F337902
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 225 | 173 | 450 | 339 |
Family's Representative Sequence
| Representative Sequence | 3300027665|Ga0209983_1005480|Ga0209983_10054803 |
| Length | 369 |
| Sequence | VRPTIDAASPLLLEVDNLTTYFFTRDGIVRAVDGVSFSVRRGEVLAIVGESGCGKSVTSLSIMRLIASPPGKTVEGRVLFEGRDLLQLSEAEMRNIRGDAISMIFQEPMTSLNPVLTIGRQIAEALVLHRGTSRDEAARRTVELLRLVRMPEAERRASQYPHELSGGMRQRVMIAMALACEPRLLIADEPTTALDVTIQAQILDLMRELQQRTGAAIVLITHDLGVVAEMAERVVVMYAGRKVEEASVGDLFAHPRHPYTRGLLDSIPKLGAGGHGDGGRVRLAEIAGTVPSLSEPIVGCAFAPRCAFATPRCRDEFPPLEEKAPAHFAACWESARVTAGSVAASTQSPDPRGAAEWPDANAGDARAAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 3 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 17 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 18 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 19 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 20 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 21 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 24 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 25 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 26 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 27 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 28 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 38 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 39 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 40 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 41 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 42 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 62 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 63 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 64 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 65 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 66 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 67 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 68 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 69 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 70 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 71 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 72 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 73 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 74 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 75 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 76 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 77 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 78 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 79 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 80 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 81 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 82 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 83 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 84 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 85 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 86 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 87 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 88 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 89 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 90 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 91 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 123 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 124 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 125 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 126 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 127 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 128 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 