F337271

General Info

Members Datasets Scaffolds Average Seq Length
224 150 448 126

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2868088558|2868090244
Length 129
Sequence IAAFGMVVADMGRSLEFYRKLGLDIPADGDTQPHVEAELAPGMRLLWDTTESVRSFTPGYEQPGVSQISLAVDCAEPSAVDGLYKDLVDAGYHGEREPWDAFWGQRYATVQDPDGNDVDLFAVLPADDG

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
45 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
51 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
54 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
81 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
82 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
83 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
84 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
85 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
86 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
87 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
88 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
89 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
95 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
96 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
97 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
98 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
99 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
100 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
101 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
102 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
103 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
104 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
105 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
106 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
107 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
108 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
109 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
110 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
111 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
112 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
113 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
114 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
115 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
116 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
117 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
118 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
119 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
120 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
121 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
124 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
125 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
128 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
129 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
130 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
131 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
132 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
133 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
136 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
137 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
138 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
139 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
140 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
141 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
142 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
143 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
144 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
145 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
146 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
147 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
148 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
149 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
150 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.88
Metatranscriptomes 2.68
Isolates 0.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.45
Nodule 0
Rhizoplane 8.93
Rhizosphere 90.18
Stem 0
Stem Tuber 0
Unclassified 3.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10029868 3300005327 Bacteria 4379
2 Ga0070683_100008376 3300005329 Bacteria 8781
3 Ga0070683_100171179 3300005329 Bacteria 2061
4 Ga0070680_100912893 3300005336 Bacteria 758
5 Ga0070680_101369585 3300005336 Bacteria 612
6 Ga0070682_100080871 3300005337 Bacteria 2102
7 Ga0068868_100388371 3300005338 Bacteria 1202
8 Ga0070660_100130596 3300005339 Bacteria 2010
9 Ga0070660_100229909 3300005339 Bacteria 1509
10 Ga0070659_100491632 3300005366 Bacteria 1045
11 Ga0070709_10003184 3300005434 Bacteria 8803
12 Ga0070709_10022499 3300005434 Bacteria 3688
13 Ga0070709_10601042 3300005434 Bacteria 847
14 Ga0070714_100038004 3300005435 Bacteria 4048
15 Ga0070714_100939950 3300005435 Bacteria 840
16 Ga0070711_101659623 3300005439 Bacteria 559
17 Ga0070708_100204202 3300005445 Bacteria 1851
18 Ga0070663_100018230 3300005455 Bacteria 4597
19 Ga0070678_100058926 3300005456 Bacteria 2820
20 Ga0070681_10062891 3300005458 Bacteria 3684
21 Ga0070681_10180935 3300005458 Bacteria 2030
22 Ga0070706_100139067 3300005467 Bacteria 2266
23 Ga0070698_100319029 3300005471 Bacteria 1484
24 Ga0070699_100415829 3300005518 Bacteria 1217
25 Ga0070679_100029502 3300005530 Bacteria 5412
26 Ga0070679_100076582 3300005530 Bacteria 3334
27 Ga0070684_100085292 3300005535 Bacteria 2801
28 Ga0070684_100107435 3300005535 Bacteria 2499
29 Ga0070684_100349007 3300005535 Bacteria 1361
30 Ga0068853_102432557 3300005539 Bacteria 507
31 Ga0070686_100034488 3300005544 Bacteria 3119
32 Ga0070693_100402117 3300005547 Bacteria 950
33 Ga0068855_101451853 3300005563 Bacteria 705
34 Ga0068855_101719372 3300005563 Bacteria 639
35 Ga0070664_100707204 3300005564 Bacteria 939
36 Ga0068857_101801833 3300005577 Bacteria 599
37 Ga0068854_100276107 3300005578 Bacteria 1351
38 Ga0068854_100906846 3300005578 Bacteria 775
39 Ga0068852_101672904 3300005616 Bacteria 659
40 Ga0081455_10128931 3300005937 Bacteria 1981
41 Ga0070717_10506044 3300006028 Bacteria 1092
42 Ga0070715_10005199 3300006163 Bacteria 4325
43 Ga0070716_101015952 3300006173 Bacteria 656
44 Ga0070712_100163393 3300006175 Bacteria 1721
45 Ga0070712_101817978 3300006175 Bacteria 533
46 Ga0075428_100349689 3300006844 Bacteria 1586
47 Ga0075428_101126055 3300006844 Bacteria 829
48 Ga0075431_100230173 3300006847 Bacteria 1889
49 Ga0075433_10090037 3300006852 Bacteria 2712
50 Ga0075433_10300059 3300006852 Bacteria 1422
51 Ga0075434_100098158 3300006871 Bacteria 2934
52 Ga0075429_100397589 3300006880 Bacteria 1207
53 Ga0075436_100081347 3300006914 Bacteria 2246
54 Ga0105240_10911475 3300009093 Bacteria 945
55 Ga0111539_10145523 3300009094 Bacteria 2775
56 Ga0111539_10293972 3300009094 Bacteria 1890
57 Ga0114129_10275153 3300009147 Bacteria 2251
58 Ga0105242_10562743 3300009176 Bacteria 1095
59 Ga0105246_11884061 3300011119 Bacteria 574
60 Ga0157339_1017446 3300012505 Bacteria 729
61 Ga0157342_1051411 3300012507 Bacteria 581
62 Ga0157373_10503095 3300013100 Bacteria 875
63 Ga0157371_10542273 3300013102 Bacteria 862
64 Ga0157369_11449340 3300013105 Bacteria 699
