F337902

General Info

Members Datasets Scaffolds Average Seq Length
225 173 450 339

Family's Representative Sequence

Representative Sequence 3300027665|Ga0209983_1005480|Ga0209983_10054803
Length 369
Sequence VRPTIDAASPLLLEVDNLTTYFFTRDGIVRAVDGVSFSVRRGEVLAIVGESGCGKSVTSLSIMRLIASPPGKTVEGRVLFEGRDLLQLSEAEMRNIRGDAISMIFQEPMTSLNPVLTIGRQIAEALVLHRGTSRDEAARRTVELLRLVRMPEAERRASQYPHELSGGMRQRVMIAMALACEPRLLIADEPTTALDVTIQAQILDLMRELQQRTGAAIVLITHDLGVVAEMAERVVVMYAGRKVEEASVGDLFAHPRHPYTRGLLDSIPKLGAGGHGDGGRVRLAEIAGTVPSLSEPIVGCAFAPRCAFATPRCRDEFPPLEEKAPAHFAACWESARVTAGSVAASTQSPDPRGAAEWPDANAGDARAAR

Samples

Sample ID Description Type Environment
1 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
16 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
23 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
35 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
38 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
39 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
40 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
41 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
42 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
62 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
63 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
64 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
65 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
66 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
67 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
68 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
69 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
70 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
71 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
72 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
73 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
74 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
75 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
76 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
77 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
78 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
79 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
80 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
81 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
82 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
83 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
84 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
85 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
86 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
87 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
88 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
89 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
90 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
91 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
92 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
93 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
94 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
95 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
96 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
97 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
98 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
99 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
100 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
101 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
102 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
103 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
104 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
105 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
106 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
107 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
108 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