129 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 130 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 131 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 132 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 133 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 134 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 135 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 136 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 137 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 138 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 139 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 140 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 141 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 142 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 143 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 144 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 145 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 146 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 147 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 148 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 149 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 150 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 151 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 152 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 153 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 154 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 155 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 156 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 159 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 160 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 161 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 162 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 163 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 164 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 165 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 166 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 167 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 168 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 169 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 170 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 171 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 172 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 173 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96 |
| Metatranscriptomes | 0 |
| Isolates | 4 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.89 |
| Nodule | 2.67 |
| Rhizoplane | 13.78 |
| Rhizosphere | 71.56 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0209983_1005480 | 3300027665 | Bacteria | 2627 |
| 2 | JGI25151J46595_10000185 | 3300003187 | Bacteria | 77945 |
| 3 | Ga0070670_100197682 | 3300005331 | Bacteria | 1747 |
| 4 | Ga0070661_100006560 | 3300005344 | Bacteria | 8024 |
| 5 | Ga0070668_100217351 | 3300005347 | Bacteria | 1575 |
| 6 | Ga0070659_100066358 | 3300005366 | Bacteria | 2859 |
| 7 | Ga0070667_100334305 | 3300005367 | Bacteria | 1369 |
| 8 | Ga0070711_100307905 | 3300005439 | Bacteria | 1262 |
| 9 | Ga0070678_100259856 | 3300005456 | Bacteria | 1460 |
| 10 | Ga0070681_10143397 | 3300005458 | Bacteria | 2318 |
| 11 | Ga0070679_100012768 | 3300005530 | Bacteria | 8036 |
| 12 | Ga0070684_100009745 | 3300005535 | Bacteria | 7582 |
| 13 | Ga0070695_100002077 | 3300005545 | Bacteria | 11454 |
| 14 | Ga0070665_100050227 | 3300005548 | Bacteria | 4185 |
| 15 | Ga0070664_100008020 | 3300005564 | Bacteria | 8529 |
