F337574

General Info

Members Datasets Scaffolds Average Seq Length
225 157 450 172

Family's Representative Sequence

Representative Sequence 3300005549|Ga0070704_100083635|Ga0070704_1000836353
Length 204
Sequence MKPKSQQSLPASAFVTDSRPPQQPTVTLIVLSGLPGVGKTTIARELAVVLGATHVRIDSIEHSLRNAGMAVYDEGYRVAYAVAEDNLRLGQTVIADCVNPWPLTRLEWHSVAARAAVADHGPIRVLSVELVCSDLDEHKRRVESRVPDIAHHTVPTWPEVMAHDYRPWDTERLVIDTARLTVPQSIQTILSASGLTLTSRQAAD

Samples

Sample ID Description Type Environment
1 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
66 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
67 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
68 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
69 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
95 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
96 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
97 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
100 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
101 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
102 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
103 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
104 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
105 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
106 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
107 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
108 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
109 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
110 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
111 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
112 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
113 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
114 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
115 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
116 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
117 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
118 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
119 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
120 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
121 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
122 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
123 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
124 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
128 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
133 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
134 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
135 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
136 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
137 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
138 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
139 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
140 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
141 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
142 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
143 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
144 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
145 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
146 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
147 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
148 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
149 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
150 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
151 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
152 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
153 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
154 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
155 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
156 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
157 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.56
Metatranscriptomes 0
Isolates 0.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.89
Nodule 0
Rhizoplane 0.89
Rhizosphere 88.44
Stem 0
Stem Tuber 0
