F337200

General Info

Members Datasets Scaffolds Average Seq Length
224 161 220 292

Family's Representative Sequence

Representative Sequence 3300049823|Ga0501044_0378955|Ga0501044_0378955_113_1093
Length 326
Sequence MDAVAPLCVSCDPAIPLATRRAAGQDHSQTGVPMAYNTLSSQIDGGIATLTLNRPDKMNAFTVEMANELVDYFTRAGSDDAIRAIVVTGAGKAFCAGMDLSIGGNVFGLDEKQRPTLDDMTRRLDDPAILKGVRDTGGRVALSIFNCTKPVIAAISGAAVGIGATMTLPMDFRLASEKARIGFVFGKIGIVPEACSSWFLPRIVGISQALEWTYSAEILDAETALRGGLLKAVVPPDQLLNEAHALARRITEHRSPVAVALTRQMMYRNAAQPHPLEAHRIDSLAMFYASLGDGKEGVQSFLDKRAPQFKSEVPKDLPPFYKDWAK

Samples

Sample ID Description Type Environment
1 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
2 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
3 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
4 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
51 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
83 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
84 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
85 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
86 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
87 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
88 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
89 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
90 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
91 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
92 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
93 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
94 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
100 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
101 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
102 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
103 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
104 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
105 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
106 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
107 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
108 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
109 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
110 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
111 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
112 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
113 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
114 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
115 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
116 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
117 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
118 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
119 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
120 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
121 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
122 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
123 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
124 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
125 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
126 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
127 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
128 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
129 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
130 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
131 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