109 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
110 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
111 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
112 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
113 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
114 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
115 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
116 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
117 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
118 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
119 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
120 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
121 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
122 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
123 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
124 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
125 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
126 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
127 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
128 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
129 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
133 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
136 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
137 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
138 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
139 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
140 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
141 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
142 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
149 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
150 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
151 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
152 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
153 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
154 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
155 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
156 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
157 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
158 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
159 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
160 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
161 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
162 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
163 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
164 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
165 2643221629 Devosia sp. Root105 Isolate Unclassified
166 2643221662 Devosia sp. Root413D1 Isolate Unclassified
167 2738543024 Aminobacter sp. AP02 Isolate Unclassified
168 2855730933 Achromobacter sp. HZ28 Isolate Nodule
169 2855767633 Achromobacter sp. HZ34 Isolate Nodule
170 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
171 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
172 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
173 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96
Metatranscriptomes 0
Isolates 4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.89
Nodule 2.67
Rhizoplane 13.78
Rhizosphere 71.56
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209983_1005480 3300027665 Bacteria 2627
2 JGI25151J46595_10000185 3300003187 Bacteria 77945
3 Ga0070670_100197682 3300005331 Bacteria 1747
4 Ga0070661_100006560 3300005344 Bacteria 8024
5 Ga0070668_100217351 3300005347 Bacteria 1575
6 Ga0070659_100066358 3300005366 Bacteria 2859
7 Ga0070667_100334305 3300005367 Bacteria 1369
8 Ga0070711_100307905 3300005439 Bacteria 1262
9 Ga0070678_100259856 3300005456 Bacteria 1460
10 Ga0070681_10143397 3300005458 Bacteria 2318
