501032_0076765 3300049569 Bacteria 2224
161 Ga0501037_0037921 3300049573 Bacteria 3553
162 Ga0501040_0070030 3300049576 Bacteria 2420
163 Ga0501041_0089418 3300049577 Bacteria 1901
164 Ga0501047_0000066 3300049581 Bacteria 132744
165 Ga0501070_0004717 3300049586 Bacteria 11678
166 Ga0501075_0257821 3300049591 Bacteria 1329
167 Ga0501079_0001168 3300049741 Bacteria 18359
168 Ga0501080_0000232 3300049742 Bacteria 41967
169 Ga0501080_0031991 3300049742 Bacteria 4904
170 Ga0501045_0068296 3300049824 Bacteria 2611
171 nmdc:mga00v17_100092_c1 3300050491 Bacteria 1829
172 nmdc:mga00v17_37938_c1 3300050491 Bacteria 2879
173 nmdc:mga05p37_2286_c1 3300050507 Bacteria 22337
174 nmdc:mga0qj67_132599_c1 3300050509 Bacteria 2018
175 nmdc:mga0qj67_8043_c1 3300050509 Bacteria 7803
176 nmdc:mga08y16_21700_c1 3300050511 Bacteria 6778
177 Ga0500635_0003523 3300053080 Bacteria 3953
178 Ga0495619_0108389 3300053085 Bacteria 1896
179 Ga0500583_0002791 3300053092 Bacteria 5342
180 Ga0500641_0012964 3300053096 Bacteria 3056
181 Ga0500650_0019261 3300053098 Bacteria 2974
182 Ga0500652_001294 3300053131 Bacteria 7926
183 Ga0501084_0126670 3300054114 Bacteria 2149
184 Ga0501082_0258183 3300060353 Bacteria 1516
185 Ga0466962_0053187 3300061719 Bacteria 1935
186 Ga0530510_0010350 3300061734 Bacteria 6538
187 Ga0530510_0306926 3300061734 Bacteria 1188
188 2583152696 2582580736 Bacteria 5325865
189 2643761921 2643221548 Bacteria 8053412
190 2644460652 2643221682 Bacteria 6743283
191 2731908714 2731639228 Bacteria 4187555
192 2753267644 2751185782 Bacteria 11227053
193 2832008138 2832004796 Bacteria 6538017
194 2839988004 2839986021 Bacteria 3685650
195 2855673998 2855670206 Bacteria 7120389
196 2855679587 2855676851 Bacteria 7063653
197 2857289580 2857288857 Bacteria 7189066
198 2858850593 2858848962 Bacteria 6963058
199 2858888127 2858882152 Bacteria 7230291
200 2858891046 2858888857 Bacteria 7060307
201 2858897579 2858895516 Bacteria 7378898
202 2861521896 2861520306 Bacteria 8348283
203 2862183323 2862178590 Bacteria 8583590
204 2866067892 2866065130 Bacteria 6518152
205 2867319431 2867312974 Bacteria 7058875
206 2867325402 2867319477 Bacteria 7069771
207 2867510825 2867507094 Bacteria 6506033
208 2869050910 2869048445 Bacteria 6875584
209 2869067180 2869061728 Bacteria 7112407
210 2869075121 2869068681 Bacteria 7205615
211 2880495157 2880489317 Bacteria 7096270
212 2880497192 2880495981 Bacteria 7340502
213 2887447019 2887443736 Bacteria 4426037
214 2887479622 2887478801 Bacteria 8972725
215 2904775858 2904770941 Bacteria 5580202
216 2908812637 2908811453 Bacteria 5478616
217 2922557522 2922554459 Bacteria 6683962
218 2929231251 2929226422 Bacteria 7248583
219 8003833596 8003830390 Bacteria 6541657
220 8003877744 8003870546 Bacteria 7396674
221 8054706776 8054704163 Bacteria 7247792
222 8054733612 8054727385 Bacteria 7558670
223 8054740811 8054734606 Bacteria 6947278
224 8055415921 8055412473 Bacteria 6257500
225 8056059019 8056054917 Bacteria 5736694
226 Ga0307508_10130903
227 Ga0070683_100116524
228 Ga0070683_100186141
229 Ga0068868_100007727
230 Ga0070668_100000137
231 Ga0070675_100001623
232 Ga0070675_100348102
233 Ga0070674_100077615
234 Ga0070674_100285968
235 Ga0070673_100283475
236 Ga0070659_100385609
237 Ga0070714_100001361
238 Ga0070713_100066378
239 Ga0070700_100003454
240 Ga0070678_100338705
241 Ga0070662_100061908
242 Ga0070681_10076878
243 Ga0070679_100270237
244 Ga0070684_100036478
245 Ga0070684_100036588
246 Ga0068853_100006182
247 Ga0070664_100000319
248 Ga0068856_100338034
249 Ga0068852_100156418
250 Ga0068861_100193028
251 Ga0068862_100013590
252 Ga0068862_100181026
253 Ga0081455_10036102
254 Ga0081539_10002456
255 Ga0075365_10007433
256 Ga0075364_10313658
257 Ga0075428_100000084
258 Ga0075430_100229599
259 Ga0075430_100318020
260 Ga0111539_10003045
261 Ga0105245_10268704
262 Ga0114129_10000017
263 Ga0105237_10081245
264 Ga0105238_10034678