132 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
133 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
134 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
135 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
136 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
137 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
140 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
141 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
142 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
143 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
144 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
145 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
146 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
147 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
148 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
149 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
150 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
151 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
152 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
153 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
154 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
156 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
157 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
158 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
159 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
160 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
161 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.21
Metatranscriptomes 0
Isolates 1.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.79
Nodule 0
Rhizoplane 9.82
Rhizosphere 79.02
Stem 0
Stem Tuber 0
Unclassified 9.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10218721 3300003320 Bacteria 1609
2 Ga0065707_10082203 3300005295 Bacteria 19236
3 Ga0070676_10001154 3300005328 Bacteria 13192
4 Ga0070666_10011531 3300005335 Bacteria 5550
5 Ga0070666_10016929 3300005335 Bacteria 4667
6 Ga0070668_100000138 3300005347 Bacteria 45978
7 Ga0070668_100043871 3300005347 Bacteria 3429
8 Ga0070669_100125689 3300005353 Bacteria 1962
9 Ga0070671_100006561 3300005355 Bacteria 9302
10 Ga0070671_100008684 3300005355 Bacteria 8152
11 Ga0070674_100059171 3300005356 Bacteria 2666
12 Ga0070667_100000146 3300005367 Bacteria 88847
13 Ga0070667_100017872 3300005367 Bacteria 5878
14 Ga0070709_10039792 3300005434 Bacteria 2887
15 Ga0070710_10005557 3300005437 Bacteria 6001
16 Ga0070700_100032063 3300005441 Bacteria 3155
17 Ga0070678_100080210 3300005456 Bacteria 2471
18 Ga0068867_100003668 3300005459 Bacteria 10804
19 Ga0070707_100086481 3300005468 Bacteria 3032
20 Ga0070698_100008777 3300005471 Bacteria 10878
21 Ga0070672_100057277 3300005543 Bacteria 3058
22 Ga0070665_100000915 3300005548 Bacteria 37838
23 Ga0070665_100018686 3300005548 Bacteria 6949
24 Ga0068855_100066700 3300005563 Bacteria 4196
25 Ga0068856_100015343 3300005614 Bacteria 7404
26 Ga0068859_100000635 3300005617 Bacteria 35152
27 Ga0068859_100076114 3300005617 Bacteria 3397
28 Ga0068859_100079352 3300005617 Bacteria 3322
29 Ga0068864_100000137 3300005618 Bacteria 70702
30 Ga0068863_100000165 3300005841 Bacteria 71079
31 Ga0068863_100164404 3300005841 Bacteria 2127
32 Ga0068858_100003996 3300005842 Bacteria 14552
33 Ga0068858_100047773 3300005842 Bacteria 3967