11 Ga0070679_100012768 3300005530 Bacteria 8036
12 Ga0070684_100009745 3300005535 Bacteria 7582
13 Ga0070695_100002077 3300005545 Bacteria 11454
14 Ga0070665_100050227 3300005548 Bacteria 4185
15 Ga0070664_100008020 3300005564 Bacteria 8529
16 Ga0068854_100034602 3300005578 Bacteria 3530
17 Ga0068856_100046700 3300005614 Bacteria 4265
18 Ga0068852_100027876 3300005616 Bacteria 4611
19 Ga0068859_100111645 3300005617 Bacteria 2797
20 Ga0081539_10019537 3300005985 Bacteria 4631
21 Ga0070717_10213324 3300006028 Bacteria 1695
22 Ga0070712_100000365 3300006175 Bacteria 25666
23 Ga0075430_100037233 3300006846 Bacteria 4124
24 Ga0075431_100032475 3300006847 Bacteria 5379
25 Ga0075434_100005225 3300006871 Bacteria 11794
26 Ga0075434_100013013 3300006871 Bacteria 7901
27 Ga0075434_100068322 3300006871 Bacteria 3540
28 Ga0097620_100111638 3300006931 Bacteria 2797
29 Ga0075435_100015977 3300007076 Bacteria 5652
30 Ga0075435_100223569 3300007076 Bacteria 1599
31 Ga0105240_10012571 3300009093 Bacteria 11678
32 Ga0114129_10087093 3300009147 Bacteria 4332
33 Ga0105241_10027981 3300009174 Bacteria 4198
34 Ga0105237_10010755 3300009545 Bacteria 9711
35 Ga0105237_10042629 3300009545 Bacteria 4575
36 Ga0105238_10377491 3300009551 Bacteria 1409
37 Ga0105239_10489251 3300010375 Bacteria 1398
38 Ga0157373_10024995 3300013100 Bacteria 4324
39 Ga0157370_10021344 3300013104 Bacteria 6452
40 Ga0157369_10059669 3300013105 Bacteria 4114
41 Ga0213872_10000953 3300021361 Bacteria 20225
42 Ga0213872_10024565 3300021361 Bacteria 2773
43 Ga0213874_10001408 3300021377 Bacteria 4972
44 Ga0213874_10007621 3300021377 Bacteria 2607
45 Ga0213876_10001884 3300021384 Bacteria 12610
46 Ga0209025_1000064 3300025294 Bacteria 301309
47 Ga0207426_1010874 3300025302 Bacteria 3503
48 Ga0207426_1031009 3300025302 Bacteria 1748
49 Ga0207688_10077877 3300025901 Bacteria 1889
50 Ga0207707_10025710 3300025912 Bacteria 5150
51 Ga0207695_10126576 3300025913 Bacteria 2516
52 Ga0207671_10085311 3300025914 Bacteria 2372
53 Ga0207693_10000413 3300025915 Bacteria 38842
54 Ga0207663_10195366 3300025916 Bacteria 1456
55 Ga0207657_10000466 3300025919 Bacteria 42880
56 Ga0207694_10052137 3300025924 Bacteria 3172
57 Ga0207664_10095592 3300025929 Bacteria 2444
58 Ga0207691_10038416 3300025940 Bacteria 4430
59 Ga0207667_10006898 3300025949 Bacteria 13719
60 Ga0207639_10007259 3300026041 Bacteria 7552
61 Ga0207702_10052213 3300026078 Bacteria 3458
62 Ga0207674_10001129 3300026116 Bacteria 34633
63 Ga0207683_10054469 3300026121 Bacteria 3508
64 Ga0207698_10227893 3300026142 Bacteria 1689
65 Ga0209971_1001026 3300027682 Bacteria 7115
66 Ga0268266_10442203 3300028379 Bacteria 1235
67 Ga0268264_10342953 3300028381 Bacteria 1420
68 Ga0265332_10093188 3300031238 Bacteria 1273
69 Ga0373934_0045013 3300035086 Bacteria 1745
70 Ga0373944_0003279 3300035089 Bacteria 4165
71 Ga0373923_0001063 3300035111 Bacteria 7521
72 Ga0373936_0003137 3300035113 Bacteria 6188
73 Ga0373945_0027626 3300035116 Bacteria 1983
74 Ga0373945_0032208 3300035116 Bacteria 1857
75 Ga0373954_0010843 3300035118 Bacteria 4029
76 Ga0373943_0030410 3300035170 Bacteria 2555
77 Ga0373946_0007032 3300035171 Bacteria 4103
78 Ga0373955_0012847 3300035172 Bacteria 4036
79 Ga0373924_0021761 3300035410 Bacteria 2502
80 Ga0373931_0074605 3300035691 Bacteria 1858
81 Ga0373935_0049499 3300035692 Bacteria 2663
82 Ga0373927_0226722 3300035695 Bacteria 1227
83 Ga0373947_0030856 3300035725 Bacteria 3151
84 Ga0373947_0117082 3300035725 Bacteria 1690
85 Ga0373937_0166473 3300036401 Bacteria 2067
86 Ga0373937_0276411 3300036401 Bacteria 1586
87 Ga0373925_0005527 3300037068 Bacteria 9408
88 Ga0373925_0037021 3300037068 Bacteria 3600
89 Ga0395900_0022448 3300037418 Bacteria 6454
90 Ga0395898_0005925 3300037466 Bacteria 13130
91 Ga0436364_0651677 3300037853 Bacteria 2431
