F337300

General Info

Members Datasets Scaffolds Average Seq Length
224 181 132 199

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8005570704|8005570835
Length 215
Sequence RGRRCTSVRKPPKAPQMITSPATAKVFQGVASRQQMFRMFDRHAQRPNRWDGDAAPFYAGEWFEIGETEYDYMFEILPPLWVRGSMFAMREYMTGSVTSVFFALRIDAAIRYFHGYCDLSDKASVETMRVAIIERESRPVHDAARAARAYLEHDCRRLPRLCRRQVAAVRSRQAHRRAFWRQRGHFPEAARGTHRRESAVKLPVHLRHLPSPIAA

Samples

Sample ID Description Type Environment
1 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
2 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
3 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
4 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
5 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
6 2516143018 Ensifer sp. BR816 Isolate Nodule
7 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
8 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
9 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
10 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
11 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
12 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
13 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
14 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
15 2643221558 Rhizobium sp. Root149 Isolate Unclassified
16 2643221582 Rhizobium sp. Root651 Isolate Unclassified
17 2643221599 Rhizobium sp. Root708 Isolate Unclassified
18 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
19 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
20 2643221651 Afipia sp. Root123D2 Isolate Unclassified
21 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
22 2643221719 Rhizobium sp. Root274 Isolate Unclassified
23 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
24 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
25 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
26 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
27 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
28 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
29 2791355256 Rhizobium sp. M10 Isolate Nodule
30 2791355263 Rhizobium chutanense C5 Isolate Nodule
31 2791355266 Rhizobium sp. L43 Isolate Nodule
32 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
33 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
34 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
35 2802429634 Rhizobium anhuiense S10 Isolate Nodule
36 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
37 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
38 2802429637 Rhizobium anhuiense C15 Isolate Nodule
39 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
40 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
41 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
42 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
43 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
44 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
45 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
46 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
47 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
48 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
49 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
50 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
51 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
52 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
53 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
54 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
55 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
56 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
57 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
58 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
59 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
60 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
61 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
62 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
63 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
64 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
65 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
66 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
67 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
68 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
69 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
70 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
71 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
72 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
73 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
74 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
75 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
76 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
77 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
78 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
79 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
80 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
81 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
82 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
83 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
84 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
85 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
91 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
92 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
93 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
94 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
98 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
107 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
108 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
109 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
110 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
118 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
119 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
120 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
121 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
122 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
123 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
124 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
125 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
126 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
127 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
128 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
129 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
130 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
131 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
132 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
133 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
134 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
135 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
136 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
137 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
138 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
139 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
140 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
141 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
142 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
143 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
144 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
145 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
146 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
147 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
148 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
159 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
161 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
162 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
163 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
164 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
165 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
166 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
167 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
168 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
169 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
170 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
171 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
172 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
173 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
174 8005395548 Rhizobium sp. R339 Isolate Nodule
175 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
176 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
177 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
178 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
179 8018176218 Rhizobium sp. N122 Isolate Nodule
180 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
181 8054558443 Rhizobium alarense TRM95111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 59.38
Metatranscriptomes 0
Isolates 40.62