34 Ga0068858_100060202 3300005842 Bacteria 3510
35 Ga0068860_100006101 3300005843 Bacteria 12127
36 Ga0068860_100012167 3300005843 Bacteria 8476
37 Ga0068860_100347325 3300005843 Bacteria 1459
38 Ga0068862_100000129 3300005844 Bacteria 88141
39 Ga0068862_100297069 3300005844 Bacteria 1485
40 Ga0070715_10002552 3300006163 Bacteria 5610
41 Ga0070712_100003633 3300006175 Bacteria 9513
42 Ga0068865_100013227 3300006881 Bacteria 5210
43 Ga0097620_100000635 3300006931 Bacteria 35152
44 Ga0097620_100076118 3300006931 Bacteria 3397
45 Ga0097620_100079354 3300006931 Bacteria 3322
46 Ga0105250_10007061 3300009092 Bacteria 4850
47 Ga0111539_10482404 3300009094 Bacteria 1444
48 Ga0105247_10000254 3300009101 Bacteria 49729
49 Ga0105247_10122582 3300009101 Bacteria 1686
50 Ga0105243_10226847 3300009148 Bacteria 1655
51 Ga0105242_10037506 3300009176 Bacteria 3893
52 Ga0105248_10001490 3300009177 Bacteria 26065
53 Ga0105248_10008877 3300009177 Bacteria 11047
54 Ga0105248_10015301 3300009177 Bacteria 8458
55 Ga0105248_10076066 3300009177 Bacteria 3773
56 Ga0105249_10000337 3300009553 Bacteria 47466
57 Ga0105239_10028559 3300010375 Bacteria 6133
58 Ga0157374_10341286 3300013296 Bacteria 1487
59 Ga0163162_10319397 3300013306 Bacteria 1685
60 Ga0163162_10356035 3300013306 Unclassified 1596
61 Ga0157375_10294333 3300013308 Bacteria 1786
62 Ga0163163_10008511 3300014325 Bacteria 9117
63 Ga0163163_10286464 3300014325 Bacteria 1699
64 Ga0157380_10000025 3300014326 Bacteria 107388
65 Ga0157380_10005302 3300014326 Bacteria 9009
66 Ga0157380_10059060 3300014326 Bacteria 3059
67 Ga0157380_10147261 3300014326 Bacteria 2031
68 Ga0182008_10028778 3300014497 Bacteria 2810
69 Ga0157379_10004358 3300014968 Bacteria 12106
70 Ga0157379_10008470 3300014968 Bacteria 8946
71 Ga0157379_10039795 3300014968 Bacteria 4195
72 Ga0213876_10000221 3300021384 Bacteria 56997
73 Ga0207710_10062983 3300025900 Bacteria 1686
74 Ga0207699_10088382 3300025906 Bacteria 1939
75 Ga0207645_10003134 3300025907 Bacteria 12682
76 Ga0207693_10000279 3300025915 Bacteria 47471
77 Ga0207663_10036614 3300025916 Bacteria 2953
78 Ga0207646_10079177 3300025922 Bacteria 2938
79 Ga0207681_10035557 3300025923 Bacteria 3283
80 Ga0207681_10080518 3300025923 Bacteria 2297
81 Ga0207650_10000064 3300025925 Bacteria 142969
82 Ga0207700_10037017 3300025928 Bacteria 3530
83 Ga0207664_10412328 3300025929 Bacteria 1202
84 Ga0207644_10022505 3300025931 Bacteria 4306
85 Ga0207706_10231310 3300025933 Bacteria 1617
86 Ga0207686_10183501 3300025934 Unclassified 1485
87 Ga0207665_10001877 3300025939 Bacteria 14160
88 Ga0207691_10218005 3300025940 Bacteria 1655
89 Ga0207711_10001078 3300025941 Bacteria 26059
90 Ga0207711_10016284 3300025941 Bacteria 6175
91 Ga0207711_10061195 3300025941 Bacteria 3246
92 Ga0207711_10130618 3300025941 Bacteria 2252
93 Ga0207712_10001014 3300025961 Bacteria 19999
94 Ga0207712_10007509 3300025961 Bacteria 6883
95 Ga0207668_10000595 3300025972 Bacteria 22503
96 Ga0207668_10011851 3300025972 Bacteria 5315
97 Ga0207668_10166364 3300025972 Bacteria 1724
98 Ga0207658_10003467 3300025986 Bacteria 11150
99 Ga0207658_10040582 3300025986 Bacteria 3365
100 Ga0207658_10117661 3300025986 Bacteria 2112
101 Ga0207703_10004051 3300026035 Bacteria 12102
102 Ga0207703_10026296 3300026035 Bacteria 4579
103 Ga0207703_10046614 3300026035 Bacteria 3491
104 Ga0207703_10060761 3300026035 Bacteria 3091
