F337696

General Info

Members Datasets Scaffolds Average Seq Length
225 155 450 332

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10010746|Ga0105240_100107462
Length 343
Sequence MLRPERRPEIRYDFMSDNTAPAAPEAMAAVLAANAGFVPSYGADPFTARAADLIRKLLDADAEVRFVASGTAANAIALAALCRPFESVVAHQHAHVATDETGAPGFFGHGLGMIPLPGAHGRIEAAALAAALAQPENGHVQSPGALSLTNATEYGAVYSGKALGGLIAPAKAAGLGVHLDGARIFNATAAGFDLVAIRPLGVDILAIGGTKAGMPPAEALVVFDRRLAHRLDARLKQSGQLPSKGRFYAAPFIGMLEDGAVLRHAAHANAMAARLAAAMPFKLSHPAESSGVFVEMDEPTRLRLRDAGWASSRFLDGSVRFMCSWATTPEAVDALGAALDAIR

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
44 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
45 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
46 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
47 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
48 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
79 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
80 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
81 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
82 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
83 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
84 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
85 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
86 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
87 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
88 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
94 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
95 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
96 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
97 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
98 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
99 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
100 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
101 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
102 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
103 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
104 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
105 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
106 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
107 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
108 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
109 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
110 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
111 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
112 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
113 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
114 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
115 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
116 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
117 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
118 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
119 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
120 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
121 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
127 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
128 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
129 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
130 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
131 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
132 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
133 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
134 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
135 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
136 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
137 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
138 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
139 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
140 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
141 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
142 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
143 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
144 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
145 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