Biome Distribution

Category Percentage (%)
Aerial Root 0.45
Bulb 0
Endosphere 16.96
Nodule 25.89
Rhizoplane 0.89
Rhizosphere 25.45
Stem 0
Stem Tuber 0
Unclassified 30.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1007477 3300003214 Bacteria 1810
2 rootH2_10177937 3300003320 Bacteria 1310
3 JGI25160J50197_1005225 3300003354 Bacteria 5442
4 JGI25161J50226_1017718 3300003374 Bacteria 744
5 Ga0055526_1000143 3300003771 Bacteria 62679
6 Ga0055524_1002498 3300003775 Bacteria 9455
7 Ga0055524_1003905 3300003775 Bacteria 7068
8 Ga0055528_1000404 3300003790 Bacteria 35025
9 Ga0055528_1000627 3300003790 Bacteria 26226
10 Ga0055540_1000094 3300003792 Bacteria 97733
11 Ga0055540_1043861 3300003792 Bacteria 952
12 Ga0055531_10031424 3300003794 Bacteria 1758
13 Ga0058692_1000083 3300003856 Bacteria 66222
14 Ga0055543_1003915 3300004625 Bacteria 4207
15 Ga0065165_1006440 3300005262 Bacteria 6152
16 Ga0065165_1010269 3300005262 Bacteria 4070
17 Ga0105240_10000484 3300009093 Bacteria 73546
18 Ga0105245_10208190 3300009098 Bacteria 1881
19 Ga0105237_10005183 3300009545 Bacteria 14739
20 Ga0105239_10133912 3300010375 Bacteria 2758
21 Ga0214544_1000097 3300021320 Bacteria 116548
22 Ga0214542_1000418 3300021321 Bacteria 75807
23 Ga0214543_1008600 3300021327 Bacteria 16559
24 Ga0209233_1007028 3300025261 Bacteria 3593
25 Ga0209673_1000126 3300025273 Bacteria 167949
26 Ga0209673_1000161 3300025273 Bacteria 142073
27 Ga0209673_1000699 3300025273 Bacteria 47647
28 Ga0209130_1027399 3300025284 Bacteria 1211
29 Ga0209564_1000526 3300025295 Bacteria 62489
30 Ga0209758_1003636 3300025297 Bacteria 13768
31 Ga0209050_1028267 3300025298 Bacteria 1824
32 Ga0209256_1001474 3300025299 Bacteria 24076
33 Ga0209256_1001813 3300025299 Bacteria 20074
34 Ga0207426_1005061 3300025302 Bacteria 6165
35 Ga0209051_1000032 3300025303 Bacteria 383445
36 Ga0209051_1002072 3300025303 Bacteria 15168
37 Ga0209257_1005431 3300025304 Bacteria 8951
38 Ga0207695_10000477 3300025913 Bacteria 86226
39 Ga0207671_10000642 3300025914 Bacteria 45685
40 Ga0209371_1000251 3300027312 Bacteria 66325
41 Ga0307515_10020198 3300028794 Bacteria 11906
42 Ga0307515_10105899 3300028794 Bacteria 3343
43 Ga0307515_10166429 3300028794 Bacteria 2220
44 Ga0268256_1003118 3300030500 Bacteria 7725
45 Ga0307513_10476845 3300031456 Bacteria 968
46 Ga0307514_10088235 3300031649 Bacteria 2270
47 Ga0307406_10031632 3300031901 Bacteria 3224
48 Ga0307412_10001590 3300031911 Bacteria 12505
49 Ga0395899_0003902 3300037312 Bacteria 11755
50 Ga0395899_0263033 3300037312 Bacteria 1179
51 Ga0395900_0000187 3300037418 Bacteria 100262
52 Ga0395900_0469673 3300037418 Bacteria 1212
53 Ga0395898_0000366 3300037466 Bacteria 99100
54 Ga0395898_0034243 3300037466 Bacteria 5064
55 Ga0395905_0001204 3300037471 Bacteria 32329
56 Ga0395905_0007063 3300037471 Bacteria 11224
57 Ga0395901_0000126 3300038443 Bacteria 98429
58 Ga0395901_0012046 3300038443 Bacteria 8772
59 Ga0439436_0053197 3300041404 Bacteria 1141
60 Ga0439438_036575 3300041405 Bacteria 1287
61 Ga0439461_0039257 3300041410 Bacteria 1017
62 Ga0439465_0004826 3300041413 Bacteria 4330
63 Ga0451833_0954644 3300041491 Bacteria 19723
64 Ga0451835_0519532 3300041492 Bacteria 19762