| 16 | Ga0068854_100034602 | 3300005578 | Bacteria | 3530 |
| 17 | Ga0068856_100046700 | 3300005614 | Bacteria | 4265 |
| 18 | Ga0068852_100027876 | 3300005616 | Bacteria | 4611 |
| 19 | Ga0068859_100111645 | 3300005617 | Bacteria | 2797 |
| 20 | Ga0081539_10019537 | 3300005985 | Bacteria | 4631 |
| 21 | Ga0070717_10213324 | 3300006028 | Bacteria | 1695 |
| 22 | Ga0070712_100000365 | 3300006175 | Bacteria | 25666 |
| 23 | Ga0075430_100037233 | 3300006846 | Bacteria | 4124 |
| 24 | Ga0075431_100032475 | 3300006847 | Bacteria | 5379 |
| 25 | Ga0075434_100005225 | 3300006871 | Bacteria | 11794 |
| 26 | Ga0075434_100013013 | 3300006871 | Bacteria | 7901 |
| 27 | Ga0075434_100068322 | 3300006871 | Bacteria | 3540 |
| 28 | Ga0097620_100111638 | 3300006931 | Bacteria | 2797 |
| 29 | Ga0075435_100015977 | 3300007076 | Bacteria | 5652 |
| 30 | Ga0075435_100223569 | 3300007076 | Bacteria | 1599 |
| 31 | Ga0105240_10012571 | 3300009093 | Bacteria | 11678 |
| 32 | Ga0114129_10087093 | 3300009147 | Bacteria | 4332 |
| 33 | Ga0105241_10027981 | 3300009174 | Bacteria | 4198 |
| 34 | Ga0105237_10010755 | 3300009545 | Bacteria | 9711 |
| 35 | Ga0105237_10042629 | 3300009545 | Bacteria | 4575 |
| 36 | Ga0105238_10377491 | 3300009551 | Bacteria | 1409 |
| 37 | Ga0105239_10489251 | 3300010375 | Bacteria | 1398 |
| 38 | Ga0157373_10024995 | 3300013100 | Bacteria | 4324 |
| 39 | Ga0157370_10021344 | 3300013104 | Bacteria | 6452 |
| 40 | Ga0157369_10059669 | 3300013105 | Bacteria | 4114 |
| 41 | Ga0213872_10000953 | 3300021361 | Bacteria | 20225 |
| 42 | Ga0213872_10024565 | 3300021361 | Bacteria | 2773 |
| 43 | Ga0213874_10001408 | 3300021377 | Bacteria | 4972 |
| 44 | Ga0213874_10007621 | 3300021377 | Bacteria | 2607 |
| 45 | Ga0213876_10001884 | 3300021384 | Bacteria | 12610 |
| 46 | Ga0209025_1000064 | 3300025294 | Bacteria | 301309 |
| 47 | Ga0207426_1010874 | 3300025302 | Bacteria | 3503 |
| 48 | Ga0207426_1031009 | 3300025302 | Bacteria | 1748 |
| 49 | Ga0207688_10077877 | 3300025901 | Bacteria | 1889 |
| 50 | Ga0207707_10025710 | 3300025912 | Bacteria | 5150 |
| 51 | Ga0207695_10126576 | 3300025913 | Bacteria | 2516 |
| 52 | Ga0207671_10085311 | 3300025914 | Bacteria | 2372 |
| 53 | Ga0207693_10000413 | 3300025915 | Bacteria | 38842 |
| 54 | Ga0207663_10195366 | 3300025916 | Bacteria | 1456 |
| 55 | Ga0207657_10000466 | 3300025919 | Bacteria | 42880 |
| 56 | Ga0207694_10052137 | 3300025924 | Bacteria | 3172 |
| 57 | Ga0207664_10095592 | 3300025929 | Bacteria | 2444 |
| 58 | Ga0207691_10038416 | 3300025940 | Bacteria | 4430 |
| 59 | Ga0207667_10006898 | 3300025949 | Bacteria | 13719 |
| 60 | Ga0207639_10007259 | 3300026041 | Bacteria | 7552 |
| 61 | Ga0207702_10052213 | 3300026078 | Bacteria | 3458 |
| 62 | Ga0207674_10001129 | 3300026116 | Bacteria | 34633 |
| 63 | Ga0207683_10054469 | 3300026121 | Bacteria | 3508 |
| 64 | Ga0207698_10227893 | 3300026142 | Bacteria | 1689 |
| 65 | Ga0209971_1001026 | 3300027682 | Bacteria | 7115 |
| 66 | Ga0268266_10442203 | 3300028379 | Bacteria | 1235 |
| 67 | Ga0268264_10342953 | 3300028381 | Bacteria | 1420 |
| 68 | Ga0265332_10093188 | 3300031238 | Bacteria | 1273 |
| 69 | Ga0373934_0045013 | 3300035086 | Bacteria | 1745 |
| 70 | Ga0373944_0003279 | 3300035089 | Bacteria | 4165 |
| 71 | Ga0373923_0001063 | 3300035111 | Bacteria | 7521 |
| 72 | Ga0373936_0003137 | 3300035113 | Bacteria | 6188 |
| 73 | Ga0373945_0027626 | 3300035116 | Bacteria | 1983 |
| 74 | Ga0373945_0032208 | 3300035116 | Bacteria | 1857 |
| 75 | Ga0373954_0010843 | 3300035118 | Bacteria | 4029 |
| 76 | Ga0373943_0030410 | 3300035170 | Bacteria | 2555 |