Unclassified 18.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070704_100083635 3300005549 Bacteria 2357
2 JGI25152J39213_1001304 3300002773 Bacteria 11151
3 JGI25153J46596_10003331 3300003215 Bacteria 9026
4 Ga0065704_10174295 3300005289 Bacteria 1273
5 Ga0065712_10004556 3300005290 Bacteria 8020
6 Ga0065712_10088101 3300005290 Unclassified 2530
7 Ga0065712_10159243 3300005290 Bacteria 1314
8 Ga0065707_10017054 3300005295 Bacteria 1578
9 Ga0070676_10271423 3300005328 Unclassified 1139
10 Ga0070690_100133265 3300005330 Bacteria 1680
11 Ga0070670_100007731 3300005331 Bacteria 9142
12 Ga0070670_101311875 3300005331 Unclassified 663
13 Ga0068868_100087242 3300005338 Bacteria 2509
14 Ga0070689_100467950 3300005340 Bacteria 1075
15 Ga0070687_100076989 3300005343 Bacteria 1808
16 Ga0070661_100871998 3300005344 Unclassified 742
17 Ga0070668_100074868 3300005347 Bacteria 2642
18 Ga0070669_100667213 3300005353 Bacteria 876
19 Ga0070675_100001326 3300005354 Bacteria 18099
20 Ga0070675_100379401 3300005354 Bacteria 1258
21 Ga0070675_100696923 3300005354 Bacteria 925
22 Ga0070675_101085780 3300005354 Bacteria 736
23 Ga0070675_101635906 3300005354 Bacteria 594
24 Ga0070674_100307744 3300005356 Bacteria 1265
25 Ga0070673_100013857 3300005364 Bacteria 5595
26 Ga0070688_100885597 3300005365 Bacteria 703
27 Ga0070709_10032249 3300005434 Bacteria 3157
28 Ga0070701_10221733 3300005438 Bacteria 1128
29 Ga0070711_100285107 3300005439 Bacteria 1308
30 Ga0070705_100106163 3300005440 Bacteria 1785
31 Ga0070700_100035463 3300005441 Bacteria 3019
32 Ga0070663_100215889 3300005455 Bacteria 1504
33 Ga0070678_100073662 3300005456 Bacteria 2564
34 Ga0070662_100355113 3300005457 Bacteria 1202
35 Ga0070707_100177528 3300005468 Bacteria 2076
36 Ga0070672_100176887 3300005543 Bacteria 1777
37 Ga0070672_100222046 3300005543 Bacteria 1585
38 Ga0070672_101227958 3300005543 Unclassified 668
39 Ga0070686_100169661 3300005544 Bacteria 1542
40 Ga0070695_100282853 3300005545 Bacteria 1219
41 Ga0070696_100433869 3300005546 Bacteria 1034
42 Ga0070664_100064880 3300005564 Bacteria 3115
43 Ga0070664_100295741 3300005564 Unclassified 1462
44 Ga0068859_100130515 3300005617 Unclassified 2584
45 Ga0068859_100432870 3300005617 Bacteria 1412
46 Ga0068859_100885900 3300005617 Unclassified 978
47 Ga0068859_101400117 3300005617 Unclassified 771
48 Ga0068861_100051498 3300005719 Bacteria 3126
49 Ga0068861_100976815 3300005719 Unclassified 807
50 Ga0068861_101276369 3300005719 Unclassified 713
51 Ga0068861_101921777 3300005719 Bacteria 589
52 Ga0068860_100059229 3300005843 Bacteria 3641
53 Ga0075368_10120369 3300006042 Bacteria 1087
54 Ga0075364_10133809 3300006051 Bacteria 1665
55 Ga0075364_10313793 3300006051 Bacteria 1068
56 Ga0075367_10087763 3300006178 Bacteria 1889
57 Ga0075366_10003933 3300006195 Bacteria 7921
58 Ga0097621_100069797 3300006237 Plasmid 2902
59 Ga0097621_100408750 3300006237 Bacteria 1216
60 Ga0075370_10026063 3300006353 Bacteria 3236
61 Ga0075370_10206368 3300006353 Unclassified 1160
62 Ga0075428_100016626 3300006844 Bacteria 8126
63 Ga0075428_100037625 3300006844 Bacteria 5325
64 Ga0075428_100723671 3300006844 Bacteria 1060
65 Ga0075428_101260476 3300006844 Bacteria 778
66 Ga0075430_100071022 3300006846 Bacteria 2921
67 Ga0075431_100000937 3300006847 Bacteria 25774
68 Ga0075431_100029307 3300006847 Bacteria 5664
69 Ga0075431_100453033 3300006847 Bacteria 1278
70 Ga0075431_101767486 3300006847 Bacteria 575
71 Ga0075433_10429250 3300006852 Unclassified 1165
72 Ga0075434_100096933 3300006871 Bacteria 2954
73 Ga0075434_100157537 3300006871 Bacteria 2290
74 Ga0075429_100000131 3300006880 Bacteria 44868
75 Ga0075429_100026210 3300006880 Bacteria 5059
76 Ga0075429_100036432 3300006880 Bacteria 4278
77 Ga0097620_100130513 3300006931 Unclassified 2584
78 Ga0097620_100432832 3300006931 Bacteria 1412
79 Ga0097620_100885919 3300006931 Unclassified 978
80 Ga0097620_101400027 3300006931 Unclassified 771
81 Ga0075435_100065353 3300007076 Unclassified 2957
82 Ga0099795_10022133 3300007788 Bacteria 2094
83 Ga0111539_10000037 3300009094 Bacteria 143023