65 Ga0451837_0484889 3300041494 Bacteria 4429
66 Ga0451837_1228669 3300041494 Bacteria 3048
67 Ga0451839_0359094 3300041496 Bacteria 17158
68 Ga0451841_0518582 3300041498 Bacteria 18545
69 Ga0451845_0003133 3300041501 Bacteria 19158
70 Ga0451847_0430911 3300041503 Bacteria 1769
71 Ga0451849_0184412 3300041505 Bacteria 11701
72 Ga0451851_0011802 3300041507 Bacteria 19405
73 Ga0451843_0224544 3300041509 Bacteria 12657
74 Ga0451853_0043400 3300041512 Bacteria 33404
75 Ga0439449_0000983 3300042007 Bacteria 11209
76 Ga0495638_0000077 3300046460 Bacteria 158724
77 Ga0495687_005885 3300047443 Bacteria 7672
78 Ga0496104_0017327 3300048907 Bacteria 6557
79 Ga0496113_0000193 3300048916 Bacteria 27845
80 Ga0496116_0051593 3300048919 Bacteria 2731
81 Ga0496117_0026922 3300048920 Bacteria 4490
82 Ga0496118_0159105 3300048921 Bacteria 1400
83 Ga0496119_0023901 3300048922 Bacteria 4317
84 Ga0496120_0000974 3300048923 Bacteria 39045
85 Ga0496121_0128497 3300048924 Bacteria 1901
86 Ga0496121_0141954 3300048924 Bacteria 1780
87 Ga0496122_0000605 3300048925 Bacteria 73607
88 Ga0496122_0000868 3300048925 Bacteria 56966
89 Ga0496122_0098178 3300048925 Bacteria 1968
90 Ga0496123_0000046 3300048926 Bacteria 244844
91 Ga0496123_0000682 3300048926 Bacteria 55995
92 Ga0496124_0000227 3300048927 Bacteria 110314
93 Ga0496124_0000570 3300048927 Bacteria 62422
94 Ga0496125_0016562 3300048928 Bacteria 7071
95 Ga0496125_0119360 3300048928 Bacteria 1885
96 Ga0496126_0000243 3300048929 Bacteria 117685
97 Ga0501031_0170614 3300049568 Bacteria 1422
98 Ga0501032_0021907 3300049569 Bacteria 4436
99 Ga0501032_0302334 3300049569 Bacteria 1034
100 Ga0501033_0000054 3300049570 Bacteria 108163
101 Ga0501033_0001737 3300049570 Bacteria 19052
102 Ga0501033_0270230 3300049570 Bacteria 1202
103 Ga0501034_0146774 3300049571 Bacteria 2336
104 Ga0501036_0013795 3300049572 Bacteria 6721
105 Ga0501037_0013963 3300049573 Bacteria 5919
106 Ga0501037_0730405 3300049573 Bacteria 657
107 Ga0501038_0002274 3300049574 Bacteria 17862
108 Ga0501038_0228738 3300049574 Bacteria 1481
109 Ga0501038_0906896 3300049574 Bacteria 650
110 Ga0501039_0248370 3300049575 Bacteria 1399
111 Ga0501043_0049870 3300049579 Bacteria 3291
112 Ga0501047_0018136 3300049581 Bacteria 6744
113 Ga0501047_0202616 3300049581 Bacteria 1845
114 Ga0501047_0318319 3300049581 Bacteria 1396
115 Ga0501074_0047395 3300049590 Bacteria 3107
116 Ga0501035_0000381 3300049822 Bacteria 50879
117 Ga0501035_0008923 3300049822 Bacteria 9329
118 Ga0501035_0608610 3300049822 Bacteria 890
119 Ga0501035_1143795 3300049822 Bacteria 606
120 Ga0501044_0013411 3300049823 Bacteria 8862
121 Ga0501044_0046632 3300049823 Bacteria 4486
122 nmdc:mga03683_203584_c1 3300050489 Bacteria 909
123 nmdc:mga00v17_105_c2 3300050491 Bacteria 41105
124 nmdc:mga0k408_65993_c1 3300050493 Bacteria 2107
125 nmdc:mga06z11_347037_c1 3300050494 Bacteria 888
126 nmdc:mga0sz30_244879_c1 3300050516 Bacteria 798
127 nmdc:mga0sz30_85034_c1 3300050516 Bacteria 1372
128 Ga0500556_0000488 3300053104 Bacteria 27556
129 Ga0500618_003171 3300053125 Bacteria 5773
130 Ga0500658_0061595 3300053134 Bacteria 1561
131 Ga0500622_0143738 3300053156 Bacteria 1135
132 Ga0501084_0005838 3300054114 Bacteria 10135