| 77 | Ga0373946_0007032 | 3300035171 | Bacteria | 4103 |
| 78 | Ga0373955_0012847 | 3300035172 | Bacteria | 4036 |
| 79 | Ga0373924_0021761 | 3300035410 | Bacteria | 2502 |
| 80 | Ga0373931_0074605 | 3300035691 | Bacteria | 1858 |
| 81 | Ga0373935_0049499 | 3300035692 | Bacteria | 2663 |
| 82 | Ga0373927_0226722 | 3300035695 | Bacteria | 1227 |
| 83 | Ga0373947_0030856 | 3300035725 | Bacteria | 3151 |
| 84 | Ga0373947_0117082 | 3300035725 | Bacteria | 1690 |
| 85 | Ga0373937_0166473 | 3300036401 | Bacteria | 2067 |
| 86 | Ga0373937_0276411 | 3300036401 | Bacteria | 1586 |
| 87 | Ga0373925_0005527 | 3300037068 | Bacteria | 9408 |
| 88 | Ga0373925_0037021 | 3300037068 | Bacteria | 3600 |
| 89 | Ga0395900_0022448 | 3300037418 | Bacteria | 6454 |
| 90 | Ga0395898_0005925 | 3300037466 | Bacteria | 13130 |
| 91 | Ga0436364_0651677 | 3300037853 | Bacteria | 2431 |
| 92 | Ga0395901_0029957 | 3300038443 | Bacteria | 5605 |
| 93 | Ga0436365_0705937 | 3300039437 | Bacteria | 2207 |
| 94 | Ga0436365_1716323 | 3300039437 | Bacteria | 15523 |
| 95 | Ga0436360_0340755 | 3300039438 | Bacteria | 2140 |
| 96 | Ga0436361_0062896 | 3300039447 | Bacteria | 26723 |
| 97 | Ga0436361_0066755 | 3300039447 | Bacteria | 4357 |
| 98 | Ga0436361_0802206 | 3300039447 | Bacteria | 2619 |
| 99 | Ga0436361_0930588 | 3300039447 | Bacteria | 8741 |
| 100 | Ga0436363_0162311 | 3300039450 | Bacteria | 14500 |
| 101 | Ga0436363_1301554 | 3300039450 | Bacteria | 1478 |
| 102 | Ga0436362_0791278 | 3300039453 | Bacteria | 1600 |
| 103 | Ga0466963_0023104 | 3300044694 | Bacteria | 3943 |
| 104 | Ga0466963_0315023 | 3300044694 | Bacteria | 1101 |
| 105 | Ga0466964_0006326 | 3300044706 | Bacteria | 4410 |
| 106 | Ga0466964_0044377 | 3300044706 | Bacteria | 1806 |
| 107 | Ga0451576_0003568 | 3300045051 | Bacteria | 21176 |
| 108 | Ga0451576_0048679 | 3300045051 | Bacteria | 4451 |
| 109 | Ga0466967_0003646 | 3300045976 | Bacteria | 10125 |
| 110 | Ga0466967_0017502 | 3300045976 | Bacteria | 5693 |
| 111 | Ga0466967_0134152 | 3300045976 | Bacteria | 2301 |
| 112 | Ga0466967_0350871 | 3300045976 | Bacteria | 1428 |
| 113 | Ga0495627_000482 | 3300046453 | Bacteria | 33698 |
| 114 | Ga0495650_0000954 | 3300046471 | Bacteria | 33429 |
| 115 | Ga0495582_0009966 | 3300046473 | Bacteria | 5232 |
| 116 | Ga0495582_0093786 | 3300046473 | Bacteria | 1675 |
| 117 | Ga0495639_0008281 | 3300046475 | Bacteria | 4463 |
| 118 | Ga0495639_0027933 | 3300046475 | Bacteria | 2499 |
| 119 | Ga0495662_0005636 | 3300046476 | Bacteria | 6264 |
| 120 | Ga0495664_0006486 | 3300046477 | Bacteria | 6465 |
| 121 | Ga0495664_0154961 | 3300046477 | Bacteria | 1390 |
| 122 | Ga0495594_0021889 | 3300046499 | Bacteria | 3415 |
| 123 | Ga0495618_0028662 | 3300046514 | Bacteria | 3471 |
| 124 | Ga0495620_0003516 | 3300046515 | Bacteria | 8955 |
| 125 | Ga0495628_0320285 | 3300046516 | Bacteria | 1144 |
| 126 | Ga0495630_0052695 | 3300046517 | Bacteria | 3046 |
| 127 | Ga0495630_0074049 | 3300046517 | Bacteria | 2564 |
| 128 | Ga0495632_0000332 | 3300046519 | Bacteria | 44934 |
| 129 | Ga0495666_0080591 | 3300046526 | Bacteria | 1540 |
| 130 | Ga0495652_0027432 | 3300046529 | Bacteria | 5018 |
| 131 | Ga0495665_0019590 | 3300046531 | Bacteria | 3639 |
| 132 | Ga0495640_0076020 | 3300046533 | Bacteria | 2241 |
| 133 | Ga0495586_0025199 | 3300046535 | Bacteria | 3182 |
| 134 | Ga0495667_0118715 | 3300046559 | Bacteria | 1708 |
| 135 | Ga0495634_0024702 | 3300046642 | Bacteria | 4212 |
| 136 | Ga0495635_0061264 | 3300046663 | Bacteria | 2585 |
| 137 | Ga0495599_0121290 | 3300046678 | Bacteria | 1625 |