65 Ga0157372_10234259 3300013307 Bacteria 2129
66 Ga0182008_10135103 3300014497 Bacteria 1231
67 Ga0157377_10145271 3300014745 Bacteria 1461
68 Ga0157376_10004722 3300014969 Bacteria 9493
69 Ga0182005_1148310 3300015265 Bacteria 681
70 Ga0206356_10008309 3300020070 Bacteria 1104
71 Ga0206356_10545307 3300020070 Bacteria 2073
72 Ga0206354_10600778 3300020081 Bacteria 2514
73 Ga0206354_11430759 3300020081 Bacteria 1033
74 Ga0206353_10173132 3300020082 Bacteria 2032
75 Ga0206353_11511255 3300020082 Bacteria 1253
76 Ga0207692_10022236 3300025898 Bacteria 2915
77 Ga0207705_10014278 3300025909 Bacteria 5719
78 Ga0207705_10024111 3300025909 Bacteria 4342
79 Ga0207707_10097369 3300025912 Bacteria 2571
80 Ga0207707_10427924 3300025912 Bacteria 1134
81 Ga0207693_10022292 3300025915 Bacteria 5033
82 Ga0207693_10037323 3300025915 Bacteria 3829
83 Ga0207663_10014333 3300025916 Bacteria 4335
84 Ga0207663_10231479 3300025916 Bacteria 1350
85 Ga0207660_10052957 3300025917 Bacteria 2891
86 Ga0207660_10062969 3300025917 Bacteria 2673
87 Ga0207657_10010625 3300025919 Bacteria 9174
88 Ga0207657_10024314 3300025919 Bacteria 5615
89 Ga0207657_10151714 3300025919 Bacteria 1887
90 Ga0207649_10124114 3300025920 Bacteria 1745
91 Ga0207649_10126073 3300025920 Unclassified 1733
92 Ga0207652_10052182 3300025921 Bacteria 3508
93 Ga0207652_10522732 3300025921 Bacteria 1068
94 Ga0207652_11191641 3300025921 Unclassified 663
95 Ga0207664_10371540 3300025929 Bacteria 1268
96 Ga0207664_10804819 3300025929 Bacteria 845
97 Ga0207664_11141900 3300025929 Bacteria 696
98 Ga0207690_10222104 3300025932 Bacteria 1446
99 Ga0207690_10299898 3300025932 Bacteria 1257
100 Ga0207690_10856187 3300025932 Bacteria 753
101 Ga0207686_10501292 3300025934 Bacteria 942
102 Ga0207665_10981025 3300025939 Bacteria 672
103 Ga0207661_10050140 3300025944 Bacteria 3324
104 Ga0207661_10062188 3300025944 Bacteria 3020
105 Ga0207661_10182535 3300025944 Bacteria 1834
106 Ga0207661_10620829 3300025944 Unclassified 993
107 Ga0207679_10465832 3300025945 Bacteria 1123
108 Ga0207667_10149251 3300025949 Bacteria 2406
109 Ga0207667_11654717 3300025949 Unclassified 608
110 Ga0207668_11398142 3300025972 Bacteria 631
111 Ga0207640_10208328 3300025981 Bacteria 1487
112 Ga0207677_11003032 3300026023 Bacteria 757
113 Ga0207678_10082009 3300026067 Bacteria 2760
114 Ga0207674_11092975 3300026116 Bacteria 767
115 Ga0207683_10023388 3300026121 Bacteria 5315
116 Ga0207698_11148784 3300026142 Bacteria 790
117 Ga0207428_10007499 3300027907 Bacteria 9941
118 Ga0265338_10080188 3300028800 Bacteria 2743
119 Ga0265338_10102263 3300028800 Bacteria 2330
120 Ga0265339_10076313 3300031249 Bacteria 1777
121 Ga0265316_10622518 3300031344 Bacteria 764
122 Ga0307408_101259585 3300031548 Bacteria 692
123 Ga0265314_10128960 3300031711 Bacteria 1580
124 Ga0265314_10445646 3300031711 Bacteria 691
125 Ga0307415_100906985 3300032126 Bacteria 813
126 Ga0373961_0324617 3300035241 Bacteria 575
127 Ga0373947_0371085 3300035725 Bacteria 962
128 Ga0373947_0716391 3300035725 Bacteria 683
129 Ga0395899_0053531 3300037312 Bacteria 2988
130 Ga0395900_0070002 3300037418 Bacteria 3607
131 Ga0395900_0080951 3300037418 Bacteria 3337
132 Ga0395900_0402840 3300037418 Bacteria 1332
133 Ga0395898_0001107 3300037466 Bacteria 41584
134 Ga0395898_0137086 3300037466 Bacteria 2343
135 Ga0395898_1845876 3300037466 Bacteria 525
136 Ga0395905_0246900 3300037471 Bacteria 1668
137 Ga0395905_0361246 3300037471 Bacteria 1345
138 Ga0395905_0510810 3300037471 Bacteria 1102
139 Ga0395901_0009580 3300038443 Bacteria 9830