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041494 Ga0451837_0484889 Ga0451837_0484889_3059_3658 172
2 iso_pu_bacteria 8005570704 8005570835 172
3 3300009093 Ga0105240_10000484 Ga0105240_1000048444 182
4 3300009098 Ga0105245_10208190 Ga0105245_102081902 182
5 3300009545 Ga0105237_10005183 Ga0105237_100051832 182
6 3300010375 Ga0105239_10133912 Ga0105239_101339122 182
7 3300041404 Ga0439436_0053197 Ga0439436_0053197_409_957 182
8 3300041405 Ga0439438_036575 Ga0439438_036575_560_1108 182
9 3300041410 Ga0439461_0039257 Ga0439461_0039257_419_967 182
10 3300041413 Ga0439465_0004826 Ga0439465_0004826_451_999 182
11 3300042007 Ga0439449_0000983 Ga0439449_0000983_9641_10189 182
12 3300049570 Ga0501033_0000054 Ga0501033_0000054_37312_37860 182
13 3300049573 Ga0501037_0730405 Ga0501037_0730405_15_563 182
14 3300049574 Ga0501038_0906896 Ga0501038_0906896_19_567 182
15 3300049822 Ga0501035_0000381 Ga0501035_0000381_42821_43369 182
16 3300049822 Ga0501035_1143795 Ga0501035_1143795_35_583 182
17 3300050516 nmdc:mga0sz30_85034_c1 nmdc:mga0sz30_85034_c1_555_1103 182
18 3300003354 JGI25160J50197_1005225 JGI25160J50197_10052257 183
19 3300003374 JGI25161J50226_1017718 JGI25161J50226_10177181 183
20 3300004625 Ga0055543_1003915 Ga0055543_10039157 183
21 3300005262 Ga0065165_1006440 Ga0065165_10064403 183
22 3300025284 Ga0209130_1027399 Ga0209130_10273992 183
23 3300025302 Ga0207426_1005061 Ga0207426_10050618 183
24 iso_pu_bacteria 2524023209 2524460765 186
25 iso_pu_bacteria 2615840626 2616309914 186
26 iso_pu_bacteria 2791355256 2793298036 186
27 iso_pu_bacteria 2924784321 2924786001 193
28 3300049590 Ga0501074_0047395 Ga0501074_0047395_46_633 195
29 3300054114 Ga0501084_0005838 Ga0501084_0005838_5700_6287 195
30 iso_pu_bacteria 2643221651 2644291590 195
31 iso_pu_bacteria 2802429605 2805931199 195
32 iso_pu_bacteria 8046767195 8046769996 195
33 iso_pu_bacteria 2511231027 2511388248 196
34 iso_pu_bacteria 2513237144 2513913733 196
35 iso_pu_bacteria 2513237159 2514000655 196
36 iso_pu_bacteria 2516143018 2516210537 196
37 iso_pu_bacteria 2517572143 2517896292 196
38 iso_pu_bacteria 2528768022 2528855651 196
39 iso_pu_bacteria 2537561587 2537877777 196
40 iso_pu_bacteria 2585427594 2585846893 196
41 iso_pu_bacteria 2615840698 2616551550 196
42 iso_pu_bacteria 2643221582 2643918159 196
43 iso_pu_bacteria 2643221599 2644004852 196
44 iso_pu_bacteria 2791355094 2792642566 196
45 iso_pu_bacteria 2838029111 2838033453 196
46 iso_pu_bacteria 2842475841 2842480277 196
47 iso_pu_bacteria 2842502639 2842507689 196
48 iso_pu_bacteria 2842521101 2842526677 196
49 iso_pu_bacteria 2896384573 2896385629 196
50 iso_pu_bacteria 2906328253 2906335600 196
51 iso_pu_bacteria 2958071322 2958076516 196
52 iso_pu_bacteria 639633055 639651311 196
53 iso_pu_bacteria 8054558443 8054560526 196
54 iso_pu_bacteria 2513237140 2513881878 197
55 iso_pu_bacteria 2515154113 2515635710 197
56 iso_pu_bacteria 2516143018 2516210304 197
57 iso_pu_bacteria 2524023209 2524461823 197
58 iso_pu_bacteria 2558860100 2558867083 197
59 iso_pu_bacteria 2643221558 2643814950 197
60 iso_pu_bacteria 2643221582 2643918076 197