| 138 | Ga0495647_0030798 | 3300046681 | Bacteria | 1992 |
| 139 | Ga0495658_0010395 | 3300046683 | Bacteria | 4656 |
| 140 | Ga0495624_0016477 | 3300046690 | Bacteria | 4974 |
| 141 | Ga0495581_0013096 | 3300047315 | Bacteria | 4808 |
| 142 | Ga0495604_0197494 | 3300047317 | Bacteria | 1398 |
| 143 | Ga0495674_0040416 | 3300047319 | Bacteria | 4171 |
| 144 | Ga0495681_0000045 | 3300047470 | Bacteria | 111769 |
| 145 | Ga0495684_0024149 | 3300047471 | Bacteria | 4678 |
| 146 | Ga0495602_0081577 | 3300048088 | Bacteria | 2719 |
| 147 | Ga0495614_0027338 | 3300048089 | Bacteria | 2460 |
| 148 | Ga0496100_0005746 | 3300048903 | Bacteria | 6712 |
| 149 | Ga0496100_0056423 | 3300048903 | Bacteria | 2570 |
| 150 | Ga0496101_0004184 | 3300048904 | Bacteria | 9042 |
| 151 | Ga0496102_0009577 | 3300048905 | Bacteria | 8330 |
| 152 | Ga0496102_0058247 | 3300048905 | Bacteria | 3529 |
| 153 | Ga0496102_0285767 | 3300048905 | Bacteria | 1555 |
| 154 | Ga0496103_0064354 | 3300048906 | Bacteria | 2286 |
| 155 | Ga0496104_0004397 | 3300048907 | Bacteria | 12274 |
| 156 | Ga0496104_0009428 | 3300048907 | Bacteria | 8682 |
| 157 | Ga0496105_0054597 | 3300048908 | Bacteria | 3298 |
| 158 | Ga0496105_0167560 | 3300048908 | Bacteria | 1802 |
| 159 | Ga0496106_0001630 | 3300048909 | Bacteria | 16852 |
| 160 | Ga0496106_0003424 | 3300048909 | Bacteria | 11819 |
| 161 | Ga0496107_0000229 | 3300048910 | Bacteria | 29677 |
| 162 | Ga0496107_0017443 | 3300048910 | Bacteria | 5050 |
| 163 | Ga0496107_0266996 | 3300048910 | Bacteria | 1274 |
| 164 | Ga0496108_0000419 | 3300048911 | Bacteria | 34761 |
| 165 | Ga0496108_0021727 | 3300048911 | Bacteria | 5276 |
| 166 | Ga0496109_0000901 | 3300048912 | Bacteria | 24745 |
| 167 | Ga0496109_0013509 | 3300048912 | Bacteria | 7085 |
| 168 | Ga0496109_0112447 | 3300048912 | Bacteria | 2532 |
| 169 | Ga0496110_0004800 | 3300048913 | Bacteria | 10528 |
| 170 | Ga0496110_0180016 | 3300048913 | Bacteria | 1920 |
| 171 | Ga0496111_0025732 | 3300048914 | Bacteria | 4152 |
| 172 | Ga0496111_0034158 | 3300048914 | Bacteria | 3630 |
| 173 | Ga0496112_0001990 | 3300048915 | Bacteria | 16161 |
| 174 | Ga0496112_0075021 | 3300048915 | Bacteria | 3344 |
| 175 | Ga0496113_0006766 | 3300048916 | Bacteria | 7309 |
| 176 | Ga0496113_0038483 | 3300048916 | Bacteria | 3517 |
| 177 | Ga0496114_0041495 | 3300048917 | Bacteria | 3814 |
| 178 | Ga0496115_0207563 | 3300048918 | Bacteria | 1618 |
| 179 | Ga0496119_0046282 | 3300048922 | Bacteria | 2718 |
| 180 | Ga0496121_0014173 | 3300048924 | Bacteria | 8489 |
| 181 | Ga0496121_0073010 | 3300048924 | Bacteria | 2752 |
| 182 | Ga0496125_0020839 | 3300048928 | Bacteria | 6137 |
| 183 | Ga0496126_0055159 | 3300048929 | Bacteria | 3597 |
| 184 | Ga0501031_0148702 | 3300049568 | Bacteria | 1530 |
| 185 | Ga0501032_0014407 | 3300049569 | Bacteria | 5601 |
| 186 | Ga0501033_0050573 | 3300049570 | Bacteria | 3082 |
| 187 | Ga0501034_0001206 | 3300049571 | Bacteria | 35489 |
| 188 | Ga0501037_0096816 | 3300049573 | Bacteria | 2132 |
| 189 | Ga0501039_0011594 | 3300049575 | Bacteria | 6712 |
| 190 | Ga0501035_0011601 | 3300049822 | Bacteria | 8169 |
| 191 | nmdc:mga05p37_33365_c1 | 3300050507 | Bacteria | 6305 |
| 192 | nmdc:mga09592_360556_c1 | 3300050508 | Bacteria | 1258 |
| 193 | nmdc:mga09592_60401_c1 | 3300050508 | Bacteria | 3205 |
| 194 | nmdc:mga0qj67_110098_c1 | 3300050509 | Bacteria | 2223 |
| 195 | nmdc:mga0qj67_11115_c1 | 3300050509 | Bacteria | 6743 |
| 196 | nmdc:mga0qj67_29469_c1 | 3300050509 | Bacteria | 4264 |
| 197 | nmdc:mga0qj67_63878_c1 | 3300050509 | Bacteria | 2927 |