140 Ga0395901_0021436 3300038443 Bacteria 6620
141 Ga0395901_0945667 3300038443 Bacteria 841
142 Ga0395901_1839806 3300038443 Bacteria 554
143 Ga0439448_0105815 3300042005 Bacteria 959
144 Ga0466966_0154966 3300044684 Bacteria 1396
145 Ga0466961_0005407 3300044693 Bacteria 8045
146 Ga0466963_0290878 3300044694 Bacteria 1148
147 Ga0466963_0405096 3300044694 Bacteria 962
148 Ga0466963_0601264 3300044694 Bacteria 777
149 Ga0466963_0721097 3300044694 Bacteria 703
150 Ga0466964_0102417 3300044706 Bacteria 1264
151 Ga0466964_0192550 3300044706 Bacteria 974
152 Ga0466971_0108965 3300044719 Bacteria 1277
153 Ga0466971_0146951 3300044719 Bacteria 1099
154 Ga0466968_0060873 3300044735 Bacteria 1628
155 Ga0466957_0152765 3300044842 Bacteria 1494
156 Ga0466957_0915650 3300044842 Unclassified 627
157 Ga0466959_0309614 3300045049 Bacteria 1081
158 Ga0466959_0945307 3300045049 Bacteria 574
159 Ga0466958_0032506 3300045836 Bacteria 3104
160 Ga0466958_0133852 3300045836 Bacteria 1558
161 Ga0466958_0293583 3300045836 Bacteria 1043
162 Ga0466958_0774191 3300045836 Bacteria 626
163 Ga0466967_0052791 3300045976 Bacteria 3570
164 Ga0466967_0104934 3300045976 Bacteria 2588
165 Ga0466967_0131716 3300045976 Bacteria 2322
166 Ga0466967_0241246 3300045976 Bacteria 1724
167 Ga0466967_2105434 3300045976 Unclassified 560
168 Ga0466967_2184277 3300045976 Bacteria 549
169 Ga0495629_0018212 3300046459 Bacteria 5031
170 Ga0495653_0088996 3300046463 Bacteria 2263
171 Ga0495582_0607056 3300046473 Bacteria 633
172 Ga0495585_0267753 3300046492 Bacteria 848
173 Ga0495607_0424214 3300046501 Bacteria 601
174 Ga0495608_0255366 3300046511 Bacteria 1092
175 Ga0495667_0052957 3300046559 Bacteria 2673
176 Ga0495634_0186873 3300046642 Bacteria 1294
177 Ga0495635_0117831 3300046663 Bacteria 1812
178 Ga0495657_0170764 3300046675 Bacteria 1339
179 Ga0495589_0502486 3300046794 Unclassified 554
180 Ga0495676_0041249 3300047321 Bacteria 3801
181 Ga0495684_0394596 3300047471 Bacteria 973
182 Ga0495593_0208898 3300047673 Bacteria 980
183 Ga0496101_0128883 3300048904 Bacteria 1919
184 Ga0496102_0995546 3300048905 Bacteria 759
185 Ga0496103_0112438 3300048906 Bacteria 1730
186 Ga0496104_0511547 3300048907 Bacteria 1112
187 Ga0496105_0129698 3300048908 Bacteria 2079
188 Ga0496105_0359562 3300048908 Bacteria 1161
189 Ga0496106_0344995 3300048909 Bacteria 1196
190 Ga0496107_0338478 3300048910 Bacteria 1119
191 Ga0496109_0091013 3300048912 Bacteria 2821
192 Ga0496110_0736726 3300048913 Bacteria 888
193 Ga0496111_0029569 3300048914 Bacteria 3892
194 Ga0496112_0070525 3300048915 Bacteria 3454
195 Ga0496112_0131628 3300048915 Bacteria 2472
196 Ga0496112_0223336 3300048915 Bacteria 1839
197 Ga0496113_0451516 3300048916 Bacteria 1033
198 Ga0496113_0470214 3300048916 Bacteria 1010
199 Ga0496114_0148416 3300048917 Bacteria 2033
200 Ga0496114_0831518 3300048917 Bacteria 803
201 Ga0496114_1711278 3300048917 Bacteria 517
202 Ga0496115_0140261 3300048918 Bacteria 1994
203 Ga0501031_0476140 3300049568 Bacteria 806
204 Ga0501042_0526307 3300049578 Unclassified 859
205 Ga0501067_0011134 3300049583 Bacteria 4975
206 Ga0501067_0117317 3300049583 Bacteria 1480
207 Ga0501069_0007322 3300049585 Bacteria 5791
208 Ga0501070_0659214 3300049586 Bacteria 830
209 Ga0501071_0154713 3300049587 Bacteria 1712
210 nmdc:mga03n38_139810_c2 3300050490 Bacteria 707
211 nmdc:mga09592_1332428_c1 3300050508 Bacteria 589
212 nmdc:mga08y16_1210797_c1 3300050511 Bacteria 725
213 nmdc:mga08y16_13320_c1 3300050511 Bacteria 8650
214 nmdc:mga0n895_185591_c1 3300050512 Bacteria 2111
215 nmdc:mga0n895_289968_c1 3300050512 Bacteria 1659
