F337226

General Info

Members Datasets Scaffolds Average Seq Length
224 160 207 368

Family's Representative Sequence

Representative Sequence 3300053153|Ga0500616_0016221|Ga0500616_0016221_2775_3968
Length 397
Sequence MPHLPGIFALFVAPFLPSGFAQSHTHSMTTPWYEISNVAEIPTPSLAVWPHRIEENLRRMVKMVQGDPARLRPHMKTHKMPEVIKLHLMHGITKFKCATIAEAEMTASEGADEVLLAYPPVGPNIARLLRLVQKYPHTKFAATSDSETAARALSEACVAAGITMDVYIDLDCGMHRTGIAPDDAALALYRLLTTLPGLKVAGIHAYDGHIHDPDLAARKAAVETAFTTVEAFRDRLLAKGLPVPNYIASGTPTFGIHAVRGSYECSPGTCVLWDWGYGTKHPDLDFLHAALVLTRVISKPSSGRLTVDLGHKAIAAENPHPRVHFLNLPDAKAVMHSEEHLVLETPRADEFQIGDVLYGVPWHICPTVALHSYANVVRDGAVEDTWRVAGRERILSV

Samples

Sample ID Description Type Environment
1 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
2 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
3 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
4 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
5 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified
6 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
7 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
8 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
9 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
10 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
11 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
12 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
13 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
14 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
15 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
58 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
97 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
98 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
104 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
105 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
106 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
107 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
108 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
109 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
110 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
111 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
112 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
113 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
114 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
115 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
116 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
117 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
118 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
119 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
120 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
121 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
122 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
123 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
124 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
125 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
126 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
127 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
128 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
129 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
130 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
131 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
132 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
133 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
134 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
135 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
136 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
137 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
138 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
140 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
141 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
142 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
143 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
144 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
145 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
146 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
147 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
148 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
149 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
150 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
151 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
152 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
153 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
154 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
155 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
156 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
157 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
158 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
159 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
160 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.41
Metatranscriptomes 0
Isolates 7.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.68
Nodule 1.79
Rhizoplane 4.02