105 Ga0207639_10358271 3300026041 Unclassified 1305
106 Ga0207708_10041725 3300026075 Bacteria 3497
107 Ga0207702_10244761 3300026078 Unclassified 1682
108 Ga0207641_10003122 3300026088 Bacteria 14896
109 Ga0207641_10016800 3300026088 Bacteria 5992
110 Ga0207648_10000682 3300026089 Bacteria 37982
111 Ga0207648_10032265 3300026089 Bacteria 4625
112 Ga0207676_10000302 3300026095 Bacteria 42408
113 Ga0207675_100004106 3300026118 Bacteria 14092
114 Ga0207675_100043710 3300026118 Bacteria 4185
115 Ga0207683_10001002 3300026121 Bacteria 25841
116 Ga0268266_10003199 3300028379 Bacteria 16571
117 Ga0268266_10349227 3300028379 Bacteria 1390
118 Ga0268266_10407591 3300028379 Unclassified 1286
119 Ga0268265_10000677 3300028380 Bacteria 33608
120 Ga0268264_10000118 3300028381 Bacteria 193487
121 Ga0268264_10004107 3300028381 Bacteria 12455
122 Ga0265334_10000087 3300028573 Bacteria 66703
123 Ga0307511_10005353 3300030521 Bacteria 13058
124 Ga0265332_10000014 3300031238 Bacteria 249035
125 Ga0265328_10009528 3300031239 Bacteria 3951
126 Ga0265328_10011444 3300031239 Bacteria 3543
127 Ga0265331_10041147 3300031250 Bacteria 2246
128 Ga0265327_10000027 3300031251 Bacteria 364541
129 Ga0265327_10000174 3300031251 Bacteria 138922
130 Ga0265316_10000349 3300031344 Bacteria 51876
131 Ga0307509_10000048 3300031507 Bacteria 167101
132 Ga0307509_10001585 3300031507 Bacteria 38258
133 Ga0373936_0008851 3300035113 Unclassified 3794
134 Ga0373956_0051944 3300035119 Bacteria 1843
135 Ga0373927_0054526 3300035695 Bacteria 2586
136 Ga0373947_0058044 3300035725 Bacteria 2344
137 Ga0373937_0010405 3300036401 Bacteria 8124
138 Ga0373925_0217862 3300037068 Bacteria 1523
139 Ga0395905_0001436 3300037471 Bacteria 28673
140 Ga0436364_1188536 3300037853 Bacteria 1718
141 Ga0395901_0158739 3300038443 Bacteria 2375
142 Ga0436365_1543423 3300039437 Bacteria 31863
143 Ga0451797_0278012 3300041453 Bacteria 1011
144 Ga0451576_0254819 3300045051 Bacteria 1834
145 Ga0495638_0006693 3300046460 Bacteria 8351
146 Ga0495638_0171147 3300046460 Bacteria 1246
147 Ga0495580_0014699 3300046472 Bacteria 5932
148 Ga0495606_0000845 3300046507 Bacteria 46095
149 Ga0495643_0086035 3300046522 Bacteria 1629
150 Ga0495586_0198369 3300046535 Bacteria 1137
151 Ga0495625_0002371 3300046660 Bacteria 20511
152 Ga0495671_0001388 3300046692 Bacteria 16355
153 Ga0495649_0001682 3300046694 Bacteria 16405
154 Ga0495649_0018918 3300046694 Bacteria 3869
155 Ga0495672_0035808 3300047320 Bacteria 3054
156 Ga0495681_0007615 3300047470 Bacteria 6889
157 Ga0496100_0157881 3300048903 Unclassified 1623
158 Ga0496101_0028503 3300048904 Bacteria 3898
159 Ga0496102_0001969 3300048905 Bacteria 17723
160 Ga0496102_0071019 3300048905 Bacteria 3197
161 Ga0496102_0158654 3300048905 Bacteria 2127
162 Ga0496103_0012850 3300048906 Bacteria 4967
163 Ga0496103_0050831 3300048906 Bacteria 2565
164 Ga0496105_0070153 3300048908 Bacteria 2896
165 Ga0496107_0050783 3300048910 Bacteria 2990
166 Ga0496108_0068833 3300048911 Unclassified 2986
167 Ga0496109_0007737 3300048912 Bacteria 9099
168 Ga0496109_0017825 3300048912 Bacteria 6229
169 Ga0496109_0066288 3300048912 Bacteria 3306
170 Ga0496110_0052785 3300048913 Bacteria 3572
171 Ga0496110_0058918 3300048913 Bacteria 3383
172 Ga0496110_0071960 3300048913 Bacteria 3067
173 Ga0496111_0334817 3300048914 Bacteria 1120
174 Ga0496112_0154245 3300048915 Bacteria 2264
175 Ga0496112_0300734 3300048915 Bacteria 1550