92 Ga0395901_0029957 3300038443 Bacteria 5605
93 Ga0436365_0705937 3300039437 Bacteria 2207
94 Ga0436365_1716323 3300039437 Bacteria 15523
95 Ga0436360_0340755 3300039438 Bacteria 2140
96 Ga0436361_0062896 3300039447 Bacteria 26723
97 Ga0436361_0066755 3300039447 Bacteria 4357
98 Ga0436361_0802206 3300039447 Bacteria 2619
99 Ga0436361_0930588 3300039447 Bacteria 8741
100 Ga0436363_0162311 3300039450 Bacteria 14500
101 Ga0436363_1301554 3300039450 Bacteria 1478
102 Ga0436362_0791278 3300039453 Bacteria 1600
103 Ga0466963_0023104 3300044694 Bacteria 3943
104 Ga0466963_0315023 3300044694 Bacteria 1101
105 Ga0466964_0006326 3300044706 Bacteria 4410
106 Ga0466964_0044377 3300044706 Bacteria 1806
107 Ga0451576_0003568 3300045051 Bacteria 21176
108 Ga0451576_0048679 3300045051 Bacteria 4451
109 Ga0466967_0003646 3300045976 Bacteria 10125
110 Ga0466967_0017502 3300045976 Bacteria 5693
111 Ga0466967_0134152 3300045976 Bacteria 2301
112 Ga0466967_0350871 3300045976 Bacteria 1428
113 Ga0495627_000482 3300046453 Bacteria 33698
114 Ga0495650_0000954 3300046471 Bacteria 33429
115 Ga0495582_0009966 3300046473 Bacteria 5232
116 Ga0495582_0093786 3300046473 Bacteria 1675
117 Ga0495639_0008281 3300046475 Bacteria 4463
118 Ga0495639_0027933 3300046475 Bacteria 2499
119 Ga0495662_0005636 3300046476 Bacteria 6264
120 Ga0495664_0006486 3300046477 Bacteria 6465
121 Ga0495664_0154961 3300046477 Bacteria 1390
122 Ga0495594_0021889 3300046499 Bacteria 3415
123 Ga0495618_0028662 3300046514 Bacteria 3471
124 Ga0495620_0003516 3300046515 Bacteria 8955
125 Ga0495628_0320285 3300046516 Bacteria 1144
126 Ga0495630_0052695 3300046517 Bacteria 3046
127 Ga0495630_0074049 3300046517 Bacteria 2564
128 Ga0495632_0000332 3300046519 Bacteria 44934
129 Ga0495666_0080591 3300046526 Bacteria 1540
130 Ga0495652_0027432 3300046529 Bacteria 5018
131 Ga0495665_0019590 3300046531 Bacteria 3639
132 Ga0495640_0076020 3300046533 Bacteria 2241
133 Ga0495586_0025199 3300046535 Bacteria 3182
134 Ga0495667_0118715 3300046559 Bacteria 1708
135 Ga0495634_0024702 3300046642 Bacteria 4212
136 Ga0495635_0061264 3300046663 Bacteria 2585
137 Ga0495599_0121290 3300046678 Bacteria 1625
138 Ga0495647_0030798 3300046681 Bacteria 1992
139 Ga0495658_0010395 3300046683 Bacteria 4656
140 Ga0495624_0016477 3300046690 Bacteria 4974
141 Ga0495581_0013096 3300047315 Bacteria 4808
142 Ga0495604_0197494 3300047317 Bacteria 1398
143 Ga0495674_0040416 3300047319 Bacteria 4171
144 Ga0495681_0000045 3300047470 Bacteria 111769
145 Ga0495684_0024149 3300047471 Bacteria 4678
146 Ga0495602_0081577 3300048088 Bacteria 2719
147 Ga0495614_0027338 3300048089 Bacteria 2460
148 Ga0496100_0005746 3300048903 Bacteria 6712
149 Ga0496100_0056423 3300048903 Bacteria 2570
150 Ga0496101_0004184 3300048904 Bacteria 9042
151 Ga0496102_0009577 3300048905 Bacteria 8330
152 Ga0496102_0058247 3300048905 Bacteria 3529
153 Ga0496102_0285767 3300048905 Bacteria 1555
154 Ga0496103_0064354 3300048906 Bacteria 2286
155 Ga0496104_0004397 3300048907 Bacteria 12274
156 Ga0496104_0009428 3300048907 Bacteria 8682
157 Ga0496105_0054597 3300048908 Bacteria 3298
158 Ga0496105_0167560 3300048908 Bacteria 1802
159 Ga0496106_0001630 3300048909 Bacteria 16852
160 Ga0496106_0003424 3300048909 Bacteria 11819
161 Ga0496107_0000229 3300048910 Bacteria 29677
162 Ga0496107_0017443 3300048910 Bacteria 5050
163 Ga0496107_0266996 3300048910 Bacteria 1274
164 Ga0496108_0000419 3300048911 Bacteria 34761
165 Ga0496108_0021727 3300048911 Bacteria 5276
166 Ga0496109_0000901 3300048912 Bacteria 24745
167 Ga0496109_0013509 3300048912 Bacteria 7085
168 Ga0496109_0112447 3300048912 Bacteria 2532
169 Ga0496110_0004800 3300048913 Bacteria 10528
170 Ga0496110_0180016 3300048913 Bacteria 1920
171 Ga0496111_0025732 3300048914 Bacteria 4152
172 Ga0496111_0034158 3300048914 Bacteria 3630