61 iso_pu_bacteria 2643221623 2644130278 197
62 iso_pu_bacteria 2643221636 2644200594 197
63 iso_pu_bacteria 2643221653 2644300723 197
64 iso_pu_bacteria 2643221719 2644658945 197
65 iso_pu_bacteria 2690316117 2692320986 197
66 iso_pu_bacteria 2738541333 2739037558 197
67 iso_pu_bacteria 2775507266 2778180072 197
68 iso_pu_bacteria 2791355091 2792623715 197
69 iso_pu_bacteria 2791355092 2792630052 197
70 iso_pu_bacteria 2791355094 2792641131 197
71 iso_pu_bacteria 2791355263 2793343621 197
72 iso_pu_bacteria 2791355263 2793344610 197
73 iso_pu_bacteria 2791355266 2793363100 197
74 iso_pu_bacteria 2802429268 2804750420 197
75 iso_pu_bacteria 2802429606 2805937462 197
76 iso_pu_bacteria 2802429634 2806055757 197
77 iso_pu_bacteria 2802429635 2806062528 197
78 iso_pu_bacteria 2802429636 2806071049 197
79 iso_pu_bacteria 2802429637 2806076174 197
80 iso_pu_bacteria 2838074704 2838080423 197
81 iso_pu_bacteria 2838686498 2838691094 197
82 iso_pu_bacteria 2841851746 2841856417 197
83 iso_pu_bacteria 2842077413 2842083264 197
84 iso_pu_bacteria 2842110456 2842115200 197
85 iso_pu_bacteria 2842271015 2842275569 197
86 iso_pu_bacteria 2842298080 2842303298 197
87 iso_pu_bacteria 2842402390 2842407839 197
88 iso_pu_bacteria 2842409023 2842414372 197
89 iso_pu_bacteria 2842415677 2842421267 197
90 iso_pu_bacteria 2842489311 2842494770 197
91 iso_pu_bacteria 2842509118 2842514860 197
92 iso_pu_bacteria 2847417321 2847421482 197
93 iso_pu_bacteria 2848992105 2848996268 197
94 iso_pu_bacteria 2933016740 2933023057 197
95 iso_pu_bacteria 2933586486 2933589987 197
96 iso_pu_bacteria 2968083720 2968087407 197
97 iso_pu_bacteria 2978969890 2978974975 197
98 iso_pu_bacteria 2979089926 2979091901 197
99 iso_pu_bacteria 2979095461 2979100884 197
100 iso_pu_bacteria 2989776772 2989781271 197
101 iso_pu_bacteria 3004334049 3004342096 197
102 iso_pu_bacteria 637000159 637080395 197
103 iso_pu_bacteria 8003570095 8003574917 197
104 iso_pu_bacteria 8003570095 8003575096 197
105 iso_pu_bacteria 8003570095 8003575347 197
106 iso_pu_bacteria 8005395548 8005402137 197
107 iso_pu_bacteria 8005460587 8005465911 197
108 iso_pu_bacteria 8005619151 8005626089 197
109 iso_pu_bacteria 8018163183 8018169650 197
110 iso_pu_bacteria 8018176218 8018181625 197
111 iso_pu_bacteria 2818991453 2819642766 198
112 iso_pu_bacteria 2821123053 2821129764 198
113 iso_pu_bacteria 2899845264 2899848188 198
114 iso_pu_bacteria 2933594066 2933598862 198
115 iso_pu_bacteria 2984587000 2984589017 198
116 3300046460 Ga0495638_0000077 Ga0495638_0000077_63449_64048 199
117 3300049570 Ga0501033_0270230 Ga0501033_0270230_19_618 199
118 3300049574 Ga0501038_0228738 Ga0501038_0228738_396_995 199
119 3300049579 Ga0501043_0049870 Ga0501043_0049870_2541_3140 199
120 3300049581 Ga0501047_0202616 Ga0501047_0202616_706_1305 199
121 3300049581 Ga0501047_0318319 Ga0501047_0318319_728_1327 199
122 3300049823 Ga0501044_0046632 Ga0501044_0046632_3220_3819 199
123 3300041491 Ga0451833_0954644 Ga0451833_0954644_6982_7584 200
124 3300041492 Ga0451835_0519532 Ga0451835_0519532_6982_7584 200