84 Ga0111539_10110463 3300009094 Unclassified 3226
85 Ga0111539_10224545 3300009094 Bacteria 2188
86 Ga0111539_11663950 3300009094 Bacteria 740
87 Ga0105245_10663697 3300009098 Bacteria 1074
88 Ga0114129_10000019 3300009147 Bacteria 124932
89 Ga0114129_10063757 3300009147 Bacteria 5144
90 Ga0114129_10314706 3300009147 Bacteria 2083
91 Ga0114129_12903466 3300009147 Bacteria 567
92 Ga0105238_11936027 3300009551 Bacteria 623
93 Ga0105249_10218224 3300009553 Bacteria 1875
94 Ga0157369_10294796 3300013105 Bacteria 1688
95 Ga0157374_10117963 3300013296 Bacteria 2559
96 Ga0157374_10233847 3300013296 Unclassified 1806
97 Ga0163162_11143084 3300013306 Bacteria 883
98 Ga0157375_10083467 3300013308 Bacteria 3240
99 Ga0157375_10467311 3300013308 Bacteria 1427
100 Ga0163163_10020179 3300014325 Bacteria 6272
101 Ga0157380_10251356 3300014326 Bacteria 1600
102 Ga0157380_10908670 3300014326 Unclassified 907
103 Ga0157377_10037773 3300014745 Bacteria 2662
104 Ga0157376_10102708 3300014969 Bacteria 2501
105 Ga0157376_10338472 3300014969 Bacteria 1436
106 Ga0207425_1006668 3300025245 Bacteria 3132
107 Ga0209129_1000727 3300025258 Bacteria 21221
108 Ga0209025_1003369 3300025294 Bacteria 15282
109 Ga0209758_1000463 3300025297 Bacteria 67158
110 Ga0207699_10006603 3300025906 Bacteria 5631
111 Ga0207645_10214147 3300025907 Bacteria 1269
112 Ga0207645_10490254 3300025907 Bacteria 831
113 Ga0207643_10503356 3300025908 Bacteria 774
114 Ga0207663_10098841 3300025916 Bacteria 1955
115 Ga0207662_10017629 3300025918 Bacteria 4041
116 Ga0207646_10654990 3300025922 Unclassified 941
117 Ga0207650_10005832 3300025925 Bacteria 8404
118 Ga0207650_11111473 3300025925 Unclassified 673
119 Ga0207659_10006838 3300025926 Bacteria 7013
120 Ga0207659_10207718 3300025926 Bacteria 1568
121 Ga0207659_10312157 3300025926 Bacteria 1295
122 Ga0207687_10386139 3300025927 Bacteria 1148
123 Ga0207690_10036582 3300025932 Bacteria 3180
124 Ga0207691_10187481 3300025940 Bacteria 1805
125 Ga0207691_10203533 3300025940 Bacteria 1722
126 Ga0207689_10084876 3300025942 Bacteria 2603
127 Ga0207679_10037781 3300025945 Bacteria 3435
128 Ga0207679_10429656 3300025945 Bacteria 1167
129 Ga0207679_10863569 3300025945 Bacteria 827
130 Ga0207651_10104167 3300025960 Bacteria 2113
131 Ga0207712_10560225 3300025961 Bacteria 984
132 Ga0207668_10915248 3300025972 Unclassified 781
133 Ga0207640_10122882 3300025981 Bacteria 1863
134 Ga0207708_10023964 3300026075 Bacteria 4615
135 Ga0207641_10266559 3300026088 Bacteria 1606
136 Ga0207675_100037639 3300026118 Bacteria 4512
137 Ga0207675_100087688 3300026118 Bacteria 2923
138 Ga0207675_101467736 3300026118 Unclassified 703
139 Ga0207683_10208474 3300026121 Bacteria 1778
140 Ga0209813_10170720 3300027866 Bacteria 790
141 Ga0207428_10001399 3300027907 Bacteria 25465
142 Ga0207428_10408342 3300027907 Bacteria 994
143 Ga0268266_10305775 3300028379 Bacteria 1485
144 Ga0268264_10136478 3300028381 Bacteria 2181
145 Ga0307408_100005301 3300031548 Bacteria 8635
146 Ga0307408_100009565 3300031548 Bacteria 6396
147 Ga0307408_100368616 3300031548 Bacteria 1224
148 Ga0307516_10540418 3300031730 Unclassified 819
149 Ga0307405_10262318 3300031731 Bacteria 1291
150 Ga0307406_10013316 3300031901 Bacteria 4710
151 Ga0307416_100055488 3300032002 Bacteria 3191
152 Ga0373947_0479597 3300035725 Unclassified 844
153 Ga0439443_027891 3300042003 Bacteria 919
154 Ga0439448_0175223 3300042005 Unclassified 749
155 Ga0439450_018255 3300042008 Bacteria 1471
156 Ga0439435_0011276 3300042436 Bacteria 2142
157 Ga0439464_0010501 3300042439 Bacteria 2445
158 Ga0439440_0177850 3300042993 Bacteria 622
159 Ga0495603_0020374 3300046455 Bacteria 4019
160 Ga0495590_0339447 3300046457 Unclassified 570
161 Ga0495580_0216528 3300046472 Bacteria 1317
162 Ga0495584_0303367 3300046491 Unclassified 811
163 Ga0495585_0023266 3300046492 Bacteria 3556
164 Ga0495644_0037824 3300046523 Bacteria 1821
165 Ga0495648_0506775 3300046524 Unclassified 517
166 Ga0495652_0145523 3300046529 Bacteria 1858
167 Ga0495598_0005433 3300046537 Bacteria 2823
168 Ga0495621_0167428 3300046539 Bacteria 872