Rhizosphere 81.25
Stem 0
Stem Tuber 0
Unclassified 10.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10143534 3300003320 Bacteria 4107
2 rootH2_10172008 3300003320 Archaea 2371
3 rootH1_10084903 3300003323 Unclassified 2569
4 rootH1_10084904 3300003323 Bacteria 6602
5 Ga0065714_10003618 3300005288 Bacteria 6726
6 Ga0065714_10088251 3300005288 Bacteria 2025
7 Ga0065707_10140541 3300005295 Bacteria 1779
8 Ga0070690_100113578 3300005330 Unclassified 1810
9 Ga0070670_100053483 3300005331 Bacteria 3467
10 Ga0070666_10010477 3300005335 Bacteria 5801
11 Ga0070682_100061823 3300005337 Bacteria 2371
12 Ga0070689_100047056 3300005340 Bacteria 3325
13 Ga0070689_100067200 3300005340 Unclassified 2794
14 Ga0070689_100177054 3300005340 Bacteria 1730
15 Ga0070661_100006139 3300005344 Bacteria 8274
16 Ga0070669_100002575 3300005353 Bacteria 13121
17 Ga0070675_100039918 3300005354 Bacteria 3831
18 Ga0070671_100009785 3300005355 Bacteria 7697
19 Ga0070671_100096911 3300005355 Bacteria 2473
20 Ga0070674_100016256 3300005356 Bacteria 4662
21 Ga0070673_100385778 3300005364 Bacteria 1250
22 Ga0070688_100034225 3300005365 Unclassified 3075
23 Ga0070667_100078569 3300005367 Bacteria 2819
24 Ga0070667_100235830 3300005367 Bacteria 1632
25 Ga0070701_10005579 3300005438 Bacteria 5211
26 Ga0070701_10155921 3300005438 Bacteria 1319
27 Ga0070705_100086871 3300005440 Bacteria 1937
28 Ga0070700_100049420 3300005441 Unclassified 2611
29 Ga0070700_100092106 3300005441 Bacteria 1980
30 Ga0070678_100089222 3300005456 Bacteria 2359
31 Ga0070707_100240972 3300005468 Unclassified 1760
32 Ga0070684_100000858 3300005535 Bacteria 21459
33 Ga0070684_100026002 3300005535 Bacteria 4927
34 Ga0070686_100040512 3300005544 Unclassified 2906
35 Ga0070695_100056699 3300005545 Bacteria 2529
36 Ga0070704_100132220 3300005549 Bacteria 1936
37 Ga0070704_100209493 3300005549 Unclassified 1579
38 Ga0070664_100001006 3300005564 Bacteria 22147
39 Ga0070664_100009031 3300005564 Bacteria 8086
40 Ga0068857_100277472 3300005577 Unclassified 1541
41 Ga0068856_100003895 3300005614 Bacteria 14973
42 Ga0070702_100104194 3300005615 Bacteria 1746
43 Ga0068863_100197416 3300005841 Bacteria 1934
44 Ga0068862_100004285 3300005844 Bacteria 12070
45 Ga0081455_10029305 3300005937 Bacteria 5019
46 Ga0097621_100007163 3300006237 Bacteria 7952
47 Ga0075428_100020572 3300006844 Bacteria 7306
48 Ga0075428_100104413 3300006844 Bacteria 3090
49 Ga0075430_100000633 3300006846 Bacteria 26769
50 Ga0075430_100082804 3300006846 Bacteria 2689
51 Ga0075430_100101333 3300006846 Bacteria 2404
52 Ga0075431_100003570 3300006847 Bacteria 15067
53 Ga0075431_100027450 3300006847 Bacteria 5841
54 Ga0075431_100027698 3300006847 Bacteria 5816
55 Ga0075431_100122093 3300006847 Bacteria 2688
56 Ga0075431_100159032 3300006847 Bacteria 2324
57 Ga0075433_10019724 3300006852 Bacteria 5625
58 Ga0075433_10096733 3300006852 Bacteria 2613
59 Ga0075434_100424301 3300006871 Bacteria 1351
60 Ga0075429_100012474 3300006880 Bacteria 7373
61 Ga0075429_100020565 3300006880 Bacteria 5728
62 Ga0075436_100026938 3300006914 Bacteria 3958
63 Ga0099824_1008363 3300006942 Bacteria 13260
64 Ga0099826_10009238 3300006948 Bacteria 7361
65 Ga0075435_100108895 3300007076 Bacteria 2302
66 Ga0105244_10000046 3300009036 Bacteria 143184
67 Ga0111539_10000322 3300009094 Bacteria 58508
68 Ga0111539_10002626 3300009094 Bacteria 23816
69 Ga0111539_10211059 3300009094 Bacteria 2262
70 Ga0114129_10000592 3300009147 Bacteria 44838
71 Ga0114129_10013744 3300009147 Bacteria 11541
72 Ga0114129_10595485 3300009147 Bacteria 1433
73 Ga0114129_10809695 3300009147 Bacteria 1194
74 Ga0105243_10285180 3300009148 Bacteria 1489
75 Ga0105248_10010079 3300009177 Bacteria 10404
76 Ga0105249_10020621 3300009553 Bacteria 5893
77 Ga0157371_10007569 3300013102 Bacteria 8768
78 Ga0157370_10002652 3300013104 Bacteria 21482
79 Ga0157370_10054540 3300013104 Bacteria 3810
80 Ga0157370_10057809 3300013104 Bacteria 3686
81 Ga0157369_10051684 3300013105 Bacteria 4447
82 Ga0157375_10000058 3300013308 Bacteria 121019
83 Ga0157375_10015358 3300013308 Bacteria 6852
84 Ga0163163_10115318 3300014325 Bacteria 2718
85 Ga0157380_10120501 3300014326 Unclassified 2222
86 Ga0182006_1005424 3300015261 Bacteria 6087
87 Ga0182006_1025367 3300015261 Bacteria 2436
88 Ga0163161_10000019 3300017792 Bacteria 216758
89 Ga0163161_10064436 3300017792 Bacteria 2673
90 Ga0207697_10034670 3300025315 Bacteria 2066
91 Ga0207655_1000034 3300025728 Bacteria 364737
92 Ga0207642_10094453 3300025899 Bacteria 1486
93 Ga0207688_10049441 3300025901 Bacteria 2350
94 Ga0207649_10004825 3300025920 Bacteria 7292
95 Ga0207681_10024902 3300025923 Unclassified 3844
96 Ga0207650_10050955 3300025925 Bacteria 3063
97 Ga0207650_10065131 3300025925 Bacteria 2730
98 Ga0207706_10167337 3300025933 Bacteria 1932
99 Ga0207670_10002463 3300025936 Bacteria 9707
100 Ga0207670_10089380 3300025936 Bacteria 2174
101 Ga0207669_10100016 3300025937 Bacteria 1914
102 Ga0207691_10017824 3300025940 Bacteria 6729
103 Ga0207711_10032157 3300025941 Bacteria 4436
104 Ga0207711_10187290 3300025941 Bacteria 1885