125 3300041494 Ga0451837_1228669 Ga0451837_1228669_1574_2176 200
126 3300041496 Ga0451839_0359094 Ga0451839_0359094_6982_7584 200
127 3300041498 Ga0451841_0518582 Ga0451841_0518582_11380_11982 200
128 3300041501 Ga0451845_0003133 Ga0451845_0003133_6918_7520 200
129 3300041503 Ga0451847_0430911 Ga0451847_0430911_1024_1626 200
130 3300041505 Ga0451849_0184412 Ga0451849_0184412_4118_4720 200
131 3300041507 Ga0451851_0011802 Ga0451851_0011802_6687_7289 200
132 3300041509 Ga0451843_0224544 Ga0451843_0224544_4326_4928 200
133 3300041512 Ga0451853_0043400 Ga0451853_0043400_6944_7546 200
134 3300049822 Ga0501035_0608610 Ga0501035_0608610_63_665 200
135 3300050489 nmdc:mga03683_203584_c1 nmdc:mga03683_203584_c1_222_824 200
136 3300050491 nmdc:mga00v17_105_c2 nmdc:mga00v17_105_c2_4101_4703 200
137 3300050493 nmdc:mga0k408_65993_c1 nmdc:mga0k408_65993_c1_935_1537 200
138 3300050494 nmdc:mga06z11_347037_c1 nmdc:mga06z11_347037_c1_74_676 200
139 3300050516 nmdc:mga0sz30_244879_c1 nmdc:mga0sz30_244879_c1_13_615 200
140 3300003320 rootH2_10177937 rootH2_101779372 201
141 3300003771 Ga0055526_1000143 Ga0055526_100014334 201
142 3300003775 Ga0055524_1002498 Ga0055524_10024981 201
143 3300003775 Ga0055524_1003905 Ga0055524_100390512 201
144 3300003790 Ga0055528_1000404 Ga0055528_100040416 201
145 3300003790 Ga0055528_1000627 Ga0055528_100062713 201
146 3300003792 Ga0055540_1000094 Ga0055540_100009473 201
147 3300003792 Ga0055540_1043861 Ga0055540_10438611 201
148 3300003794 Ga0055531_10031424 Ga0055531_100314242 201
149 3300003856 Ga0058692_1000083 Ga0058692_100008359 201
150 3300005262 Ga0065165_1010269 Ga0065165_10102693 201
151 3300021320 Ga0214544_1000097 Ga0214544_1000097100 201
152 3300021321 Ga0214542_1000418 Ga0214542_100041816 201
153 3300021327 Ga0214543_1008600 Ga0214543_10086005 201
154 3300025273 Ga0209673_1000126 Ga0209673_1000126113 201
155 3300025273 Ga0209673_1000161 Ga0209673_100016112 201
156 3300025273 Ga0209673_1000699 Ga0209673_100069932 201
157 3300025295 Ga0209564_1000526 Ga0209564_100052632 201
158 3300025297 Ga0209758_1003636 Ga0209758_10036367 201
159 3300025298 Ga0209050_1028267 Ga0209050_10282672 201
160 3300025299 Ga0209256_1001474 Ga0209256_100147418 201
161 3300025299 Ga0209256_1001813 Ga0209256_100181318 201
162 3300025303 Ga0209051_1000032 Ga0209051_1000032199 201
163 3300025303 Ga0209051_1002072 Ga0209051_10020722 201
164 3300025304 Ga0209257_1005431 Ga0209257_10054312 201
165 3300025913 Ga0207695_10000477 Ga0207695_1000047734 201
166 3300025914 Ga0207671_10000642 Ga0207671_1000064234 201
167 3300027312 Ga0209371_1000251 Ga0209371_100025121 201
168 3300028794 Ga0307515_10020198 Ga0307515_100201985 201
169 3300028794 Ga0307515_10105899 Ga0307515_101058993 201
170 3300028794 Ga0307515_10166429 Ga0307515_101664293 201
171 3300030500 Ga0268256_1003118 Ga0268256_10031185 201
172 3300031456 Ga0307513_10476845 Ga0307513_104768452 201
173 3300031649 Ga0307514_10088235 Ga0307514_100882352 201
174 3300031901 Ga0307406_10031632 Ga0307406_100316322 201
175 3300031911 Ga0307412_10001590 Ga0307412_100015909 201
176 3300037312 Ga0395899_0003902 Ga0395899_0003902_6382_6987 201