169 Ga0495633_0050885 3300046558 Bacteria 1952
170 Ga0495656_0006516 3300046615 Bacteria 4098
171 Ga0495659_0007282 3300046664 Bacteria 3507
172 Ga0495669_0094974 3300046684 Bacteria 1380
173 Ga0495670_0038217 3300046691 Bacteria 2393
174 Ga0495589_0143536 3300046794 Bacteria 1142
175 Ga0495636_0056453 3300047318 Bacteria 1653
176 Ga0495674_0032751 3300047319 Bacteria 4711
177 Ga0495684_0015439 3300047471 Bacteria 5877
178 Ga0496102_0038470 3300048905 Bacteria 4317
179 Ga0496109_0926092 3300048912 Bacteria 809
180 Ga0496126_0027133 3300048929 Bacteria 5477
181 Ga0496126_0088264 3300048929 Bacteria 2732
182 Ga0501036_1022331 3300049572 Unclassified 676
183 Ga0501037_0247252 3300049573 Unclassified 1249
184 Ga0501041_0076856 3300049577 Unclassified 2054
185 Ga0501048_0358424 3300049582 Bacteria 1040
186 Ga0501071_0285030 3300049587 Unclassified 1250
187 Ga0501072_0085284 3300049588 Bacteria 2505
188 Ga0501076_0025659 3300049592 Bacteria 4563
189 Ga0501080_0683384 3300049742 Bacteria 906
190 Ga0501081_0273910 3300049743 Unclassified 1235
191 Ga0501045_0054666 3300049824 Bacteria 2919
192 nmdc:mga03n38_658063_c1 3300050490 Bacteria 601
193 nmdc:mga00v17_82996_c1 3300050491 Bacteria 2004
194 nmdc:mga0k408_39052_c1 3300050493 Bacteria 2726
195 nmdc:mga04h51_11820_c1 3300050495 Bacteria 2434
196 nmdc:mga07m45_14900_c2 3300050496 Bacteria 3305
197 nmdc:mga07m45_201080_c1 3300050496 Unclassified 1159
198 nmdc:mga05p37_134478_c1 3300050507 Bacteria 3033
199 nmdc:mga05p37_214_c1 3300050507 Bacteria 58748
200 nmdc:mga05p37_2227_c1 3300050507 Bacteria 21082
201 nmdc:mga09592_1448_c1 3300050508 Bacteria 19042
202 nmdc:mga09592_46155_c1 3300050508 Bacteria 3670
203 nmdc:mga09592_52373_c1 3300050508 Bacteria 3445
204 nmdc:mga0qj67_1059682_c1 3300050509 Bacteria 634
205 nmdc:mga0qj67_1219_c1 3300050509 Bacteria 17902
206 nmdc:mga0qj67_790412_c1 3300050509 Bacteria 752
207 nmdc:mga06r32_315157_c1 3300050510 Bacteria 1550
208 nmdc:mga06r32_5215_c1 3300050510 Bacteria 11680
209 nmdc:mga06r32_5679_c1 3300050510 Bacteria 11229
210 nmdc:mga06r32_79185_c1 3300050510 Bacteria 3196
211 nmdc:mga08y16_1675634_c1 3300050511 Unclassified 592
212 nmdc:mga08y16_462411_c1 3300050511 Bacteria 1293
213 nmdc:mga0n895_158518_c1 3300050512 Bacteria 2294
214 nmdc:mga0n895_173298_c1 3300050512 Bacteria 2189
215 nmdc:mga0n895_996996_c1 3300050512 Unclassified 819
216 nmdc:mga0rr50_154436_c1 3300050513 Bacteria 1858
217 nmdc:mga0rr50_568566_c1 3300050513 Bacteria 966
218 Ga0501084_0061718 3300054114 Bacteria 3139
219 Ga0590071_000342 3300059421 Bacteria 13667
220 Ga0590074_000499 3300059423 Bacteria 5807
221 Ga0590075_001032 3300059424 Bacteria 7187
222 Ga0590077_002150 3300059426 Unclassified 4307
223 Ga0501082_0358187 3300060353 Unclassified 1272
224 Ga0530510_0129169 3300061734 Unclassified 1858
225 3005448208 3005445848 Bacteria 6906074
226 Ga0070704_100083635
227 JGI25152J39213_1001304
228 JGI25153J46596_10003331
229 Ga0065704_10174295
230 Ga0065712_10004556
231 Ga0065712_10088101
232 Ga0065712_10159243
233 Ga0065707_10017054
234 Ga0070676_10271423
235 Ga0070690_100133265
236 Ga0070670_100007731
237 Ga0070670_101311875
238 Ga0068868_100087242
239 Ga0070689_100467950
240 Ga0070687_100076989
241 Ga0070661_100871998
242 Ga0070668_100074868
243 Ga0070669_100667213
244 Ga0070675_100001326
245 Ga0070675_100379401
246 Ga0070675_100696923
247 Ga0070675_101085780
248 Ga0070675_101635906
249 Ga0070674_100307744
250 Ga0070673_100013857
251 Ga0070688_100885597
252 Ga0070709_10032249
253 Ga0070701_10221733
254 Ga0070711_100285107
255 Ga0070705_100106163
256 Ga0070700_100035463
257 Ga0070663_100215889
258 Ga0070678_100073662
259 Ga0070662_100355113
260 Ga0070707_100177528
261 Ga0070672_100176887
262 Ga0070672_100222046
263 Ga0070672_101227958
264 Ga0070686_100169661
265 Ga0070695_100282853
266 Ga0070696_100433869
267 Ga0070664_100064880
268 Ga0070664_100295741
269 Ga0068859_100130515
270 Ga0068859_100432870
271 Ga0068859_100885900
272 Ga0068859_101400117
273 Ga0068861_100051498
274 Ga0068861_100976815
275 Ga0068861_101276369
276 Ga0068861_101921777