265 Ga0105239_10207666
266 Ga0157372_10216496
267 Ga0163163_10457319
268 Ga0157377_10003572
269 Ga0157379_10004373
270 Ga0213875_10000333
271 Ga0213875_10007027
272 Ga0224712_10007197
273 Ga0207643_10139318
274 Ga0207695_10057780
275 Ga0207649_10010772
276 Ga0207681_10112080
277 Ga0207694_10046875
278 Ga0207659_10062264
279 Ga0207687_10083235
280 Ga0207690_10203079
281 Ga0207706_10085296
282 Ga0207689_10015269
283 Ga0207661_10050412
284 Ga0207661_10211857
285 Ga0207679_10011272
286 Ga0207712_10171460
287 Ga0207677_10090851
288 Ga0207639_10029184
289 Ga0207708_10030280
290 Ga0207683_10053479
291 Ga0207683_10134651
292 Ga0207683_10375689
293 Ga0207698_10096118
294 Ga0207428_10066438
295 Ga0268265_10013602
296 Ga0268265_10140813
297 Ga0307515_10021178
298 Ga0307511_10000322
299 Ga0307512_10017823
300 Ga0307513_10022232
301 Ga0307508_10203737
302 Ga0307405_10056206
303 Ga0307405_10081630
304 Ga0307413_10118746
305 Ga0307410_10002501
306 Ga0307410_10149907
307 Ga0307406_10001982
308 Ga0307406_10041550
309 Ga0307407_10007817
310 Ga0307412_10144406
311 Ga0307409_100000875
312 Ga0307409_100003446
313 Ga0307409_100085123
314 Ga0307416_100000423
315 Ga0307416_100204597
316 Ga0307416_100750098
317 Ga0307411_10225272
318 Ga0307415_100000035
319 Ga0307510_10138624
320 Ga0373956_0003735
321 Ga0395899_0073855
322 Ga0395900_0411311
323 Ga0395898_0036943
324 Ga0395905_0177070
325 Ga0436364_0265841
326 Ga0436364_0971903
327 Ga0395901_0014609
328 Ga0451853_0895170
329 Ga0466969_0006776
330 Ga0466969_0017855
331 Ga0466972_0010230
332 Ga0466965_0051769
333 Ga0466966_0044120
334 Ga0466961_0007273
335 Ga0466961_0173694
336 Ga0466963_0044138
337 Ga0466963_0062983
338 Ga0466964_0066582
339 Ga0466964_0124566
340 Ga0466968_0000520
341 Ga0466968_0044155
342 Ga0466970_0030733
343 Ga0466957_0050715
344 Ga0466960_0001803
345 Ga0466960_0013195
346 Ga0466959_0015653
347 Ga0466959_0157361
348 Ga0466958_0037401
349 Ga0466958_0106266
350 Ga0466967_0002802
351 Ga0466967_0022788
352 Ga0466967_0027820
353 Ga0466967_0067276
354 Ga0466967_0090389
355 Ga0466967_0105351
356 Ga0495629_0102406
357 Ga0495606_0000578
358 Ga0495668_0000293
359 Ga0495668_0000340
360 Ga0495625_0003796
361 Ga0495635_0123229
362 Ga0495658_0208721
363 Ga0495683_0017096
364 Ga0495626_0000046
365 Ga0496100_0002680
366 Ga0496102_0133621
367 Ga0496104_0011748
368 Ga0496104_0039881
369 Ga0496104_0108874
370 Ga0496105_0013333
371 Ga0496105_0122819
372 Ga0496110_0015562
373 Ga0496114_0070863
374 Ga0496114_0076088
375 Ga0496114_0101686
376 Ga0496114_0351601
377 Ga0496119_0004059
378 Ga0496120_0003308
379 Ga0496120_0042418
380 Ga0496121_0009757
381 Ga0496122_0022359
382 Ga0496123_0009759
383 Ga0496124_0009325
384 Ga0496126_0011660
385 Ga0501032_0076765
386 Ga0501037_0037921
387 Ga0501040_0070030
388 Ga0501041_0089418
389 Ga0501047_0000066
390 Ga0501070_0004717
391 Ga0501075_0257821
392 Ga0501079_0001168
393 Ga0501080_0000232
394 Ga0501080_0031991
395 Ga0501045_0068296
396 nmdc:mga00v17_100092_c1
397 nmdc:mga00v17_37938_c1
398 nmdc:mga05p37_2286_c1
399 nmdc:mga0qj67_132599_c1
400 nmdc:mga0qj67_8043_c1
401 nmdc:mga08y16_21700_c1
402 Ga0500635_0003523
403 Ga0495619_0108389
404 Ga0500583_0002791
405 Ga0500641_0012964
406 Ga0500650_0019261
407 Ga0500652_001294
408 Ga0501084_0126670
409 Ga0501082_0258183
410 Ga0466962_0053187
411 Ga0530510_0010350
412 Ga0530510_0306926
413 2583152696
414 2643761921
415 2644460652
416 2731908714
417 2753267644
418 2832008138
419 2839988004
420 2855673998
421 2855679587
422 2857289580
423 2858850593
424 2858888127
425 2858891046
426 2858897579
427 2861521896
428 2862183323
429 2866067892
430 2867319431
431 2867325402
432 2867510825
433 2869050910
434 2869067180
435 2869075121
436 2880495157
437 2880497192
438 2887447019
439 2887479622
440 2904775858
441 2908812637
442 2922557522
443 2929231251
444 8003833596
445 8003877744
446 8054706776
447 8054733612
448 8054740811
449 8055415921
450 8056059019