216 nmdc:mga0rr50_16988_c1 3300050513 Bacteria 4848
217 nmdc:mga0rr50_25675_c1 3300050513 Bacteria 4099
218 nmdc:mga08x19_62269_c1 3300050514 Bacteria 2419
219 nmdc:mga0a205_35896_c1 3300050515 Bacteria 4762
220 Ga0495619_0001992 3300053085 Bacteria 13596
221 Ga0501084_1407586 3300054114 Bacteria 584
222 Ga0466962_0067552 3300061719 Bacteria 1707
223 Ga0530510_0002519 3300061734 Bacteria 12591
224 2868090244 2868088558 Bacteria 7609351
225 Ga0070658_10029868
226 Ga0070683_100008376
227 Ga0070683_100171179
228 Ga0070680_100912893
229 Ga0070680_101369585
230 Ga0070682_100080871
231 Ga0068868_100388371
232 Ga0070660_100130596
233 Ga0070660_100229909
234 Ga0070659_100491632
235 Ga0070709_10003184
236 Ga0070709_10022499
237 Ga0070709_10601042
238 Ga0070714_100038004
239 Ga0070714_100939950
240 Ga0070711_101659623
241 Ga0070708_100204202
242 Ga0070663_100018230
243 Ga0070678_100058926
244 Ga0070681_10062891
245 Ga0070681_10180935
246 Ga0070706_100139067
247 Ga0070698_100319029
248 Ga0070699_100415829
249 Ga0070679_100029502
250 Ga0070679_100076582
251 Ga0070684_100085292
252 Ga0070684_100107435
253 Ga0070684_100349007
254 Ga0068853_102432557
255 Ga0070686_100034488
256 Ga0070693_100402117
257 Ga0068855_101451853
258 Ga0068855_101719372
259 Ga0070664_100707204
260 Ga0068857_101801833
261 Ga0068854_100276107
262 Ga0068854_100906846
263 Ga0068852_101672904
264 Ga0081455_10128931
265 Ga0070717_10506044
266 Ga0070715_10005199
267 Ga0070716_101015952
268 Ga0070712_100163393
269 Ga0070712_101817978
270 Ga0075428_100349689
271 Ga0075428_101126055
272 Ga0075431_100230173
273 Ga0075433_10090037
274 Ga0075433_10300059
275 Ga0075434_100098158
276 Ga0075429_100397589
277 Ga0075436_100081347
278 Ga0105240_10911475
279 Ga0111539_10145523
280 Ga0111539_10293972
281 Ga0114129_10275153
282 Ga0105242_10562743
283 Ga0105246_11884061
284 Ga0157339_1017446
285 Ga0157342_1051411
286 Ga0157373_10503095
287 Ga0157371_10542273
288 Ga0157369_11449340
289 Ga0157372_10234259
290 Ga0182008_10135103
291 Ga0157377_10145271
292 Ga0157376_10004722
293 Ga0182005_1148310
294 Ga0206356_10008309
295 Ga0206356_10545307
296 Ga0206354_10600778
297 Ga0206354_11430759
298 Ga0206353_10173132
299 Ga0206353_11511255
300 Ga0207692_10022236
301 Ga0207705_10014278
302 Ga0207705_10024111
303 Ga0207707_10097369
304 Ga0207707_10427924
305 Ga0207693_10022292
306 Ga0207693_10037323
307 Ga0207663_10014333
308 Ga0207663_10231479
309 Ga0207660_10052957
310 Ga0207660_10062969
311 Ga0207657_10010625
312 Ga0207657_10024314
313 Ga0207657_10151714
314 Ga0207649_10124114
315 Ga0207649_10126073
316 Ga0207652_10052182
317 Ga0207652_10522732
318 Ga0207652_11191641
319 Ga0207664_10371540
320 Ga0207664_10804819
321 Ga0207664_11141900
322 Ga0207690_10222104
323 Ga0207690_10299898
324 Ga0207690_10856187
325 Ga0207686_10501292
326 Ga0207665_10981025
327 Ga0207661_10050140
328 Ga0207661_10062188
329 Ga0207661_10182535
330 Ga0207661_10620829
331 Ga0207679_10465832
332 Ga0207667_10149251
333 Ga0207667_11654717
334 Ga0207668_11398142
335 Ga0207640_10208328
336 Ga0207677_11003032
337 Ga0207678_10082009
338 Ga0207674_11092975
339 Ga0207683_10023388
340 Ga0207698_11148784
341 Ga0207428_10007499
342 Ga0265338_10080188
343 Ga0265338_10102263
344 Ga0265339_10076313
345 Ga0265316_10622518
346 Ga0307408_101259585
347 Ga0265314_10128960
348 Ga0265314_10445646
349 Ga0307415_100906985
350 Ga0373961_0324617
351 Ga0373947_0371085
352 Ga0373947_0716391
353 Ga0395899_0053531
354 Ga0395900_0070002
355 Ga0395900_0080951
356 Ga0395900_0402840
357 Ga0395898_0001107
358 Ga0395898_0137086
359 Ga0395898_1845876