176 Ga0496114_0008309 3300048917 Bacteria 8224
177 Ga0496115_0093514 3300048918 Bacteria 2458
178 Ga0496118_0071667 3300048921 Bacteria 2493
179 Ga0496119_0001037 3300048922 Bacteria 35545
180 Ga0496119_0016724 3300048922 Bacteria 5561
181 Ga0496120_0000843 3300048923 Bacteria 43594
182 Ga0496121_0000058 3300048924 Bacteria 281335
183 Ga0496121_0001029 3300048924 Bacteria 49692
184 Ga0496121_0251601 3300048924 Bacteria 1225
185 Ga0496124_0009135 3300048927 Bacteria 10240
186 Ga0496125_0023296 3300048928 Bacteria 5718
187 Ga0496126_0000952 3300048929 Bacteria 49599
188 Ga0495682_0057299 3300049460 Bacteria 1411
189 Ga0501290_000123 3300049513 Bacteria 11816
190 Ga0501292_000006 3300049515 Bacteria 90286
191 Ga0501298_016407 3300049521 Bacteria 1342
192 Ga0501300_000185 3300049523 Bacteria 9444
193 Ga0501040_0108503 3300049576 Bacteria 1941
194 Ga0501047_0115523 3300049581 Bacteria 2566
195 Ga0501047_0239370 3300049581 Bacteria 1666
196 Ga0501223_000023 3300049663 Bacteria 64396
197 Ga0501223_002415 3300049663 Bacteria 4157
198 Ga0501224_000001 3300049664 Bacteria 308131
199 Ga0501233_000014 3300049668 Bacteria 27843
200 Ga0501233_002690 3300049668 Bacteria 3150
201 Ga0501235_000582 3300049669 Bacteria 7355
202 Ga0501249_021640 3300049679 Bacteria 1404
203 Ga0501259_000251 3300049688 Bacteria 8442
204 Ga0501261_000001 3300049690 Bacteria 126537
205 Ga0501221_001335 3300049704 Bacteria 4054
206 Ga0501225_0000012 3300049705 Bacteria 73262
207 Ga0501245_002985 3300049708 Bacteria 2282
208 Ga0501264_001644 3300049761 Bacteria 2313
209 Ga0501279_000006 3300049775 Bacteria 152264
210 Ga0501280_000087 3300049776 Bacteria 24626
211 Ga0501282_000076 3300049778 Bacteria 11743
212 Ga0501283_000533 3300049779 Bacteria 4997
213 Ga0501044_0378955 3300049823 Bacteria 1330
214 Ga0501226_000050 3300049853 Bacteria 51521
215 nmdc:mga0qj67_45620_c1 3300050509 Bacteria 3458
216 nmdc:mga06r32_157259_c1 3300050510 Bacteria 2254
217 Ga0500564_013021 3300053138 Bacteria 3714
218 Ga0500568_0078740 3300053139 Bacteria 1253
219 Ga0500639_099817 3300053163 Unclassified 1431
220 Ga0500637_0027975 3300053178 Unclassified 3115

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025939 Ga0207665_10001877 Ga0207665_100018772 267
2 3300014326 Ga0157380_10147261 Ga0157380_101472611 271
3 3300025923 Ga0207681_10035557 Ga0207681_100355573 271
4 3300041453 Ga0451797_0278012 Ga0451797_0278012_92_991 271
5 3300049515 Ga0501292_000006 Ga0501292_000006_12788_13657 274
6 3300049668 Ga0501233_002690 Ga0501233_002690_424_1293 274
7 3300049761 Ga0501264_001644 Ga0501264_001644_523_1392 274
8 3300049775 Ga0501279_000006 Ga0501279_000006_91375_92244 274
9 3300028379 Ga0268266_10349227 Ga0268266_103492272 279
10 3300049513 Ga0501290_000123 Ga0501290_000123_8605_9474 280
11 3300049523 Ga0501300_000185 Ga0501300_000185_4409_5278 280
12 3300049581 Ga0501047_0115523 Ga0501047_0115523_35_904 280
13 3300049663 Ga0501223_002415 Ga0501223_002415_1850_2719 280
14 3300049669 Ga0501235_000582 Ga0501235_000582_6402_7271 280
15 3300049688 Ga0501259_000251 Ga0501259_000251_1042_1911 280
16 3300049690 Ga0501261_000001 Ga0501261_000001_65704_66573 280
17 3300049704 Ga0501221_001335 Ga0501221_001335_3130_3999 280
18 3300049708 Ga0501245_002985 Ga0501245_002985_941_1810 280
19 3300049776 Ga0501280_000087 Ga0501280_000087_10870_11739 280
20 3300049778 Ga0501282_000076 Ga0501282_000076_9590_10459 280