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

172

245

0.92

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

43

135

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pts-assembly1.cif.gz_A crystal structure of a glutathione transferase from gordonia bronchialis dsm 43247, target efi-507405 0.9934 20 328
3m1g-assembly2.cif.gz_C the structure of a putative glutathione s-transferase from corynebacterium glutamicum 0.9684 34 327
3m1g-assembly1.cif.gz_A the structure of a putative glutathione s-transferase from corynebacterium glutamicum 0.9629 34 327
4pts-assembly1.cif.gz_A crystal structure of a glutathione transferase from gordonia bronchialis dsm 43247, target efi-507405 0.9504 20 328
3r3e-assembly1.cif.gz_A the glutathione bound structure of yqjg, a glutathione transferase homolog from escherichia coli k-12 0.9438 26 310
ID Description Score Start End Superfamily
4ptsA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9962 20 149 3.40.30.10
4ptsB02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9895 165 328 1.20.1050.10
4ptsA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9886 20 149 3.40.30.10
3m1gC02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9871 166 313 1.20.1050.10
3r3eB02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9867 155 264 1.20.1050.10
ID Description Score Start End GO Terms
AF-A0A7W9GTJ0-F1-model_v4 Glutathionyl-hydroquinone reductase 1.002 116 268 GO:0004364
GO:0005737
AF-A0A6G3WTI3-F1-model_v4 Glutathione S-transferase family protein 0.9978 78 270 GO:0004364
GO:0005737
AF-A0A7I7MJU9-F1-model_v4 GST C-terminal domain-containing protein 0.9971 95 235 GO:0004364
GO:0005737
AF-A0A6I5CA15-F1-model_v4 Glutathione S-transferase family protein 0.9969 22 314 GO:0004364
GO:0005737
AF-A0A1H8Y5R1-F1-model_v4 Putative glutathione S-transferase 0.9966 12 327 GO:0004364
GO:0005737

Map