| 198 | nmdc:mga06r32_35095_c1 | 3300050510 | Bacteria | 4732 |
| 199 | nmdc:mga0n895_20973_c1 | 3300050512 | Bacteria | 6103 |
| 200 | nmdc:mga0n895_3382_c1 | 3300050512 | Bacteria | 12834 |
| 201 | nmdc:mga0n895_71751_c1 | 3300050512 | Bacteria | 3434 |
| 202 | nmdc:mga0rr50_203375_c1 | 3300050513 | Bacteria | 1628 |
| 203 | nmdc:mga0rr50_349125_c1 | 3300050513 | Bacteria | 1244 |
| 204 | nmdc:mga0a205_302097_c1 | 3300050515 | Bacteria | 1473 |
| 205 | Ga0495601_0043487 | 3300053077 | Bacteria | 2821 |
| 206 | Ga0495601_0117130 | 3300053077 | Bacteria | 1728 |
| 207 | Ga0495601_0134168 | 3300053077 | Bacteria | 1613 |
| 208 | Ga0495619_0025569 | 3300053085 | Bacteria | 3793 |
| 209 | Ga0495619_0074756 | 3300053085 | Bacteria | 2273 |
| 210 | Ga0500643_000500 | 3300053087 | Bacteria | 28162 |
| 211 | Ga0500651_0089262 | 3300053093 | Bacteria | 1900 |
| 212 | Ga0500566_0087776 | 3300053094 | Bacteria | 1722 |
| 213 | Ga0500642_0000023 | 3300053130 | Bacteria | 135152 |
| 214 | Ga0500559_0000149 | 3300053136 | Bacteria | 55058 |
| 215 | Ga0500634_0000040 | 3300053161 | Bacteria | 59608 |
| 216 | Ga0500637_0148899 | 3300053178 | Bacteria | 1353 |
| 217 | 2644169621 | 2643221629 | Bacteria | 5850260 |
| 218 | 2644350257 | 2643221662 | Bacteria | 5851492 |
| 219 | 2739305864 | 2738543024 | Bacteria | 5603683 |
| 220 | 2855734857 | 2855730933 | Bacteria | 7047938 |
| 221 | 2855770641 | 2855767633 | Bacteria | 7049357 |
| 222 | 2935634800 | 2935630451 | Bacteria | 8169952 |
| 223 | 2941511870 | 2941507105 | Bacteria | 8166816 |
| 224 | 2941519572 | 2941515067 | Bacteria | 8166720 |
| 225 | 2941527736 | 2941523033 | Bacteria | 8169134 |
| 226 | Ga0209983_1005480 | |||
| 227 | JGI25151J46595_10000185 | |||
| 228 | Ga0070670_100197682 | |||
| 229 | Ga0070661_100006560 | |||
| 230 | Ga0070668_100217351 | |||
| 231 | Ga0070659_100066358 | |||
| 232 | Ga0070667_100334305 | |||
| 233 | Ga0070711_100307905 | |||
| 234 | Ga0070678_100259856 | |||
| 235 | Ga0070681_10143397 | |||
| 236 | Ga0070679_100012768 | |||
| 237 | Ga0070684_100009745 | |||
| 238 | Ga0070695_100002077 | |||
| 239 | Ga0070665_100050227 | |||
| 240 | Ga0070664_100008020 | |||
| 241 | Ga0068854_100034602 | |||
| 242 | Ga0068856_100046700 | |||
| 243 | Ga0068852_100027876 | |||
| 244 | Ga0068859_100111645 | |||
| 245 | Ga0081539_10019537 | |||
| 246 | Ga0070717_10213324 | |||
| 247 | Ga0070712_100000365 | |||
| 248 | Ga0075430_100037233 | |||
| 249 | Ga0075431_100032475 | |||
| 250 | Ga0075434_100005225 | |||
| 251 | Ga0075434_100013013 | |||
| 252 | Ga0075434_100068322 | |||
| 253 | Ga0097620_100111638 | |||
| 254 | Ga0075435_100015977 | |||
| 255 | Ga0075435_100223569 | |||
| 256 | Ga0105240_10012571 | |||
| 257 | Ga0114129_10087093 | |||
| 258 | Ga0105241_10027981 | |||
| 259 | Ga0105237_10010755 | |||
| 260 | Ga0105237_10042629 | |||
| 261 | Ga0105238_10377491 | |||
| 262 | Ga0105239_10489251 | |||
| 263 | Ga0157373_10024995 | |||
| 264 | Ga0157370_10021344 | |||
| 265 | Ga0157369_10059669 | |||
| 266 | Ga0213872_10000953 | |||
| 267 | Ga0213872_10024565 | |||
| 268 | Ga0213874_10001408 | |||
| 269 | Ga0213874_10007621 | |||
| 270 | Ga0213876_10001884 | |||
| 271 | Ga0209025_1000064 | |||
| 272 | Ga0207426_1010874 | |||
| 273 | Ga0207426_1031009 | |||
| 274 | Ga0207688_10077877 | |||
| 275 | Ga0207707_10025710 | |||
| 276 | Ga0207695_10126576 | |||
| 277 | Ga0207671_10085311 | |||
| 278 | Ga0207693_10000413 | |||
| 279 | Ga0207663_10195366 | |||
| 280 | Ga0207657_10000466 | |||
| 281 | Ga0207694_10052137 | |||
| 282 | Ga0207664_10095592 | |||
| 283 | Ga0207691_10038416 | |||
| 284 | Ga0207667_10006898 | |||