105 Ga0207661_10020559 3300025944 Bacteria 4936
106 Ga0207679_10015294 3300025945 Bacteria 5066
107 Ga0207651_10172360 3300025960 Bacteria 1708
108 Ga0207712_10010452 3300025961 Bacteria 5893
109 Ga0207712_10077733 3300025961 Unclassified 2406
110 Ga0207678_10010935 3300026067 Bacteria 7973
111 Ga0207708_10048545 3300026075 Bacteria 3231
112 Ga0207641_10198948 3300026088 Bacteria 1846
113 Ga0207676_10064248 3300026095 Bacteria 2918
114 Ga0207676_10101990 3300026095 Bacteria 2381
115 Ga0207674_10259169 3300026116 Unclassified 1686
116 Ga0207683_10196737 3300026121 Unclassified 1832
117 Ga0209489_109199 3300027361 Bacteria 12544
118 Ga0209282_1013625 3300027666 Bacteria 5174
119 Ga0207428_10015625 3300027907 Bacteria 6560
120 Ga0207428_10200141 3300027907 Bacteria 1503
121 Ga0268265_10023323 3300028380 Unclassified 4361
122 Ga0307408_100257807 3300031548 Unclassified 1442
123 Ga0307412_10175692 3300031911 Bacteria 1605
124 Ga0307416_100000874 3300032002 Bacteria 15858
125 Ga0307416_100005122 3300032002 Bacteria 8003
126 Ga0307414_10015547 3300032004 Bacteria 4594
127 Ga0307414_10018157 3300032004 Bacteria 4321
128 Ga0307414_10147812 3300032004 Bacteria 1849
129 Ga0307414_10309899 3300032004 Bacteria 1339
130 Ga0307411_10000009 3300032005 Bacteria 319906
131 Ga0307411_10092384 3300032005 Bacteria 2116
132 Ga0373943_0133878 3300035170 Bacteria 1329
133 Ga0373947_0006889 3300035725 Bacteria 6587
134 Ga0373925_0016224 3300037068 Bacteria 5391
135 Ga0439447_000193 3300041407 Bacteria 21766
136 Ga0451807_1634483 3300041486 Bacteria 2670
137 Ga0450894_002301 3300042131 Bacteria 2585
138 Ga0450908_002716 3300042184 Unclassified 3455
139 Ga0439464_0005832 3300042439 Bacteria 3196
140 Ga0451577_0139562 3300042876 Bacteria 2177
141 Ga0453684_0001244 3300044712 Bacteria 77266
142 Ga0453684_0016770 3300044712 Bacteria 11413
143 Ga0453684_0078184 3300044712 Unclassified 4141
144 Ga0453684_0079511 3300044712 Bacteria 4099
145 Ga0453684_0093296 3300044712 Bacteria 3708
146 Ga0453684_0168254 3300044712 Bacteria 2585
147 Ga0451576_0155549 3300045051 Bacteria 2385
148 Ga0451576_0187786 3300045051 Bacteria 2158
149 Ga0451576_0300089 3300045051 Bacteria 1680
150 Ga0495610_0051632 3300046512 Bacteria 2000
151 Ga0495618_0162185 3300046514 Bacteria 1425
152 Ga0495630_0000017 3300046517 Bacteria 191957
153 Ga0495633_0085474 3300046558 Bacteria 1467
154 Ga0495625_0078054 3300046660 Bacteria 2312
155 Ga0495647_0073370 3300046681 Bacteria 1374
156 Ga0495658_0027100 3300046683 Bacteria 3079
157 Ga0495680_0155346 3300047322 Unclassified 1665
158 Ga0496101_0261020 3300048904 Bacteria 1351
159 Ga0496104_0080565 3300048907 Bacteria 3104
160 Ga0496105_0100826 3300048908 Bacteria 2384
161 Ga0496107_0180855 3300048910 Unclassified 1566
162 Ga0496109_0040566 3300048912 Bacteria 4216
163 Ga0496110_0002917 3300048913 Bacteria 12943
164 Ga0496111_0012545 3300048914 Bacteria 5742
165 Ga0496114_0225047 3300048917 Unclassified 1647
166 Ga0496116_0000075 3300048919 Bacteria 231674
167 Ga0496117_0130468 3300048920 Bacteria 1524
168 Ga0496118_0028781 3300048921 Bacteria 4672
169 Ga0496121_0009080 3300048924 Bacteria 11512
170 Ga0496124_0112022 3300048927 Bacteria 2195
171 Ga0496125_0000070 3300048928 Bacteria 245793
172 Ga0501034_0014150 3300049571 Bacteria 8223
173 Ga0501067_0023901 3300049583 Bacteria 3389
174 Ga0501074_0035910 3300049590 Unclassified 3591
175 Ga0501249_000970 3300049679 Bacteria 6241
176 Ga0501080_0012825 3300049742 Bacteria 7687
177 Ga0501080_0042530 3300049742 Bacteria 4230
178 Ga0501083_0008774 3300049744 Bacteria 7134
179 Ga0501266_000013 3300049763 Bacteria 183849
180 nmdc:mga05p37_1363_c1 3300050507 Bacteria 28411
181 nmdc:mga05p37_3776_c1 3300050507 Bacteria 17724
182 nmdc:mga09592_24995_c1 3300050508 Bacteria 4941
183 nmdc:mga09592_35054_c1 3300050508 Bacteria 4197
184 nmdc:mga09592_4136_c1 3300050508 Bacteria 11723
185 nmdc:mga0qj67_158898_c1 3300050509 Bacteria 1835
186 nmdc:mga0qj67_216705_c1 3300050509 Bacteria 1554
187 nmdc:mga0qj67_2457_c1 3300050509 Bacteria 13197
188 nmdc:mga0qj67_8672_c1 3300050509 Bacteria 7546
189 nmdc:mga06r32_1548_c1 3300050510 Bacteria 20719
190 nmdc:mga06r32_220390_c1 3300050510 Bacteria 1885
191 nmdc:mga06r32_35777_c1 3300050510 Unclassified 4686
192 nmdc:mga06r32_37586_c1 3300050510 Bacteria 4580
193 nmdc:mga06r32_461671_c1 3300050510 Bacteria 1249
194 nmdc:mga08y16_2164_c1 3300050511 Bacteria 20147
195 nmdc:mga08y16_297022_c1 3300050511 Bacteria 1665
196 nmdc:mga08y16_345128_c1 3300050511 Bacteria 1530
197 nmdc:mga08y16_36276_c1 3300050511 Bacteria 5177
198 nmdc:mga08y16_9822_c1 3300050511 Bacteria 10046
199 nmdc:mga0rr50_225947_c1 3300050513 Bacteria 1547
200 nmdc:mga0a205_9558_c1 3300050515 Bacteria 8872
201 Ga0500646_0022946 3300053090 Bacteria 1671
202 Ga0500641_0000012 3300053096 Bacteria 164908
203 Ga0500594_0008525 3300053118 Bacteria 2340
204 Ga0500658_0000005 3300053134 Bacteria 369268
205 Ga0500559_0026013 3300053136 Bacteria 2491
206 Ga0500616_0016221 3300053153 Bacteria 4245
207 Ga0501084_0009382 3300054114 Bacteria 8094