146 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
147 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
148 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
149 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
150 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
151 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
152 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
153 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
154 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
155 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.89
Metatranscriptomes 0
Isolates 3.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.89
Nodule 0
Rhizoplane 4
Rhizosphere 67.56
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10010746 3300009093 Bacteria 12843
2 JGI25153J46596_10012713 3300003215 Bacteria 3608
3 Ga0055530_10000879 3300003791 Bacteria 24702
4 Ga0055531_10006801 3300003794 Bacteria 6384
5 Ga0065165_1000728 3300005262 Bacteria 46007
6 Ga0065165_1043540 3300005262 Bacteria 1317
7 Ga0070658_10209981 3300005327 Bacteria 1645
8 Ga0070670_100000044 3300005331 Bacteria 140263
9 Ga0070670_100087723 3300005331 Bacteria 2674
10 Ga0070666_10034231 3300005335 Bacteria 3367
11 Ga0070680_100006085 3300005336 Bacteria 9142
12 Ga0070680_100027676 3300005336 Bacteria 4541
13 Ga0070691_10010387 3300005341 Bacteria 4245
14 Ga0070668_100000098 3300005347 Bacteria 53574
15 Ga0070668_100009268 3300005347 Bacteria 7300
16 Ga0070668_100024940 3300005347 Bacteria 4533
17 Ga0070671_100057342 3300005355 Bacteria 3241
18 Ga0070673_100059359 3300005364 Bacteria 3027
19 Ga0070659_100212812 3300005366 Bacteria 1593
20 Ga0070667_100003729 3300005367 Bacteria 12938
21 Ga0070662_100150549 3300005457 Bacteria 1811
22 Ga0070681_10017074 3300005458 Bacteria 7254
23 Ga0070681_10105345 3300005458 Bacteria 2762
24 Ga0070681_10272026 3300005458 Bacteria 1605
25 Ga0070679_100057840 3300005530 Bacteria 3864
26 Ga0070679_100187797 3300005530 Bacteria 2036
27 Ga0068853_100225494 3300005539 Bacteria 1713
28 Ga0070665_100002025 3300005548 Bacteria 22786
29 Ga0070665_100271064 3300005548 Bacteria 1699
30 Ga0068855_100159921 3300005563 Bacteria 2557
31 Ga0068855_100497239 3300005563 Bacteria 1325
32 Ga0068859_100007203 3300005617 Bacteria 11289
33 Ga0068859_100107452 3300005617 Bacteria 2851
34 Ga0068864_100000061 3300005618 Bacteria 123373
35 Ga0068864_100006811 3300005618 Bacteria 9361
36 Ga0068861_100017580 3300005719 Bacteria 5080
37 Ga0068863_100000810 3300005841 Bacteria 31370
38 Ga0068863_100009394 3300005841 Bacteria 9545
39 Ga0068863_100079360 3300005841 Bacteria 3109
40 Ga0068858_100003504 3300005842 Bacteria 15561
41 Ga0068858_100023690 3300005842 Bacteria 5719
42 Ga0068860_100000100 3300005843 Bacteria 144580
43 Ga0068860_100000122 3300005843 Bacteria 125178
44 Ga0068860_100004300 3300005843 Bacteria 14558
45 Ga0068862_100006370 3300005844 Bacteria 9814
46 Ga0068862_100063288 3300005844 Bacteria 3183
47 Ga0070717_10278531 3300006028 Bacteria 1483
48 Ga0075364_10000160 3300006051 Bacteria 29830
49 Ga0075362_10061501 3300006177 Bacteria 1699
50 Ga0075367_10011449 3300006178 Bacteria 4695
51 Ga0075370_10028980 3300006353 Bacteria 3081
52 Ga0068865_100002419 3300006881 Bacteria 11025
53 Ga0097620_100007203 3300006931 Bacteria 11289
54 Ga0097620_100107455 3300006931 Bacteria 2851
55 Ga0105240_10008316 3300009093 Bacteria 14850
56 Ga0105240_10441735 3300009093 Bacteria 1458
57 Ga0105248_10000279 3300009177 Bacteria 60271
58 Ga0105248_10016737 3300009177 Bacteria 8073
59 Ga0105248_10157540 3300009177 Bacteria 2562
60 Ga0105238_10019131 3300009551 Bacteria 6978
61 Ga0105238_10080391 3300009551 Bacteria 3249
62 Ga0105238_10120714 3300009551 Bacteria 2600
63 Ga0105249_10035234 3300009553 Bacteria 4538
64 Ga0163162_10050310 3300013306 Bacteria 4179
65 Ga0163162_10293248 3300013306 Bacteria 1758
66 Ga0157372_10108500 3300013307 Bacteria 3177
67 Ga0157375_10012490 3300013308 Bacteria 7538
68 Ga0163163_10043821 3300014325 Bacteria 4389
69 Ga0163163_10250491 3300014325 Bacteria 1822
70 Ga0163163_10297697 3300014325 Bacteria 1666