277 Ga0068860_100059229
278 Ga0075368_10120369
279 Ga0075364_10133809
280 Ga0075364_10313793
281 Ga0075367_10087763
282 Ga0075366_10003933
283 Ga0097621_100069797
284 Ga0097621_100408750
285 Ga0075370_10026063
286 Ga0075370_10206368
287 Ga0075428_100016626
288 Ga0075428_100037625
289 Ga0075428_100723671
290 Ga0075428_101260476
291 Ga0075430_100071022
292 Ga0075431_100000937
293 Ga0075431_100029307
294 Ga0075431_100453033
295 Ga0075431_101767486
296 Ga0075433_10429250
297 Ga0075434_100096933
298 Ga0075434_100157537
299 Ga0075429_100000131
300 Ga0075429_100026210
301 Ga0075429_100036432
302 Ga0097620_100130513
303 Ga0097620_100432832
304 Ga0097620_100885919
305 Ga0097620_101400027
306 Ga0075435_100065353
307 Ga0099795_10022133
308 Ga0111539_10000037
309 Ga0111539_10110463
310 Ga0111539_10224545
311 Ga0111539_11663950
312 Ga0105245_10663697
313 Ga0114129_10000019
314 Ga0114129_10063757
315 Ga0114129_10314706
316 Ga0114129_12903466
317 Ga0105238_11936027
318 Ga0105249_10218224
319 Ga0157369_10294796
320 Ga0157374_10117963
321 Ga0157374_10233847
322 Ga0163162_11143084
323 Ga0157375_10083467
324 Ga0157375_10467311
325 Ga0163163_10020179
326 Ga0157380_10251356
327 Ga0157380_10908670
328 Ga0157377_10037773
329 Ga0157376_10102708
330 Ga0157376_10338472
331 Ga0207425_1006668
332 Ga0209129_1000727
333 Ga0209025_1003369
334 Ga0209758_1000463
335 Ga0207699_10006603
336 Ga0207645_10214147
337 Ga0207645_10490254
338 Ga0207643_10503356
339 Ga0207663_10098841
340 Ga0207662_10017629
341 Ga0207646_10654990
342 Ga0207650_10005832
343 Ga0207650_11111473
344 Ga0207659_10006838
345 Ga0207659_10207718
346 Ga0207659_10312157
347 Ga0207687_10386139
348 Ga0207690_10036582
349 Ga0207691_10187481
350 Ga0207691_10203533
351 Ga0207689_10084876
352 Ga0207679_10037781
353 Ga0207679_10429656
354 Ga0207679_10863569
355 Ga0207651_10104167
356 Ga0207712_10560225
357 Ga0207668_10915248
358 Ga0207640_10122882
359 Ga0207708_10023964
360 Ga0207641_10266559
361 Ga0207675_100037639
362 Ga0207675_100087688
363 Ga0207675_101467736
364 Ga0207683_10208474
365 Ga0209813_10170720
366 Ga0207428_10001399
367 Ga0207428_10408342
368 Ga0268266_10305775
369 Ga0268264_10136478
370 Ga0307408_100005301
371 Ga0307408_100009565
372 Ga0307408_100368616
373 Ga0307516_10540418
374 Ga0307405_10262318
375 Ga0307406_10013316
376 Ga0307416_100055488
377 Ga0373947_0479597
378 Ga0439443_027891
379 Ga0439448_0175223
380 Ga0439450_018255
381 Ga0439435_0011276
382 Ga0439464_0010501
383 Ga0439440_0177850
384 Ga0495603_0020374
385 Ga0495590_0339447
386 Ga0495580_0216528
387 Ga0495584_0303367
388 Ga0495585_0023266
389 Ga0495644_0037824
390 Ga0495648_0506775
391 Ga0495652_0145523
392 Ga0495598_0005433
393 Ga0495621_0167428
394 Ga0495633_0050885
395 Ga0495656_0006516
396 Ga0495659_0007282
397 Ga0495669_0094974
398 Ga0495670_0038217
399 Ga0495589_0143536
400 Ga0495636_0056453
401 Ga0495674_0032751
402 Ga0495684_0015439
403 Ga0496102_0038470
404 Ga0496109_0926092
405 Ga0496126_0027133
406 Ga0496126_0088264
407 Ga0501036_1022331
408 Ga0501037_0247252
409 Ga0501041_0076856
410 Ga0501048_0358424
411 Ga0501071_0285030
412 Ga0501072_0085284
413 Ga0501076_0025659
414 Ga0501080_0683384
415 Ga0501081_0273910
416 Ga0501045_0054666
417 nmdc:mga03n38_658063_c1
418 nmdc:mga00v17_82996_c1
419 nmdc:mga0k408_39052_c1
420 nmdc:mga04h51_11820_c1
421 nmdc:mga07m45_14900_c2
422 nmdc:mga07m45_201080_c1
423 nmdc:mga05p37_134478_c1
424 nmdc:mga05p37_214_c1
425 nmdc:mga05p37_2227_c1
426 nmdc:mga09592_1448_c1
427 nmdc:mga09592_46155_c1
428 nmdc:mga09592_52373_c1
429 nmdc:mga0qj67_1059682_c1
430 nmdc:mga0qj67_1219_c1
431 nmdc:mga0qj67_790412_c1
432 nmdc:mga06r32_315157_c1
433 nmdc:mga06r32_5215_c1
434 nmdc:mga06r32_5679_c1
435 nmdc:mga06r32_79185_c1
436 nmdc:mga08y16_1675634_c1
437 nmdc:mga08y16_462411_c1
438 nmdc:mga0n895_158518_c1
439 nmdc:mga0n895_173298_c1
440 nmdc:mga0n895_996996_c1
441 nmdc:mga0rr50_154436_c1
442 nmdc:mga0rr50_568566_c1
443 Ga0501084_0061718
444 Ga0590071_000342
445 Ga0590074_000499
446 Ga0590075_001032
447 Ga0590077_002150
448 Ga0501082_0358187
449 Ga0530510_0129169
450 3005448208