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050509 nmdc:mga0qj67_216705_c1 nmdc:mga0qj67_216705_c1_31_912 291
2 3300046660 Ga0495625_0078054 Ga0495625_0078054_112_1098 306
3 3300047322 Ga0495680_0155346 Ga0495680_0155346_646_1620 311
4 3300048904 Ga0496101_0261020 Ga0496101_0261020_11_955 311
5 3300046517 Ga0495630_0000017 Ga0495630_0000017_33862_35013 318
6 3300050511 nmdc:mga08y16_297022_c1 nmdc:mga08y16_297022_c1_672_1643 322
7 3300046681 Ga0495647_0073370 Ga0495647_0073370_295_1359 345
8 3300006847 Ga0075431_100027450 Ga0075431_1000274506 347
9 3300050510 nmdc:mga06r32_35777_c1 nmdc:mga06r32_35777_c1_2490_3548 347
10 3300005438 Ga0070701_10155921 Ga0070701_101559211 348
11 3300005549 Ga0070704_100132220 Ga0070704_1001322202 348
12 3300014326 Ga0157380_10120501 Ga0157380_101205012 348
13 3300048919 Ga0496116_0000075 Ga0496116_0000075_63028_64143 350
14 3300005288 Ga0065714_10003618 Ga0065714_100036186 351
15 3300005337 Ga0070682_100061823 Ga0070682_1000618233 351
16 3300013102 Ga0157371_10007569 Ga0157371_100075692 351
17 3300013104 Ga0157370_10054540 Ga0157370_100545403 351
18 3300013104 Ga0157370_10057809 Ga0157370_100578092 351
19 3300013105 Ga0157369_10051684 Ga0157369_100516842 351
20 3300015261 Ga0182006_1025367 Ga0182006_10253672 351
21 3300032004 Ga0307414_10015547 Ga0307414_100155472 351
22 3300032004 Ga0307414_10018157 Ga0307414_100181574 351
23 3300032004 Ga0307414_10309899 Ga0307414_103098992 351
24 3300032005 Ga0307411_10000009 Ga0307411_10000009125 351
25 3300041407 Ga0439447_000193 Ga0439447_000193_9893_11008 351
26 3300046512 Ga0495610_0051632 Ga0495610_0051632_670_1785 351
27 3300046558 Ga0495633_0085474 Ga0495633_0085474_185_1300 351
28 3300048920 Ga0496117_0130468 Ga0496117_0130468_237_1352 351
29 3300048921 Ga0496118_0028781 Ga0496118_0028781_707_1822 351
30 3300048928 Ga0496125_0000070 Ga0496125_0000070_83762_84877 351
31 3300049679 Ga0501249_000970 Ga0501249_000970_1944_3059 351
32 3300049763 Ga0501266_000013 Ga0501266_000013_167498_168613 351
33 3300053118 Ga0500594_0008525 Ga0500594_0008525_1038_2153 351
34 3300053134 Ga0500658_0000005 Ga0500658_0000005_179937_181052 351
35 3300044712 Ga0453684_0016770 Ga0453684_0016770_30_1151 352
36 iso_pu_bacteria 2643221725 2644682110 354
37 iso_pu_bacteria 2802428842 2802655064 354
38 iso_pu_bacteria 8055592153 8055597187 354
39 iso_pu_bacteria 2881359912 2881361080 355
40 3300013104 Ga0157370_10002652 Ga0157370_100026526 356
41 3300015261 Ga0182006_1005424 Ga0182006_10054245 356
42 3300048924 Ga0496121_0009080 Ga0496121_0009080_9522_10616 357
43 3300050511 nmdc:mga08y16_345128_c1 nmdc:mga08y16_345128_c1_26_1105 358
44 3300006942 Ga0099824_1008363 Ga0099824_100836315 360
45 3300006948 Ga0099826_10009238 Ga0099826_100092382 360
46 3300027361 Ga0209489_109199 Ga0209489_10919911 360
47 3300027666 Ga0209282_1013625 Ga0209282_10136254 360
48 3300032002 Ga0307416_100000874 Ga0307416_1000008741 360
49 3300035170 Ga0373943_0133878 Ga0373943_0133878_147_1277 361
50 3300035725 Ga0373947_0006889 Ga0373947_0006889_1038_2168 361
51 3300037068 Ga0373925_0016224 Ga0373925_0016224_2727_3857 361
52 iso_pu_bacteria 2643221600 2644012760 361
53 iso_pu_bacteria 2643221667 2644370443 361
54 iso_pu_bacteria 2643221716 2644641771 361
55 iso_pu_bacteria 2738541279 2738735543 361
56 iso_pu_bacteria 2738541285 2738768120 361
57 iso_pu_bacteria 2738543007 2739217125 361