21 3300046460 Ga0495638_0171147 Ga0495638_0171147_388_1236 282
22 3300049779 Ga0501283_000533 Ga0501283_000533_2171_3040 282
23 3300031250 Ga0265331_10041147 Ga0265331_100411472 283
24 3300031251 Ga0265327_10000027 Ga0265327_10000027129 283
25 3300009148 Ga0105243_10226847 Ga0105243_102268472 284
26 3300009176 Ga0105242_10037506 Ga0105242_100375061 284
27 3300009177 Ga0105248_10076066 Ga0105248_100760661 284
28 3300010375 Ga0105239_10028559 Ga0105239_100285596 284
29 3300013296 Ga0157374_10341286 Ga0157374_103412862 284
30 3300013306 Ga0163162_10319397 Ga0163162_103193972 284
31 3300013306 Ga0163162_10356035 Ga0163162_103560351 284
32 3300013308 Ga0157375_10294333 Ga0157375_102943332 284
33 3300014968 Ga0157379_10039795 Ga0157379_100397953 284
34 3300035119 Ga0373956_0051944 Ga0373956_0051944_579_1436 284
35 3300035725 Ga0373947_0058044 Ga0373947_0058044_1328_2185 284
36 3300036401 Ga0373937_0010405 Ga0373937_0010405_5859_6716 284
37 3300046472 Ga0495580_0014699 Ga0495580_0014699_1353_2210 284
38 3300046535 Ga0495586_0198369 Ga0495586_0198369_210_1067 284
39 3300048903 Ga0496100_0157881 Ga0496100_0157881_381_1238 284
40 3300048904 Ga0496101_0028503 Ga0496101_0028503_208_1065 284
41 3300048905 Ga0496102_0158654 Ga0496102_0158654_77_934 284
42 3300048908 Ga0496105_0070153 Ga0496105_0070153_1095_1952 284
43 3300048910 Ga0496107_0050783 Ga0496107_0050783_1805_2662 284
44 3300048911 Ga0496108_0068833 Ga0496108_0068833_838_1695 284
45 3300048912 Ga0496109_0017825 Ga0496109_0017825_1413_2270 284
46 3300048913 Ga0496110_0052785 Ga0496110_0052785_2427_3284 284
47 3300048914 Ga0496111_0334817 Ga0496111_0334817_136_993 284
48 3300048915 Ga0496112_0154245 Ga0496112_0154245_191_1048 284
49 3300048917 Ga0496114_0008309 Ga0496114_0008309_2922_3779 284
50 3300048918 Ga0496115_0093514 Ga0496115_0093514_1395_2252 284
51 iso_pu_bacteria 2738543020 2739286133 286
52 iso_pu_bacteria 2738543021 2739291446 286
53 3300048905 Ga0496102_0001969 Ga0496102_0001969_9834_10700 287
54 3300048906 Ga0496103_0012850 Ga0496103_0012850_70_936 287
55 iso_pu_bacteria 2895880812 2895885751 288
56 3300005347 Ga0070668_100043871 Ga0070668_1000438712 289
57 3300025972 Ga0207668_10011851 Ga0207668_100118512 289
58 3300049576 Ga0501040_0108503 Ga0501040_0108503_759_1634 289
59 3300053139 Ga0500568_0078740 Ga0500568_0078740_173_1135 289
60 3300021384 Ga0213876_10000221 Ga0213876_100002218 290
61 3300031238 Ga0265332_10000014 Ga0265332_10000014137 290
62 3300035695 Ga0373927_0054526 Ga0373927_0054526_124_999 290
63 3300037853 Ga0436364_1188536 Ga0436364_1188536_378_1250 290
64 3300038443 Ga0395901_0158739 Ga0395901_0158739_1341_2225 290
65 3300039437 Ga0436365_1543423 Ga0436365_1543423_5857_6738 290
66 3300046507 Ga0495606_0000845 Ga0495606_0000845_44216_45091 290
67 3300046692 Ga0495671_0001388 Ga0495671_0001388_10843_11718 290
68 3300046694 Ga0495649_0001682 Ga0495649_0001682_14535_15410 290
69 3300046694 Ga0495649_0018918 Ga0495649_0018918_341_1216 290
70 3300047470 Ga0495681_0007615 Ga0495681_0007615_1093_1968 290
71 3300049663 Ga0501223_000023 Ga0501223_000023_29516_30388 290
72 3300049664 Ga0501224_000001 Ga0501224_000001_111961_112833 290
73 3300049668 Ga0501233_000014 Ga0501233_000014_17227_18099 290
74 3300049705 Ga0501225_0000012 Ga0501225_0000012_5384_6256 290
75 3300049853 Ga0501226_000050 Ga0501226_000050_29329_30201 290
76 3300005295 Ga0065707_10082203 Ga0065707_1008220321 291