173 Ga0496112_0001990 3300048915 Bacteria 16161
174 Ga0496112_0075021 3300048915 Bacteria 3344
175 Ga0496113_0006766 3300048916 Bacteria 7309
176 Ga0496113_0038483 3300048916 Bacteria 3517
177 Ga0496114_0041495 3300048917 Bacteria 3814
178 Ga0496115_0207563 3300048918 Bacteria 1618
179 Ga0496119_0046282 3300048922 Bacteria 2718
180 Ga0496121_0014173 3300048924 Bacteria 8489
181 Ga0496121_0073010 3300048924 Bacteria 2752
182 Ga0496125_0020839 3300048928 Bacteria 6137
183 Ga0496126_0055159 3300048929 Bacteria 3597
184 Ga0501031_0148702 3300049568 Bacteria 1530
185 Ga0501032_0014407 3300049569 Bacteria 5601
186 Ga0501033_0050573 3300049570 Bacteria 3082
187 Ga0501034_0001206 3300049571 Bacteria 35489
188 Ga0501037_0096816 3300049573 Bacteria 2132
189 Ga0501039_0011594 3300049575 Bacteria 6712
190 Ga0501035_0011601 3300049822 Bacteria 8169
191 nmdc:mga05p37_33365_c1 3300050507 Bacteria 6305
192 nmdc:mga09592_360556_c1 3300050508 Bacteria 1258
193 nmdc:mga09592_60401_c1 3300050508 Bacteria 3205
194 nmdc:mga0qj67_110098_c1 3300050509 Bacteria 2223
195 nmdc:mga0qj67_11115_c1 3300050509 Bacteria 6743
196 nmdc:mga0qj67_29469_c1 3300050509 Bacteria 4264
197 nmdc:mga0qj67_63878_c1 3300050509 Bacteria 2927
198 nmdc:mga06r32_35095_c1 3300050510 Bacteria 4732
199 nmdc:mga0n895_20973_c1 3300050512 Bacteria 6103
200 nmdc:mga0n895_3382_c1 3300050512 Bacteria 12834
201 nmdc:mga0n895_71751_c1 3300050512 Bacteria 3434
202 nmdc:mga0rr50_203375_c1 3300050513 Bacteria 1628
203 nmdc:mga0rr50_349125_c1 3300050513 Bacteria 1244
204 nmdc:mga0a205_302097_c1 3300050515 Bacteria 1473
205 Ga0495601_0043487 3300053077 Bacteria 2821
206 Ga0495601_0117130 3300053077 Bacteria 1728
207 Ga0495601_0134168 3300053077 Bacteria 1613
208 Ga0495619_0025569 3300053085 Bacteria 3793
209 Ga0495619_0074756 3300053085 Bacteria 2273
210 Ga0500643_000500 3300053087 Bacteria 28162
211 Ga0500651_0089262 3300053093 Bacteria 1900
212 Ga0500566_0087776 3300053094 Bacteria 1722
213 Ga0500642_0000023 3300053130 Bacteria 135152
214 Ga0500559_0000149 3300053136 Bacteria 55058
215 Ga0500634_0000040 3300053161 Bacteria 59608
216 Ga0500637_0148899 3300053178 Bacteria 1353
217 2644169621 2643221629 Bacteria 5850260
218 2644350257 2643221662 Bacteria 5851492
219 2739305864 2738543024 Bacteria 5603683
220 2855734857 2855730933 Bacteria 7047938
221 2855770641 2855767633 Bacteria 7049357
222 2935634800 2935630451 Bacteria 8169952
223 2941511870 2941507105 Bacteria 8166816
224 2941519572 2941515067 Bacteria 8166720
225 2941527736 2941523033 Bacteria 8169134
226 Ga0209983_1005480
227 JGI25151J46595_10000185
228 Ga0070670_100197682
229 Ga0070661_100006560
230 Ga0070668_100217351
231 Ga0070659_100066358
232 Ga0070667_100334305
233 Ga0070711_100307905
234 Ga0070678_100259856
235 Ga0070681_10143397
236 Ga0070679_100012768
237 Ga0070684_100009745
238 Ga0070695_100002077
239 Ga0070665_100050227
240 Ga0070664_100008020
241 Ga0068854_100034602
242 Ga0068856_100046700
243 Ga0068852_100027876
244 Ga0068859_100111645
245 Ga0081539_10019537
246 Ga0070717_10213324
247 Ga0070712_100000365
248 Ga0075430_100037233
249 Ga0075431_100032475
250 Ga0075434_100005225
251 Ga0075434_100013013
252 Ga0075434_100068322
253 Ga0097620_100111638
254 Ga0075435_100015977
255 Ga0075435_100223569
256 Ga0105240_10012571
257 Ga0114129_10087093
258 Ga0105241_10027981
259 Ga0105237_10010755
260 Ga0105237_10042629
261 Ga0105238_10377491
262 Ga0105239_10489251
263 Ga0157373_10024995
264 Ga0157370_10021344
265 Ga0157369_10059669
266 Ga0213872_10000953
267 Ga0213872_10024565
268 Ga0213874_10001408
269 Ga0213874_10007621
270 Ga0213876_10001884
271 Ga0209025_1000064
272 Ga0207426_1010874
273 Ga0207426_1031009
274 Ga0207688_10077877
275 Ga0207707_10025710
276 Ga0207695_10126576
277 Ga0207671_10085311
278 Ga0207693_10000413