58 iso_pu_bacteria 2739367857 2740003708 361
59 iso_pu_bacteria 2739367858 2740008525 361
60 iso_pu_bacteria 2857618242 2857622376 361
61 iso_pu_bacteria 2919191525 2919194706 361
62 iso_pu_bacteria 2929150217 2929150926 361
63 iso_pu_bacteria 8054307821 8054307936 361
64 iso_pu_bacteria 2684623219 2687237692 362
65 3300005288 Ga0065714_10088251 Ga0065714_100882512 363
66 3300005937 Ga0081455_10029305 Ga0081455_100293054 363
67 3300009036 Ga0105244_10000046 Ga0105244_10000046124 363
68 3300013308 Ga0157375_10015358 Ga0157375_100153584 363
69 3300017792 Ga0163161_10000019 Ga0163161_10000019139 363
70 3300025728 Ga0207655_1000034 Ga0207655_1000034141 363
71 3300041486 Ga0451807_1634483 Ga0451807_1634483_597_1703 363
72 3300042131 Ga0450894_002301 Ga0450894_002301_413_1534 363
73 3300045051 Ga0451576_0300089 Ga0451576_0300089_298_1395 363
74 3300048927 Ga0496124_0112022 Ga0496124_0112022_836_1951 363
75 3300053090 Ga0500646_0022946 Ga0500646_0022946_189_1304 363
76 3300053096 Ga0500641_0000012 Ga0500641_0000012_51547_52662 363
77 3300053136 Ga0500559_0026013 Ga0500559_0026013_947_2062 363
78 3300005340 Ga0070689_100067200 Ga0070689_1000672002 364
79 3300005356 Ga0070674_100016256 Ga0070674_1000162562 364
80 3300025937 Ga0207669_10100016 Ga0207669_101000162 364
81 3300042876 Ga0451577_0139562 Ga0451577_0139562_792_1901 364
82 3300044712 Ga0453684_0001244 Ga0453684_0001244_55489_56592 364
83 3300044712 Ga0453684_0079511 Ga0453684_0079511_2889_3998 364
84 3300044712 Ga0453684_0093296 Ga0453684_0093296_1198_2319 364
85 3300045051 Ga0451576_0155549 Ga0451576_0155549_355_1503 364
86 3300045051 Ga0451576_0187786 Ga0451576_0187786_253_1374 364
87 3300049590 Ga0501074_0035910 Ga0501074_0035910_1762_2874 364
88 3300049742 Ga0501080_0012825 Ga0501080_0012825_2779_3894 364
89 3300049744 Ga0501083_0008774 Ga0501083_0008774_876_2018 364
90 3300054114 Ga0501084_0009382 Ga0501084_0009382_3315_4469 364
91 3300005295 Ga0065707_10140541 Ga0065707_101405412 365
92 3300005330 Ga0070690_100113578 Ga0070690_1001135782 365
93 3300005331 Ga0070670_100053483 Ga0070670_1000534832 365
94 3300005335 Ga0070666_10010477 Ga0070666_100104773 365
95 3300005340 Ga0070689_100047056 Ga0070689_1000470563 365
96 3300005340 Ga0070689_100177054 Ga0070689_1001770542 365
97 3300005344 Ga0070661_100006139 Ga0070661_1000061395 365
98 3300005353 Ga0070669_100002575 Ga0070669_10000257513 365
99 3300005354 Ga0070675_100039918 Ga0070675_1000399185 365
100 3300005355 Ga0070671_100009785 Ga0070671_1000097853 365
101 3300005355 Ga0070671_100096911 Ga0070671_1000969112 365
102 3300005364 Ga0070673_100385778 Ga0070673_1003857781 365
103 3300005365 Ga0070688_100034225 Ga0070688_1000342252 365
104 3300005367 Ga0070667_100078569 Ga0070667_1000785692 365
105 3300005367 Ga0070667_100235830 Ga0070667_1002358302 365
106 3300005438 Ga0070701_10005579 Ga0070701_100055792 365
107 3300005440 Ga0070705_100086871 Ga0070705_1000868712 365
108 3300005441 Ga0070700_100049420 Ga0070700_1000494202 365
109 3300005441 Ga0070700_100092106 Ga0070700_1000921062 365
110 3300005456 Ga0070678_100089222 Ga0070678_1000892222 365
111 3300005468 Ga0070707_100240972 Ga0070707_1002409721 365
112 3300005535 Ga0070684_100000858 Ga0070684_10000085814 365
113 3300005535 Ga0070684_100026002 Ga0070684_1000260022 365
114 3300005544 Ga0070686_100040512 Ga0070686_1000405122 365
115 3300005545 Ga0070695_100056699 Ga0070695_1000566991 365