71 Ga0157379_10111262 3300014968 Bacteria 2460
72 Ga0157376_10306989 3300014969 Bacteria 1504
73 Ga0213876_10019673 3300021384 Bacteria 3566
74 Ga0213876_10104981 3300021384 Bacteria 1499
75 Ga0209026_1001078 3300025250 Bacteria 13148
76 Ga0209758_1001067 3300025297 Bacteria 35672
77 Ga0209050_1000098 3300025298 Bacteria 236717
78 Ga0209257_1000221 3300025304 Bacteria 134870
79 Ga0209257_1002004 3300025304 Bacteria 21783
80 Ga0207705_10003909 3300025909 Bacteria 11330
81 Ga0207707_10373651 3300025912 Bacteria 1226
82 Ga0207695_10002540 3300025913 Bacteria 26801
83 Ga0207695_10008506 3300025913 Bacteria 12832
84 Ga0207695_10009975 3300025913 Bacteria 11668
85 Ga0207695_10030728 3300025913 Bacteria 5910
86 Ga0207660_10002793 3300025917 Bacteria 11441
87 Ga0207660_10080725 3300025917 Bacteria 2389
88 Ga0207657_10003993 3300025919 Bacteria 15684
89 Ga0207652_10484229 3300025921 Bacteria 1114
90 Ga0207681_10090144 3300025923 Bacteria 2188
91 Ga0207650_10000065 3300025925 Bacteria 140452
92 Ga0207650_10064619 3300025925 Bacteria 2740
93 Ga0207644_10049135 3300025931 Bacteria 3018
94 Ga0207690_10084556 3300025932 Bacteria 2224
95 Ga0207704_10022620 3300025938 Bacteria 3372
96 Ga0207711_10000684 3300025941 Bacteria 33642
97 Ga0207667_10038111 3300025949 Bacteria 5135
98 Ga0207712_10018394 3300025961 Bacteria 4550
99 Ga0207668_10000340 3300025972 Bacteria 30277
100 Ga0207668_10008059 3300025972 Bacteria 6271
101 Ga0207668_10030812 3300025972 Bacteria 3527
102 Ga0207668_10032062 3300025972 Bacteria 3468
103 Ga0207658_10000168 3300025986 Bacteria 70040
104 Ga0207703_10003313 3300026035 Bacteria 13519
105 Ga0207639_10134675 3300026041 Bacteria 2050
106 Ga0207641_10001551 3300026088 Bacteria 22508
107 Ga0207641_10011364 3300026088 Bacteria 7305
108 Ga0207641_10021655 3300026088 Bacteria 5281
109 Ga0207641_10204899 3300026088 Bacteria 1821
110 Ga0207676_10000127 3300026095 Bacteria 66733
111 Ga0207676_10033555 3300026095 Bacteria 3879
112 Ga0207676_10092715 3300026095 Bacteria 2485
113 Ga0207676_10249687 3300026095 Bacteria 1596
114 Ga0207674_10338029 3300026116 Bacteria 1456
115 Ga0207675_100108875 3300026118 Bacteria 2613
116 Ga0207698_10059930 3300026142 Bacteria 2957
117 Ga0209981_1000385 3300027378 Bacteria 5640
118 Ga0209983_1007079 3300027665 Bacteria 2303
119 Ga0268266_10008942 3300028379 Bacteria 8863
120 Ga0268266_10037934 3300028379 Bacteria 4103
121 Ga0268266_10050352 3300028379 Bacteria 3574
122 Ga0268265_10001199 3300028380 Bacteria 22587
123 Ga0268265_10002874 3300028380 Bacteria 12649
124 Ga0268265_10021624 3300028380 Bacteria 4509
125 Ga0268264_10000002 3300028381 Bacteria 1153045
126 Ga0268264_10000172 3300028381 Bacteria 140393
127 Ga0268264_10175021 3300028381 Bacteria 1944
128 Ga0307517_10001099 3300028786 Bacteria 45677
129 Ga0307511_10026156 3300030521 Bacteria 5358
130 Ga0265327_10000826 3300031251 Bacteria 46661
131 Ga0307513_10000208 3300031456 Bacteria 84906
132 Ga0307513_10003813 3300031456 Bacteria 20324
133 Ga0307513_10007922 3300031456 Bacteria 13674
134 Ga0307510_10013355 3300033180 Bacteria 9739
135 Ga0307510_10206833 3300033180 Bacteria 1490
136 Ga0373944_0013160 3300035089 Bacteria 2290
137 Ga0373936_0011306 3300035113 Bacteria 3378
138 Ga0373946_0013603 3300035171 Bacteria 3061
139 Ga0373927_0001609 3300035695 Bacteria 16951
140 Ga0373925_0000277 3300037068 Bacteria 53450
141 Ga0395899_0000847 3300037312 Bacteria 29441
142 Ga0395900_0000016 3300037418 Bacteria 382407
143 Ga0395900_0246859 3300037418 Bacteria 1788
144 Ga0395898_0009780 3300037466 Bacteria 10051
145 Ga0395898_0329000 3300037466 Bacteria 1457
146 Ga0395905_0003985 3300037471 Bacteria 15525
147 Ga0395901_0000028 3300038443 Bacteria 242653
148 Ga0395901_0217683 3300038443 Bacteria 1997
149 Ga0436365_0331671 3300039437 Bacteria 2428
150 Ga0436365_1199935 3300039437 Bacteria 5250
151 Ga0466973_0109963 3300044659 Bacteria 2307
152 Ga0495583_0041905 3300046506 Bacteria 2142
153 Ga0495620_0010489 3300046515 Bacteria 4889
154 Ga0495628_0060947 3300046516 Bacteria 2960
155 Ga0495643_0008775 3300046522 Bacteria 6369
156 Ga0495645_0014157 3300046543 Bacteria 5654
157 Ga0495622_0020935 3300046557 Bacteria 3045