| 285 | Ga0207639_10007259 | |||
| 286 | Ga0207702_10052213 | |||
| 287 | Ga0207674_10001129 | |||
| 288 | Ga0207683_10054469 | |||
| 289 | Ga0207698_10227893 | |||
| 290 | Ga0209971_1001026 | |||
| 291 | Ga0268266_10442203 | |||
| 292 | Ga0268264_10342953 | |||
| 293 | Ga0265332_10093188 | |||
| 294 | Ga0373934_0045013 | |||
| 295 | Ga0373944_0003279 | |||
| 296 | Ga0373923_0001063 | |||
| 297 | Ga0373936_0003137 | |||
| 298 | Ga0373945_0027626 | |||
| 299 | Ga0373945_0032208 | |||
| 300 | Ga0373954_0010843 | |||
| 301 | Ga0373943_0030410 | |||
| 302 | Ga0373946_0007032 | |||
| 303 | Ga0373955_0012847 | |||
| 304 | Ga0373924_0021761 | |||
| 305 | Ga0373931_0074605 | |||
| 306 | Ga0373935_0049499 | |||
| 307 | Ga0373927_0226722 | |||
| 308 | Ga0373947_0030856 | |||
| 309 | Ga0373947_0117082 | |||
| 310 | Ga0373937_0166473 | |||
| 311 | Ga0373937_0276411 | |||
| 312 | Ga0373925_0005527 | |||
| 313 | Ga0373925_0037021 | |||
| 314 | Ga0395900_0022448 | |||
| 315 | Ga0395898_0005925 | |||
| 316 | Ga0436364_0651677 | |||
| 317 | Ga0395901_0029957 | |||
| 318 | Ga0436365_0705937 | |||
| 319 | Ga0436365_1716323 | |||
| 320 | Ga0436360_0340755 | |||
| 321 | Ga0436361_0062896 | |||
| 322 | Ga0436361_0066755 | |||
| 323 | Ga0436361_0802206 | |||
| 324 | Ga0436361_0930588 | |||
| 325 | Ga0436363_0162311 | |||
| 326 | Ga0436363_1301554 | |||
| 327 | Ga0436362_0791278 | |||
| 328 | Ga0466963_0023104 | |||
| 329 | Ga0466963_0315023 | |||
| 330 | Ga0466964_0006326 | |||
| 331 | Ga0466964_0044377 | |||
| 332 | Ga0451576_0003568 | |||
| 333 | Ga0451576_0048679 | |||
| 334 | Ga0466967_0003646 | |||
| 335 | Ga0466967_0017502 | |||
| 336 | Ga0466967_0134152 | |||
| 337 | Ga0466967_0350871 | |||
| 338 | Ga0495627_000482 | |||
| 339 | Ga0495650_0000954 | |||
| 340 | Ga0495582_0009966 | |||
| 341 | Ga0495582_0093786 | |||
| 342 | Ga0495639_0008281 | |||
| 343 | Ga0495639_0027933 | |||
| 344 | Ga0495662_0005636 | |||
| 345 | Ga0495664_0006486 | |||
| 346 | Ga0495664_0154961 | |||
| 347 | Ga0495594_0021889 | |||
| 348 | Ga0495618_0028662 | |||
| 349 | Ga0495620_0003516 | |||
| 350 | Ga0495628_0320285 | |||
| 351 | Ga0495630_0052695 | |||
| 352 | Ga0495630_0074049 | |||
| 353 | Ga0495632_0000332 | |||
| 354 | Ga0495666_0080591 | |||
| 355 | Ga0495652_0027432 | |||
| 356 | Ga0495665_0019590 | |||
| 357 | Ga0495640_0076020 | |||
| 358 | Ga0495586_0025199 | |||
| 359 | Ga0495667_0118715 | |||
| 360 | Ga0495634_0024702 | |||
| 361 | Ga0495635_0061264 | |||
| 362 | Ga0495599_0121290 | |||
| 363 | Ga0495647_0030798 | |||
| 364 | Ga0495658_0010395 | |||
| 365 | Ga0495624_0016477 | |||
| 366 | Ga0495581_0013096 | |||
| 367 | Ga0495604_0197494 | |||
| 368 | Ga0495674_0040416 | |||
| 369 | Ga0495681_0000045 | |||
| 370 | Ga0495684_0024149 | |||
| 371 | Ga0495602_0081577 | |||
| 372 | Ga0495614_0027338 | |||
| 373 | Ga0496100_0005746 | |||
| 374 | Ga0496100_0056423 | |||
| 375 | Ga0496101_0004184 | |||
| 376 | Ga0496102_0009577 | |||
| 377 | Ga0496102_0058247 | |||
| 378 | Ga0496102_0285767 | |||
| 379 | Ga0496103_0064354 | |||
| 380 | Ga0496104_0004397 | |||
| 381 | Ga0496104_0009428 | |||
| 382 | Ga0496105_0054597 | |||
| 383 | Ga0496105_0167560 | |||
| 384 | Ga0496106_0001630 | |||
| 385 | Ga0496106_0003424 | |||
| 386 | Ga0496107_0000229 | |||
| 387 | Ga0496107_0017443 | |||
| 388 | Ga0496107_0266996 | |||
| 389 | Ga0496108_0000419 | |||
| 390 | Ga0496108_0021727 | |||
| 391 | Ga0496109_0000901 | |||
| 392 | Ga0496109_0013509 | |||
| 393 | Ga0496109_0112447 | |||
| 394 | Ga0496110_0004800 | |||
| 395 | Ga0496110_0180016 | |||
| 396 | Ga0496111_0025732 | |||