116 3300005549 Ga0070704_100209493 Ga0070704_1002094932 365
117 3300005564 Ga0070664_100001006 Ga0070664_10000100612 365
118 3300005564 Ga0070664_100009031 Ga0070664_1000090314 365
119 3300005577 Ga0068857_100277472 Ga0068857_1002774722 365
120 3300005615 Ga0070702_100104194 Ga0070702_1001041942 365
121 3300005841 Ga0068863_100197416 Ga0068863_1001974162 365
122 3300005844 Ga0068862_100004285 Ga0068862_1000042852 365
123 3300006237 Ga0097621_100007163 Ga0097621_1000071632 365
124 3300006844 Ga0075428_100020572 Ga0075428_1000205723 365
125 3300006844 Ga0075428_100104413 Ga0075428_1001044132 365
126 3300006846 Ga0075430_100000633 Ga0075430_10000063312 365
127 3300006846 Ga0075430_100082804 Ga0075430_1000828042 365
128 3300006846 Ga0075430_100101333 Ga0075430_1001013331 365
129 3300006847 Ga0075431_100003570 Ga0075431_1000035709 365
130 3300006847 Ga0075431_100027698 Ga0075431_1000276985 365
131 3300006847 Ga0075431_100122093 Ga0075431_1001220932 365
132 3300006847 Ga0075431_100159032 Ga0075431_1001590322 365
133 3300006852 Ga0075433_10019724 Ga0075433_100197246 365
134 3300006852 Ga0075433_10096733 Ga0075433_100967332 365
135 3300006871 Ga0075434_100424301 Ga0075434_1004243012 365
136 3300006880 Ga0075429_100012474 Ga0075429_1000124747 365
137 3300006880 Ga0075429_100020565 Ga0075429_1000205656 365
138 3300006914 Ga0075436_100026938 Ga0075436_1000269383 365
139 3300007076 Ga0075435_100108895 Ga0075435_1001088952 365
140 3300009094 Ga0111539_10000322 Ga0111539_1000032218 365
141 3300009094 Ga0111539_10002626 Ga0111539_100026263 365
142 3300009094 Ga0111539_10211059 Ga0111539_102110591 365
143 3300009147 Ga0114129_10000592 Ga0114129_1000059232 365
144 3300009147 Ga0114129_10013744 Ga0114129_100137449 365
145 3300009147 Ga0114129_10595485 Ga0114129_105954851 365
146 3300009147 Ga0114129_10809695 Ga0114129_108096951 365
147 3300009148 Ga0105243_10285180 Ga0105243_102851802 365
148 3300009177 Ga0105248_10010079 Ga0105248_100100792 365
149 3300009553 Ga0105249_10020621 Ga0105249_100206216 365
150 3300013308 Ga0157375_10000058 Ga0157375_1000005869 365
151 3300014325 Ga0163163_10115318 Ga0163163_101153182 365
152 3300017792 Ga0163161_10064436 Ga0163161_100644363 365
153 3300025315 Ga0207697_10034670 Ga0207697_100346702 365
154 3300025899 Ga0207642_10094453 Ga0207642_100944531 365
155 3300025901 Ga0207688_10049441 Ga0207688_100494413 365
156 3300025920 Ga0207649_10004825 Ga0207649_100048256 365
157 3300025923 Ga0207681_10024902 Ga0207681_100249022 365
158 3300025925 Ga0207650_10050955 Ga0207650_100509554 365
159 3300025925 Ga0207650_10065131 Ga0207650_100651312 365
160 3300025933 Ga0207706_10167337 Ga0207706_101673373 365
161 3300025936 Ga0207670_10002463 Ga0207670_100024636 365
162 3300025936 Ga0207670_10089380 Ga0207670_100893803 365
163 3300025940 Ga0207691_10017824 Ga0207691_100178248 365
164 3300025941 Ga0207711_10032157 Ga0207711_100321572 365
165 3300025941 Ga0207711_10187290 Ga0207711_101872902 365
166 3300025944 Ga0207661_10020559 Ga0207661_100205592 365
167 3300025945 Ga0207679_10015294 Ga0207679_100152944 365
168 3300025960 Ga0207651_10172360 Ga0207651_101723601 365
169 3300025961 Ga0207712_10010452 Ga0207712_100104526 365
170 3300025961 Ga0207712_10077733 Ga0207712_100777332 365
171 3300026067 Ga0207678_10010935 Ga0207678_100109359 365
172 3300026075 Ga0207708_10048545 Ga0207708_100485453 365