158 Ga0495668_0007259 3300046616 Bacteria 7110
159 Ga0495668_0049763 3300046616 Bacteria 2324
160 Ga0495668_0105937 3300046616 Bacteria 1538
161 Ga0495611_0010016 3300046648 Bacteria 4010
162 Ga0495625_0007736 3300046660 Bacteria 9289
163 Ga0495588_0045251 3300046674 Bacteria 2256
164 Ga0495669_0000005 3300046684 Bacteria 193971
165 Ga0495669_0000356 3300046684 Bacteria 23366
166 Ga0495581_0071380 3300047315 Bacteria 2009
167 Ga0495677_0002371 3300047445 Bacteria 7405
168 Ga0495686_0017002 3300047472 Bacteria 4912
169 Ga0496100_0038131 3300048903 Bacteria 3043
170 Ga0496102_0028812 3300048905 Bacteria 4964
171 Ga0496102_0089923 3300048905 Bacteria 2841
172 Ga0496103_0052766 3300048906 Bacteria 2519
173 Ga0496103_0107819 3300048906 Bacteria 1767
174 Ga0496109_0006507 3300048912 Bacteria 9840
175 Ga0496110_0072645 3300048913 Bacteria 3053
176 Ga0496112_0013259 3300048915 Bacteria 7608
177 Ga0496115_0007391 3300048918 Bacteria 8083
178 Ga0496116_0019275 3300048919 Bacteria 5227
179 Ga0496117_0008365 3300048920 Bacteria 9839
180 Ga0496118_0017032 3300048921 Bacteria 6636
181 Ga0496119_0005397 3300048922 Bacteria 12280
182 Ga0496121_0000053 3300048924 Bacteria 312611
183 Ga0496121_0000356 3300048924 Bacteria 94447
184 Ga0501032_0036090 3300049569 Bacteria 3376
185 Ga0501033_0117562 3300049570 Bacteria 1931
186 Ga0501043_0003760 3300049579 Bacteria 12478
187 Ga0501047_0000277 3300049581 Bacteria 59304
188 Ga0501047_0001732 3300049581 Bacteria 21205
189 Ga0501047_0136832 3300049581 Bacteria 2330
190 Ga0501047_0217532 3300049581 Bacteria 1767
191 Ga0501035_0041045 3300049822 Bacteria 4179
192 Ga0501035_0047769 3300049822 Bacteria 3841
193 Ga0501044_0003119 3300049823 Bacteria 18782
194 nmdc:mga03n38_17418_c1 3300050490 Bacteria 2813
195 nmdc:mga00v17_5021_c1 3300050491 Bacteria 6947
196 nmdc:mga06z11_8423_c1 3300050494 Bacteria 4299
197 nmdc:mga07m45_2901_c1 3300050496 Bacteria 8127
198 Ga0500635_0000426 3300053080 Bacteria 12283
199 Ga0500566_0020100 3300053094 Bacteria 3923
200 Ga0500641_0039695 3300053096 Bacteria 1897
201 Ga0500555_044627 3300053103 Bacteria 1226
202 Ga0500556_0008889 3300053104 Bacteria 2907
203 Ga0500562_000897 3300053108 Bacteria 7240
204 Ga0500562_005610 3300053108 Bacteria 3156
205 Ga0500569_001333 3300053109 Bacteria 4624
206 Ga0500595_009154 3300053119 Bacteria 4010
207 Ga0500595_020017 3300053119 Bacteria 2416
208 Ga0500608_000842 3300053122 Bacteria 11112
209 Ga0500559_0017485 3300053136 Bacteria 3028
210 Ga0500559_0040118 3300053136 Bacteria 2038
211 Ga0500590_006787 3300053148 Bacteria 5603
212 Ga0500616_0069139 3300053153 Bacteria 1806
213 Ga0500638_007535 3300053162 Bacteria 4565
214 Ga0500636_0010747 3300053177 Bacteria 5347
215 Ga0500637_0005243 3300053178 Bacteria 6259
216 Ga0500625_021470 3300053729 Bacteria 3044
217 Ga0500645_001646 3300053730 Bacteria 10997
218 Ga0500596_000126 3300053735 Bacteria 11116
219 2643730642 2643221541 Bacteria 5498788
220 2644000011 2643221598 Bacteria 4578346
221 2644043811 2643221606 Bacteria 5588032
222 2644088439 2643221614 Bacteria 4260023
223 2644343675 2643221661 Bacteria 4267604
224 2644368847 2643221666 Bacteria 4265935
225 2644393970 2643221671 Bacteria 5496681
226 Ga0105240_10010746
227 JGI25153J46596_10012713
228 Ga0055530_10000879
229 Ga0055531_10006801
230 Ga0065165_1000728
231 Ga0065165_1043540
232 Ga0070658_10209981
233 Ga0070670_100000044
234 Ga0070670_100087723
235 Ga0070666_10034231
236 Ga0070680_100006085
237 Ga0070680_100027676
238 Ga0070691_10010387
239 Ga0070668_100000098
240 Ga0070668_100009268
241 Ga0070668_100024940
242 Ga0070671_100057342
243 Ga0070673_100059359
244 Ga0070659_100212812
245 Ga0070667_100003729
246 Ga0070662_100150549
247 Ga0070681_10017074
248 Ga0070681_10105345
249 Ga0070681_10272026
250 Ga0070679_100057840
251 Ga0070679_100187797
252 Ga0068853_100225494
253 Ga0070665_100002025
254 Ga0070665_100271064
255 Ga0068855_100159921
256 Ga0068855_100497239
257 Ga0068859_100007203
258 Ga0068859_100107452
259 Ga0068864_100000061
260 Ga0068864_100006811
261 Ga0068861_100017580
262 Ga0068863_100000810
263 Ga0068863_100009394
264 Ga0068863_100079360
265 Ga0068858_100003504