| 397 | Ga0496111_0034158 | |||
| 398 | Ga0496112_0001990 | |||
| 399 | Ga0496112_0075021 | |||
| 400 | Ga0496113_0006766 | |||
| 401 | Ga0496113_0038483 | |||
| 402 | Ga0496114_0041495 | |||
| 403 | Ga0496115_0207563 | |||
| 404 | Ga0496119_0046282 | |||
| 405 | Ga0496121_0014173 | |||
| 406 | Ga0496121_0073010 | |||
| 407 | Ga0496125_0020839 | |||
| 408 | Ga0496126_0055159 | |||
| 409 | Ga0501031_0148702 | |||
| 410 | Ga0501032_0014407 | |||
| 411 | Ga0501033_0050573 | |||
| 412 | Ga0501034_0001206 | |||
| 413 | Ga0501037_0096816 | |||
| 414 | Ga0501039_0011594 | |||
| 415 | Ga0501035_0011601 | |||
| 416 | nmdc:mga05p37_33365_c1 | |||
| 417 | nmdc:mga09592_360556_c1 | |||
| 418 | nmdc:mga09592_60401_c1 | |||
| 419 | nmdc:mga0qj67_110098_c1 | |||
| 420 | nmdc:mga0qj67_11115_c1 | |||
| 421 | nmdc:mga0qj67_29469_c1 | |||
| 422 | nmdc:mga0qj67_63878_c1 | |||
| 423 | nmdc:mga06r32_35095_c1 | |||
| 424 | nmdc:mga0n895_20973_c1 | |||
| 425 | nmdc:mga0n895_3382_c1 | |||
| 426 | nmdc:mga0n895_71751_c1 | |||
| 427 | nmdc:mga0rr50_203375_c1 | |||
| 428 | nmdc:mga0rr50_349125_c1 | |||
| 429 | nmdc:mga0a205_302097_c1 | |||
| 430 | Ga0495601_0043487 | |||
| 431 | Ga0495601_0117130 | |||
| 432 | Ga0495601_0134168 | |||
| 433 | Ga0495619_0025569 | |||
| 434 | Ga0495619_0074756 | |||
| 435 | Ga0500643_000500 | |||
| 436 | Ga0500651_0089262 | |||
| 437 | Ga0500566_0087776 | |||
| 438 | Ga0500642_0000023 | |||
| 439 | Ga0500559_0000149 | |||
| 440 | Ga0500634_0000040 | |||
| 441 | Ga0500637_0148899 | |||
| 442 | 2644169621 | |||
| 443 | 2644350257 | |||
| 444 | 2739305864 | |||
| 445 | 2855734857 | |||
| 446 | 2855770641 | |||
| 447 | 2935634800 | |||
| 448 | 2941511870 | |||
| 449 | 2941519572 | |||
| 450 | 2941527736 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4fwi-assembly1.cif.gz_B | crystal structure of the nucleotide-binding domain of a dipeptide abc transporter | 0.9468 | 9 | 327 |
| 5xu1-assembly1.cif.gz_B | structure of a non-canonical abc transporter from streptococcus pneumoniae r6 | 0.9466 | 9 | 246 |
| 1f3o-assembly1.cif.gz_A-2 | crystal structure of mj0796 atp-binding cassette | 0.9441 | 11 | 246 |
| 7w7a-assembly2.cif.gz_E | heme exporter in complex with mn-containing protoporphyrin ix, mn-anomalous data | 0.9412 | 11 | 240 |
| 7z17-assembly1.cif.gz_J | e. coli c-p lyase bound to a phnk abc dimer in an open conformation | 0.9408 | 9 | 265 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FZR1_3_327_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9653 | 9 | 331 | 3.40.50.300 |
| af_P77268_3_327_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9647 | 9 | 327 | 3.40.50.300 |
| af_P0AAG0_1_323_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9621 | 9 | 327 | 3.40.50.300 |
| af_P75957_1_229_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9619 | 8 | 241 | 3.40.50.300 |
| af_Q2G1F8_1_274_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.961 | 9 | 277 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537WAU2-F1-model_v4 | ABC transporter ATP-binding protein | 0.9912 | 30 | 268 |
GO:0005524
GO:0005886 GO:0015833 GO:0016887 |
| AF-A0A2S9BS46-F1-model_v4 | Dipeptide/oligopeptide/nickel ABC transporter ATP-binding protein | 0.984 | 23 | 265 |
GO:0005524
GO:0005886 GO:0016887 |
| AF-A0A6G2QKZ1-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.983 | 9 | 264 |
GO:0005524
GO:0016887 |
| AF-A0A562ZJX0-F1-model_v4 | ABC transporter ATP-binding protein | 0.9805 | 8 | 327 |
GO:0005524
GO:0005886 GO:0015833 GO:0016887 |
| AF-A0A545AZY2-F1-model_v4 | ABC transporter ATP-binding protein | 0.9804 | 9 | 264 |
GO:0005524
GO:0016887 |