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13671

AAA_33

AAA domain

28

157

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ia5-assembly3.cif.gz_K t4 polynucleotide kinase/phosphatase with bound sulfate and magnesium. 0.8544 2 117
4gp6-assembly1.cif.gz_B-2 polynucleotide kinase 0.8541 2 118
1ly1-assembly1.cif.gz_A-2 structure and mechanism of t4 polynucleotide kinase 0.8519 2 117
2ia5-assembly2.cif.gz_H t4 polynucleotide kinase/phosphatase with bound sulfate and magnesium. 0.8497 2 117
2ia5-assembly2.cif.gz_E t4 polynucleotide kinase/phosphatase with bound sulfate and magnesium. 0.849 2 117
ID Description Score Start End Superfamily
af_P9WLN3_322_498_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8595 2 162 3.40.50.300
4gp6A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.849 2 117 3.40.50.300
af_Q59WJ3_131_342_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8472 2 115 3.40.50.300
af_K7KBA4_16_192_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8436 2 162 3.40.50.300
af_A0A0G2JUH4_338_483_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8324 2 136 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1H0DTC0-F1-model_v4 deleted 0.9852 1 164
AF-A0A250LHP1-F1-model_v4 Adenylyl-sulfate kinase 0.9834 1 162 GO:0004020
AF-A0A1T4QQG3-F1-model_v4 Predicted kinase 0.9822 1 163 GO:0016301
AF-Q8PCI9-F1-model_v4 Kinase 0.9814 2 128
AF-A0A7W5CPZ2-F1-model_v4 deleted 0.9808 1 166

Map