266 Ga0068858_100023690
267 Ga0068860_100000100
268 Ga0068860_100000122
269 Ga0068860_100004300
270 Ga0068862_100006370
271 Ga0068862_100063288
272 Ga0070717_10278531
273 Ga0075364_10000160
274 Ga0075362_10061501
275 Ga0075367_10011449
276 Ga0075370_10028980
277 Ga0068865_100002419
278 Ga0097620_100007203
279 Ga0097620_100107455
280 Ga0105240_10008316
281 Ga0105240_10441735
282 Ga0105248_10000279
283 Ga0105248_10016737
284 Ga0105248_10157540
285 Ga0105238_10019131
286 Ga0105238_10080391
287 Ga0105238_10120714
288 Ga0105249_10035234
289 Ga0163162_10050310
290 Ga0163162_10293248
291 Ga0157372_10108500
292 Ga0157375_10012490
293 Ga0163163_10043821
294 Ga0163163_10250491
295 Ga0163163_10297697
296 Ga0157379_10111262
297 Ga0157376_10306989
298 Ga0213876_10019673
299 Ga0213876_10104981
300 Ga0209026_1001078
301 Ga0209758_1001067
302 Ga0209050_1000098
303 Ga0209257_1000221
304 Ga0209257_1002004
305 Ga0207705_10003909
306 Ga0207707_10373651
307 Ga0207695_10002540
308 Ga0207695_10008506
309 Ga0207695_10009975
310 Ga0207695_10030728
311 Ga0207660_10002793
312 Ga0207660_10080725
313 Ga0207657_10003993
314 Ga0207652_10484229
315 Ga0207681_10090144
316 Ga0207650_10000065
317 Ga0207650_10064619
318 Ga0207644_10049135
319 Ga0207690_10084556
320 Ga0207704_10022620
321 Ga0207711_10000684
322 Ga0207667_10038111
323 Ga0207712_10018394
324 Ga0207668_10000340
325 Ga0207668_10008059
326 Ga0207668_10030812
327 Ga0207668_10032062
328 Ga0207658_10000168
329 Ga0207703_10003313
330 Ga0207639_10134675
331 Ga0207641_10001551
332 Ga0207641_10011364
333 Ga0207641_10021655
334 Ga0207641_10204899
335 Ga0207676_10000127
336 Ga0207676_10033555
337 Ga0207676_10092715
338 Ga0207676_10249687
339 Ga0207674_10338029
340 Ga0207675_100108875
341 Ga0207698_10059930
342 Ga0209981_1000385
343 Ga0209983_1007079
344 Ga0268266_10008942
345 Ga0268266_10037934
346 Ga0268266_10050352
347 Ga0268265_10001199
348 Ga0268265_10002874
349 Ga0268265_10021624
350 Ga0268264_10000002
351 Ga0268264_10000172
352 Ga0268264_10175021
353 Ga0307517_10001099
354 Ga0307511_10026156
355 Ga0265327_10000826
356 Ga0307513_10000208
357 Ga0307513_10003813
358 Ga0307513_10007922
359 Ga0307510_10013355
360 Ga0307510_10206833
361 Ga0373944_0013160
362 Ga0373936_0011306
363 Ga0373946_0013603
364 Ga0373927_0001609
365 Ga0373925_0000277
366 Ga0395899_0000847
367 Ga0395900_0000016
368 Ga0395900_0246859
369 Ga0395898_0009780
370 Ga0395898_0329000
371 Ga0395905_0003985
372 Ga0395901_0000028
373 Ga0395901_0217683
374 Ga0436365_0331671
375 Ga0436365_1199935
376 Ga0466973_0109963
377 Ga0495583_0041905
378 Ga0495620_0010489
379 Ga0495628_0060947
380 Ga0495643_0008775
381 Ga0495645_0014157
382 Ga0495622_0020935
383 Ga0495668_0007259
384 Ga0495668_0049763
385 Ga0495668_0105937
386 Ga0495611_0010016
387 Ga0495625_0007736
388 Ga0495588_0045251
389 Ga0495669_0000005
390 Ga0495669_0000356
391 Ga0495581_0071380
392 Ga0495677_0002371
393 Ga0495686_0017002
394 Ga0496100_0038131
395 Ga0496102_0028812
396 Ga0496102_0089923
397 Ga0496103_0052766
398 Ga0496103_0107819
399 Ga0496109_0006507
400 Ga0496110_0072645
401 Ga0496112_0013259
402 Ga0496115_0007391
403 Ga0496116_0019275
404 Ga0496117_0008365
405 Ga0496118_0017032
406 Ga0496119_0005397
407 Ga0496121_0000053
408 Ga0496121_0000356
409 Ga0501032_0036090
410 Ga0501033_0117562
411 Ga0501043_0003760
412 Ga0501047_0000277
413 Ga0501047_0001732
414 Ga0501047_0136832
415 Ga0501047_0217532
416 Ga0501035_0041045
417 Ga0501035_0047769
418 Ga0501044_0003119
419 nmdc:mga03n38_17418_c1
420 nmdc:mga00v17_5021_c1
421 nmdc:mga06z11_8423_c1
422 nmdc:mga07m45_2901_c1
423 Ga0500635_0000426
424 Ga0500566_0020100
425 Ga0500641_0039695
426 Ga0500555_044627
427 Ga0500556_0008889
428 Ga0500562_000897
429 Ga0500562_005610
430 Ga0500569_001333
431 Ga0500595_009154
432 Ga0500595_020017
433 Ga0500608_000842
434 Ga0500559_0017485
435 Ga0500559_0040118
436 Ga0500590_006787
437 Ga0500616_0069139
438 Ga0500638_007535
439 Ga0500636_0010747
440 Ga0500637_0005243
441 Ga0500625_021470
442 Ga0500645_001646
443 Ga0500596_000126
444 2643730642
445 2644000011
446 2644043811
447 2644088439
448 2644343675
449 2644368847
450 2644393970