360 Ga0395905_0246900
361 Ga0395905_0361246
362 Ga0395905_0510810
363 Ga0395901_0009580
364 Ga0395901_0021436
365 Ga0395901_0945667
366 Ga0395901_1839806
367 Ga0439448_0105815
368 Ga0466966_0154966
369 Ga0466961_0005407
370 Ga0466963_0290878
371 Ga0466963_0405096
372 Ga0466963_0601264
373 Ga0466963_0721097
374 Ga0466964_0102417
375 Ga0466964_0192550
376 Ga0466971_0108965
377 Ga0466971_0146951
378 Ga0466968_0060873
379 Ga0466957_0152765
380 Ga0466957_0915650
381 Ga0466959_0309614
382 Ga0466959_0945307
383 Ga0466958_0032506
384 Ga0466958_0133852
385 Ga0466958_0293583
386 Ga0466958_0774191
387 Ga0466967_0052791
388 Ga0466967_0104934
389 Ga0466967_0131716
390 Ga0466967_0241246
391 Ga0466967_2105434
392 Ga0466967_2184277
393 Ga0495629_0018212
394 Ga0495653_0088996
395 Ga0495582_0607056
396 Ga0495585_0267753
397 Ga0495607_0424214
398 Ga0495608_0255366
399 Ga0495667_0052957
400 Ga0495634_0186873
401 Ga0495635_0117831
402 Ga0495657_0170764
403 Ga0495589_0502486
404 Ga0495676_0041249
405 Ga0495684_0394596
406 Ga0495593_0208898
407 Ga0496101_0128883
408 Ga0496102_0995546
409 Ga0496103_0112438
410 Ga0496104_0511547
411 Ga0496105_0129698
412 Ga0496105_0359562
413 Ga0496106_0344995
414 Ga0496107_0338478
415 Ga0496109_0091013
416 Ga0496110_0736726
417 Ga0496111_0029569
418 Ga0496112_0070525
419 Ga0496112_0131628
420 Ga0496112_0223336
421 Ga0496113_0451516
422 Ga0496113_0470214
423 Ga0496114_0148416
424 Ga0496114_0831518
425 Ga0496114_1711278
426 Ga0496115_0140261
427 Ga0501031_0476140
428 Ga0501042_0526307
429 Ga0501067_0011134
430 Ga0501067_0117317
431 Ga0501069_0007322
432 Ga0501070_0659214
433 Ga0501071_0154713
434 nmdc:mga03n38_139810_c2
435 nmdc:mga09592_1332428_c1
436 nmdc:mga08y16_1210797_c1
437 nmdc:mga08y16_13320_c1
438 nmdc:mga0n895_185591_c1
439 nmdc:mga0n895_289968_c1
440 nmdc:mga0rr50_16988_c1
441 nmdc:mga0rr50_25675_c1
442 nmdc:mga08x19_62269_c1
443 nmdc:mga0a205_35896_c1
444 Ga0495619_0001992
445 Ga0501084_1407586
446 Ga0466962_0067552
447 Ga0530510_0002519
448 2868090244

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

1

120

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1kll-assembly1.cif.gz_A-2 molecular basis of mitomycin c resictance in streptomyces: crystal structures of the mrd protein with and without a drug derivative 0.9066 2 127
2a4x-assembly1.cif.gz_B crystal structure of mitomycin c-binding protein complexed with metal-free bleomycin a2 0.9058 1 126
1kll-assembly1.cif.gz_A-2 molecular basis of mitomycin c resictance in streptomyces: crystal structures of the mrd protein with and without a drug derivative 0.8934 2 127
2a4x-assembly1.cif.gz_B crystal structure of mitomycin c-binding protein complexed with metal-free bleomycin a2 0.8925 1 126
3bqx-assembly1.cif.gz_A-2 high resolution crystal structure of a glyoxalase-related enzyme from fulvimarina pelagi 0.8657 1 125
ID Description Score Start End Superfamily
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9493 70 122 3.30.720.110
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9069 71 123 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9063 71 126 3.30.720.110
2a4xB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9058 1 126 3.10.180.10
2a4xB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8925 1 126 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A7W0N2J8-F1-model_v4 VOC family protein 0.952 61 127
AF-A0A535JZ30-F1-model_v4 Glyoxalase 0.9514 1 127
AF-A0A1Q3MS16-F1-model_v4 Glyoxalase 0.947 1 127
AF-A0A535RUY1-F1-model_v4 Glyoxalase 0.946 1 126
AF-A0A143QJZ1-F1-model_v4 VOC domain-containing protein 0.9437 1 126

Map