177 3300037312 Ga0395899_0263033 Ga0395899_0263033_310_990 201
178 3300037418 Ga0395900_0000187 Ga0395900_0000187_93144_93749 201
179 3300037418 Ga0395900_0469673 Ga0395900_0469673_54_734 201
180 3300037466 Ga0395898_0000366 Ga0395898_0000366_92093_92698 201
181 3300037466 Ga0395898_0034243 Ga0395898_0034243_2169_2849 201
182 3300037471 Ga0395905_0001204 Ga0395905_0001204_6498_7103 201
183 3300037471 Ga0395905_0007063 Ga0395905_0007063_4928_5533 201
184 3300038443 Ga0395901_0000126 Ga0395901_0000126_91364_91969 201
185 3300038443 Ga0395901_0012046 Ga0395901_0012046_2963_3643 201
186 3300047443 Ga0495687_005885 Ga0495687_005885_6506_7111 201
187 3300048927 Ga0496124_0000570 Ga0496124_0000570_14384_14989 201
188 3300048928 Ga0496125_0119360 Ga0496125_0119360_579_1184 201
189 3300049568 Ga0501031_0170614 Ga0501031_0170614_225_830 201
190 3300049569 Ga0501032_0021907 Ga0501032_0021907_2687_3292 201
191 3300049569 Ga0501032_0302334 Ga0501032_0302334_401_1006 201
192 3300049570 Ga0501033_0001737 Ga0501033_0001737_6415_7020 201
193 3300049571 Ga0501034_0146774 Ga0501034_0146774_636_1241 201
194 3300049572 Ga0501036_0013795 Ga0501036_0013795_1344_1949 201
195 3300049573 Ga0501037_0013963 Ga0501037_0013963_3012_3617 201
196 3300049574 Ga0501038_0002274 Ga0501038_0002274_3214_3819 201
197 3300049575 Ga0501039_0248370 Ga0501039_0248370_56_661 201
198 3300049581 Ga0501047_0018136 Ga0501047_0018136_1022_1627 201
199 3300049822 Ga0501035_0008923 Ga0501035_0008923_3796_4401 201
200 3300049823 Ga0501044_0013411 Ga0501044_0013411_1825_2430 201
201 3300053104 Ga0500556_0000488 Ga0500556_0000488_8511_9116 201
202 3300053125 Ga0500618_003171 Ga0500618_003171_1564_2223 201
203 3300053134 Ga0500658_0061595 Ga0500658_0061595_440_1105 201
204 3300053156 Ga0500622_0143738 Ga0500622_0143738_222_827 201
205 3300003214 JGI25165J46597_1007477 JGI25165J46597_10074772 202
206 3300025261 Ga0209233_1007028 Ga0209233_10070283 202
207 3300048907 Ga0496104_0017327 Ga0496104_0017327_3586_4209 202
208 3300048916 Ga0496113_0000193 Ga0496113_0000193_20969_21592 202
209 3300048919 Ga0496116_0051593 Ga0496116_0051593_2012_2635 202
210 3300048920 Ga0496117_0026922 Ga0496117_0026922_914_1522 202
211 3300048921 Ga0496118_0159105 Ga0496118_0159105_576_1184 202
212 3300048922 Ga0496119_0023901 Ga0496119_0023901_986_1609 202
213 3300048923 Ga0496120_0000974 Ga0496120_0000974_986_1609 202
214 3300048924 Ga0496121_0128497 Ga0496121_0128497_279_902 202
215 3300048924 Ga0496121_0141954 Ga0496121_0141954_246_854 202
216 3300048925 Ga0496122_0000605 Ga0496122_0000605_35535_36158 202
217 3300048925 Ga0496122_0000868 Ga0496122_0000868_16440_17048 202
218 3300048925 Ga0496122_0098178 Ga0496122_0098178_97_705 202
219 3300048926 Ga0496123_0000046 Ga0496123_0000046_214569_215192 202
220 3300048926 Ga0496123_0000046 Ga0496123_0000046_93844_94467 202
221 3300048926 Ga0496123_0000682 Ga0496123_0000682_16520_17128 202
222 3300048927 Ga0496124_0000227 Ga0496124_0000227_29631_30254 202
223 3300048928 Ga0496125_0016562 Ga0496125_0016562_986_1609 202
224 3300048929 Ga0496126_0000243 Ga0496126_0000243_30593_31201 202