173 3300026088 Ga0207641_10198948 Ga0207641_101989481 365
174 3300026095 Ga0207676_10064248 Ga0207676_100642482 365
175 3300026095 Ga0207676_10101990 Ga0207676_101019902 365
176 3300026116 Ga0207674_10259169 Ga0207674_102591692 365
177 3300026121 Ga0207683_10196737 Ga0207683_101967372 365
178 3300027907 Ga0207428_10015625 Ga0207428_100156253 365
179 3300027907 Ga0207428_10200141 Ga0207428_102001411 365
180 3300028380 Ga0268265_10023323 Ga0268265_100233234 365
181 3300031548 Ga0307408_100257807 Ga0307408_1002578072 365
182 3300031911 Ga0307412_10175692 Ga0307412_101756921 365
183 3300032002 Ga0307416_100005122 Ga0307416_1000051222 365
184 3300032004 Ga0307414_10147812 Ga0307414_101478122 365
185 3300032005 Ga0307411_10092384 Ga0307411_100923842 365
186 3300042184 Ga0450908_002716 Ga0450908_002716_83_1186 365
187 3300042439 Ga0439464_0005832 Ga0439464_0005832_389_1492 365
188 3300044712 Ga0453684_0078184 Ga0453684_0078184_703_1809 365
189 3300044712 Ga0453684_0168254 Ga0453684_0168254_903_2030 365
190 3300046514 Ga0495618_0162185 Ga0495618_0162185_221_1375 365
191 3300046683 Ga0495658_0027100 Ga0495658_0027100_1482_2600 365
192 3300048907 Ga0496104_0080565 Ga0496104_0080565_826_1950 365
193 3300048908 Ga0496105_0100826 Ga0496105_0100826_69_1193 365
194 3300048910 Ga0496107_0180855 Ga0496107_0180855_200_1324 365
195 3300048912 Ga0496109_0040566 Ga0496109_0040566_1323_2459 365
196 3300048913 Ga0496110_0002917 Ga0496110_0002917_1653_2789 365
197 3300048914 Ga0496111_0012545 Ga0496111_0012545_745_1881 365
198 3300048917 Ga0496114_0225047 Ga0496114_0225047_153_1277 365
199 3300049571 Ga0501034_0014150 Ga0501034_0014150_5543_6649 365
200 3300049583 Ga0501067_0023901 Ga0501067_0023901_458_1561 365
201 3300049742 Ga0501080_0042530 Ga0501080_0042530_972_2078 365
202 3300050507 nmdc:mga05p37_1363_c1 nmdc:mga05p37_1363_c1_11320_12429 365
203 3300050507 nmdc:mga05p37_3776_c1 nmdc:mga05p37_3776_c1_12793_13896 365
204 3300050508 nmdc:mga09592_24995_c1 nmdc:mga09592_24995_c1_3176_4279 365
205 3300050508 nmdc:mga09592_35054_c1 nmdc:mga09592_35054_c1_990_2099 365
206 3300050508 nmdc:mga09592_4136_c1 nmdc:mga09592_4136_c1_6235_7338 365
207 3300050509 nmdc:mga0qj67_158898_c1 nmdc:mga0qj67_158898_c1_685_1788 365
208 3300050509 nmdc:mga0qj67_2457_c1 nmdc:mga0qj67_2457_c1_4603_5712 365
209 3300050509 nmdc:mga0qj67_8672_c1 nmdc:mga0qj67_8672_c1_833_1936 365
210 3300050510 nmdc:mga06r32_1548_c1 nmdc:mga06r32_1548_c1_10077_11180 365
211 3300050510 nmdc:mga06r32_220390_c1 nmdc:mga06r32_220390_c1_119_1228 365
212 3300050510 nmdc:mga06r32_37586_c1 nmdc:mga06r32_37586_c1_2888_3991 365
213 3300050510 nmdc:mga06r32_461671_c1 nmdc:mga06r32_461671_c1_103_1236 365
214 3300050511 nmdc:mga08y16_2164_c1 nmdc:mga08y16_2164_c1_5475_6578 365
215 3300050511 nmdc:mga08y16_36276_c1 nmdc:mga08y16_36276_c1_1904_3007 365
216 3300050511 nmdc:mga08y16_9822_c1 nmdc:mga08y16_9822_c1_7414_8550 365
217 3300050513 nmdc:mga0rr50_225947_c1 nmdc:mga0rr50_225947_c1_100_1236 365
218 3300050515 nmdc:mga0a205_9558_c1 nmdc:mga0a205_9558_c1_13_1146 365
219 3300053153 Ga0500616_0016221 Ga0500616_0016221_2775_3968 365
220 3300003320 rootH2_10143534 rootH2_101435342 368
221 3300003320 rootH2_10172008 rootH2_101720082 368
222 3300003323 rootH1_10084903 rootH1_100849032 368
223 3300003323 rootH1_10084904 rootH1_100849042 368
224 3300005614 Ga0068856_100003895 Ga0068856_10000389514 368