279 Ga0207663_10195366
280 Ga0207657_10000466
281 Ga0207694_10052137
282 Ga0207664_10095592
283 Ga0207691_10038416
284 Ga0207667_10006898
285 Ga0207639_10007259
286 Ga0207702_10052213
287 Ga0207674_10001129
288 Ga0207683_10054469
289 Ga0207698_10227893
290 Ga0209971_1001026
291 Ga0268266_10442203
292 Ga0268264_10342953
293 Ga0265332_10093188
294 Ga0373934_0045013
295 Ga0373944_0003279
296 Ga0373923_0001063
297 Ga0373936_0003137
298 Ga0373945_0027626
299 Ga0373945_0032208
300 Ga0373954_0010843
301 Ga0373943_0030410
302 Ga0373946_0007032
303 Ga0373955_0012847
304 Ga0373924_0021761
305 Ga0373931_0074605
306 Ga0373935_0049499
307 Ga0373927_0226722
308 Ga0373947_0030856
309 Ga0373947_0117082
310 Ga0373937_0166473
311 Ga0373937_0276411
312 Ga0373925_0005527
313 Ga0373925_0037021
314 Ga0395900_0022448
315 Ga0395898_0005925
316 Ga0436364_0651677
317 Ga0395901_0029957
318 Ga0436365_0705937
319 Ga0436365_1716323
320 Ga0436360_0340755
321 Ga0436361_0062896
322 Ga0436361_0066755
323 Ga0436361_0802206
324 Ga0436361_0930588
325 Ga0436363_0162311
326 Ga0436363_1301554
327 Ga0436362_0791278
328 Ga0466963_0023104
329 Ga0466963_0315023
330 Ga0466964_0006326
331 Ga0466964_0044377
332 Ga0451576_0003568
333 Ga0451576_0048679
334 Ga0466967_0003646
335 Ga0466967_0017502
336 Ga0466967_0134152
337 Ga0466967_0350871
338 Ga0495627_000482
339 Ga0495650_0000954
340 Ga0495582_0009966
341 Ga0495582_0093786
342 Ga0495639_0008281
343 Ga0495639_0027933
344 Ga0495662_0005636
345 Ga0495664_0006486
346 Ga0495664_0154961
347 Ga0495594_0021889
348 Ga0495618_0028662
349 Ga0495620_0003516
350 Ga0495628_0320285
351 Ga0495630_0052695
352 Ga0495630_0074049
353 Ga0495632_0000332
354 Ga0495666_0080591
355 Ga0495652_0027432
356 Ga0495665_0019590
357 Ga0495640_0076020
358 Ga0495586_0025199
359 Ga0495667_0118715
360 Ga0495634_0024702
361 Ga0495635_0061264
362 Ga0495599_0121290
363 Ga0495647_0030798
364 Ga0495658_0010395
365 Ga0495624_0016477
366 Ga0495581_0013096
367 Ga0495604_0197494
368 Ga0495674_0040416
369 Ga0495681_0000045
370 Ga0495684_0024149
371 Ga0495602_0081577
372 Ga0495614_0027338
373 Ga0496100_0005746
374 Ga0496100_0056423
375 Ga0496101_0004184
376 Ga0496102_0009577
377 Ga0496102_0058247
378 Ga0496102_0285767
379 Ga0496103_0064354
380 Ga0496104_0004397
381 Ga0496104_0009428
382 Ga0496105_0054597
383 Ga0496105_0167560
384 Ga0496106_0001630
385 Ga0496106_0003424
386 Ga0496107_0000229
387 Ga0496107_0017443
388 Ga0496107_0266996
389 Ga0496108_0000419
390 Ga0496108_0021727
391 Ga0496109_0000901
392 Ga0496109_0013509
393 Ga0496109_0112447
394 Ga0496110_0004800
395 Ga0496110_0180016
396 Ga0496111_0025732
397 Ga0496111_0034158
398 Ga0496112_0001990
399 Ga0496112_0075021
400 Ga0496113_0006766
401 Ga0496113_0038483
402 Ga0496114_0041495
403 Ga0496115_0207563
404 Ga0496119_0046282
405 Ga0496121_0014173
406 Ga0496121_0073010
407 Ga0496125_0020839
408 Ga0496126_0055159
409 Ga0501031_0148702
410 Ga0501032_0014407
411 Ga0501033_0050573
412 Ga0501034_0001206
413 Ga0501037_0096816
414 Ga0501039_0011594
415 Ga0501035_0011601
416 nmdc:mga05p37_33365_c1
417 nmdc:mga09592_360556_c1
418 nmdc:mga09592_60401_c1
419 nmdc:mga0qj67_110098_c1
420 nmdc:mga0qj67_11115_c1
421 nmdc:mga0qj67_29469_c1
422 nmdc:mga0qj67_63878_c1
423 nmdc:mga06r32_35095_c1
424 nmdc:mga0n895_20973_c1
425 nmdc:mga0n895_3382_c1
426 nmdc:mga0n895_71751_c1
427 nmdc:mga0rr50_203375_c1
428 nmdc:mga0rr50_349125_c1
429 nmdc:mga0a205_302097_c1
430 Ga0495601_0043487
431 Ga0495601_0117130
432 Ga0495601_0134168
433 Ga0495619_0025569
434 Ga0495619_0074756
435 Ga0500643_000500
436 Ga0500651_0089262
437 Ga0500566_0087776
438 Ga0500642_0000023
439 Ga0500559_0000149
440 Ga0500634_0000040
441 Ga0500637_0148899
442 2644169621
443 2644350257
444 2739305864
445 2855734857
446 2855770641
447 2935634800
448 2941511870
449 2941519572
450 2941527736