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01212

Beta_elim_lyase

Beta-eliminating lyase

13

299

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7yvr-assembly1.cif.gz_D crystal structure of l-threonine aldolase from neptunomonas marina 0.9591 6 336
5vye-assembly1.cif.gz_A crystal structure of l-threonine aldolase from pseudomonas putida 0.9576 5 335
1v72-assembly1.cif.gz_A crystal structure of phenylserine aldolase from pseudomonas putida 0.9465 1 336
1v72-assembly1.cif.gz_A crystal structure of phenylserine aldolase from pseudomonas putida 0.9438 1 336
7w0i-assembly1.cif.gz_C crystal structure of threonine aldolase from mycobacterium vanbaalenii 0.9427 5 333
ID Description Score Start End Superfamily
1v72A02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9562 15 251 3.40.640.10
5vyeD02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.956 15 252 3.40.640.10
5vyeD02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9483 15 252 3.40.640.10
1v72A02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9407 15 251 3.40.640.10
af_A4HRH1_20_264_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9262 8 252 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A4Q3SF13-F1-model_v4 Low specificity L-threonine aldolase 1 246 335
AF-A0A838UJW1-F1-model_v4 Low specificity L-threonine aldolase 0.9856 50 335 GO:0006520
GO:0016829
AF-A0A7V9YUH7-F1-model_v4 deleted 0.9781 3 336
AF-A0A258FDL6-F1-model_v4 Threonine aldolase 0.9728 3 198 GO:0006520
GO:0016829
AF-A0A2N4TYJ9-F1-model_v4 L-threonine aldolase (EC 4.1.2.48) 0.9721 5 335 GO:0006567
GO:0008732

Map