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07215

DUF1419

Protein of unknown function (DUF1419)

17

128

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7oyc-assembly1.cif.gz_E2 cryo-em structure of the xenopus egg 80s ribosome 0.7804 154 178
7qiz-assembly1.cif.gz_w specific features and methylation sites of a plant 80s ribosome 0.7747 154 178
6p5i-assembly1.cif.gz_F structure of a mammalian 80s ribosome in complex with the israeli acute paralysis virus ires (class 1) 0.754 154 178
4v6w-assembly1.cif.gz_AE structure of the d. melanogaster 80s ribosome 0.7413 153 178
7zai-assembly1.cif.gz_E cryo-em structure of a pyrococcus abyssi 30s bound to met-initiator trna, mrna and aif1a. 0.7357 152 177
ID Description Score Start End Superfamily
af_Q5QM20_113_350_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8576 159 175 2.130.10.10
2w80D02 Mainly Beta;Beta Barrel;Porin; 0.6629 70 100 2.40.160.90
2rotA00 Mainly Beta;Roll;SH3 type barrels.;SH3 Domains 0.6518 71 104 2.30.30.40
3tfzE00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.6509 75 107 3.30.530.20
af_Q9GYL7_59_288_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.6393 43 100 3.80.10.10
ID Description Score Start End GO Terms
AF-A0A1C3XMI8-F1-model_v4 DUF1419 domain-containing protein 0.9591 1 123
AF-A0A432V2H2-F1-model_v4 DUF1419 domain-containing protein 0.9587 1 195
AF-J8TXB0-F1-model_v4 DUF1419 domain-containing protein 0.9572 3 105
AF-A0A7W6X7R0-F1-model_v4 DUF1419 domain-containing protein 0.9563 1 144
AF-A0A527ZZ63-F1-model_v4 DUF1419 domain-containing protein 0.9537 1 167

Feature Viewer

pLDDT pTM Quality
82.99 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map