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08352

oligo_HPY

Oligopeptide/dipeptide transporter, C-terminal region

243

313

0.93

PF00005

ABC_tran

ABC transporter

32

192

0.92

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

83

228

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fwi-assembly1.cif.gz_B crystal structure of the nucleotide-binding domain of a dipeptide abc transporter 0.9468 9 327
5xu1-assembly1.cif.gz_B structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9466 9 246
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.9441 11 246
7w7a-assembly2.cif.gz_E heme exporter in complex with mn-containing protoporphyrin ix, mn-anomalous data 0.9412 11 240
7z17-assembly1.cif.gz_J e. coli c-p lyase bound to a phnk abc dimer in an open conformation 0.9408 9 265
ID Description Score Start End Superfamily
af_Q2FZR1_3_327_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9653 9 331 3.40.50.300
af_P77268_3_327_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9647 9 327 3.40.50.300
af_P0AAG0_1_323_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9621 9 327 3.40.50.300
af_P75957_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9619 8 241 3.40.50.300
af_Q2G1F8_1_274_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.961 9 277 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A537WAU2-F1-model_v4 ABC transporter ATP-binding protein 0.9912 30 268 GO:0005524
GO:0005886
GO:0015833
GO:0016887
AF-A0A2S9BS46-F1-model_v4 Dipeptide/oligopeptide/nickel ABC transporter ATP-binding protein 0.984 23 265 GO:0005524
GO:0005886
GO:0016887
AF-A0A6G2QKZ1-F1-model_v4 ATP-binding cassette domain-containing protein 0.983 9 264 GO:0005524
GO:0016887
AF-A0A562ZJX0-F1-model_v4 ABC transporter ATP-binding protein 0.9805 8 327 GO:0005524
GO:0005886
GO:0015833
GO:0016887
AF-A0A545AZY2-F1-model_v4 ABC transporter ATP-binding protein 0.9804 9 264 GO:0005524
GO:0016887

Map