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14031

D-ser_dehydrat

Putative serine dehydratase domain

289

377

0.88

PF01168

Ala_racemase_N

Alanine racemase, N-terminal domain

49

272

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7dib-assembly1.cif.gz_B crystal structure of d-threonine aldolase from filomicrobium marinum 0.9182 9 359
7yqa-assembly2.cif.gz_D crystal structure of d-threonine aldolase from chlamydomonas reinhardtii 0.9137 3 360
7yqa-assembly1.cif.gz_B crystal structure of d-threonine aldolase from chlamydomonas reinhardtii 0.9135 4 360
4v15-assembly1.cif.gz_B crystal structure of d-threonine aldolase from alcaligenes xylosoxidans 0.9091 4 360
7dib-assembly1.cif.gz_A crystal structure of d-threonine aldolase from filomicrobium marinum 0.9083 9 359
ID Description Score Start End Superfamily
4v15B02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9164 21 240 3.20.20.10
4v15B02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9007 21 240 3.20.20.10
3wqcB02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.8888 21 240 3.20.20.10
4v15B01 Mainly Beta;Beta Barrel;Lyase, Ornithine Decarboxylase; Chain A, domain 1;D-serine dehydratase-like domain 0.8852 243 360 2.40.37.20
3awoA01 Mainly Beta;Beta Barrel;Lyase, Ornithine Decarboxylase; Chain A, domain 1;D-serine dehydratase-like domain 0.877 242 360 2.40.37.20
ID Description Score Start End GO Terms
AF-A0A2V6FF74-F1-model_v4 Threonine aldolase 0.9906 10 358 GO:0008721
GO:0036088
AF-A0A3N7HB83-F1-model_v4 D-TA family PLP-dependent enzyme 0.9865 1 159 GO:0008721
GO:0036088
AF-A0A5M6DBG1-F1-model_v4 D-TA family PLP-dependent enzyme 0.9857 7 363 GO:0008721
GO:0036088
AF-A0A3M1ML19-F1-model_v4 D-TA family PLP-dependent enzyme 0.9855 6 102 GO:0008721
GO:0036088
AF-A0A2P8GGR8-F1-model_v4 D-serine deaminase-like pyridoxal phosphate-dependent protein 0.9847 1 361 GO:0008721
GO:0036088

Feature Viewer

pLDDT pTM Quality
93.98 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map