77 3300005468 Ga0070707_100086481 Ga0070707_1000864812 291
78 3300005471 Ga0070698_100008777 Ga0070698_1000087772 291
79 3300014326 Ga0157380_10000025 Ga0157380_10000025107 291
80 3300014326 Ga0157380_10005302 Ga0157380_100053027 291
81 3300014497 Ga0182008_10028778 Ga0182008_100287782 291
82 3300025922 Ga0207646_10079177 Ga0207646_100791773 291
83 3300026118 Ga0207675_100043710 Ga0207675_1000437102 291
84 3300030521 Ga0307511_10005353 Ga0307511_100053535 291
85 3300031239 Ga0265328_10009528 Ga0265328_100095284 291
86 3300031239 Ga0265328_10011444 Ga0265328_100114443 291
87 3300031251 Ga0265327_10000174 Ga0265327_10000174103 291
88 3300031344 Ga0265316_10000349 Ga0265316_1000034913 291
89 3300031507 Ga0307509_10000048 Ga0307509_10000048109 291
90 3300031507 Ga0307509_10001585 Ga0307509_1000158516 291
91 3300035113 Ga0373936_0008851 Ga0373936_0008851_2117_2992 291
92 3300037471 Ga0395905_0001436 Ga0395905_0001436_4355_5233 291
93 3300046460 Ga0495638_0006693 Ga0495638_0006693_3713_4588 291
94 3300046522 Ga0495643_0086035 Ga0495643_0086035_508_1383 291
95 3300046660 Ga0495625_0002371 Ga0495625_0002371_13335_14210 291
96 3300048912 Ga0496109_0007737 Ga0496109_0007737_2100_2978 291
97 3300048913 Ga0496110_0058918 Ga0496110_0058918_879_1754 291
98 3300048913 Ga0496110_0071960 Ga0496110_0071960_699_1577 291
99 3300048924 Ga0496121_0251601 Ga0496121_0251601_16_891 291
100 3300048929 Ga0496126_0000952 Ga0496126_0000952_46751_47626 291
101 3300049460 Ga0495682_0057299 Ga0495682_0057299_429_1304 291
102 3300050509 nmdc:mga0qj67_45620_c1 nmdc:mga0qj67_45620_c1_1767_2642 291
103 3300050510 nmdc:mga06r32_157259_c1 nmdc:mga06r32_157259_c1_780_1655 291
104 3300053163 Ga0500639_099817 Ga0500639_099817_268_1143 291
105 3300053178 Ga0500637_0027975 Ga0500637_0027975_1909_2784 291
106 3300005617 Ga0068859_100079352 Ga0068859_1000793522 292
107 3300005844 Ga0068862_100297069 Ga0068862_1002970693 292
108 3300006931 Ga0097620_100079354 Ga0097620_1000793542 292
109 3300009177 Ga0105248_10001490 Ga0105248_1000149022 292
110 3300025941 Ga0207711_10001078 Ga0207711_100010786 292
111 3300025972 Ga0207668_10166364 Ga0207668_101663642 292
112 3300028573 Ga0265334_10000087 Ga0265334_100000877 292
113 3300048906 Ga0496103_0050831 Ga0496103_0050831_634_1515 292
114 3300048921 Ga0496118_0071667 Ga0496118_0071667_786_1667 292
115 3300048922 Ga0496119_0016724 Ga0496119_0016724_2386_3267 292
116 3300048924 Ga0496121_0000058 Ga0496121_0000058_246367_247248 292
117 3300049823 Ga0501044_0378955 Ga0501044_0378955_113_1093 292
118 3300053138 Ga0500564_013021 Ga0500564_013021_2474_3370 292
119 iso_pu_bacteria 2990196909 2990198760 292
120 3300005355 Ga0070671_100006561 Ga0070671_1000065616 293
121 3300005434 Ga0070709_10039792 Ga0070709_100397921 293
122 3300005437 Ga0070710_10005557 Ga0070710_100055575 293
123 3300005456 Ga0070678_100080210 Ga0070678_1000802103 293
124 3300005563 Ga0068855_100066700 Ga0068855_1000667003 293
125 3300005614 Ga0068856_100015343 Ga0068856_1000153435 293
126 3300005841 Ga0068863_100164404 Ga0068863_1001644043 293
127 3300005843 Ga0068860_100347325 Ga0068860_1003473252 293
128 3300006163 Ga0070715_10002552 Ga0070715_100025523 293
129 3300006175 Ga0070712_100003633 Ga0070712_1000036337 293
130 3300006881 Ga0068865_100013227 Ga0068865_1000132272 293
131 3300025906 Ga0207699_10088382 Ga0207699_100883821 293
132 3300025915 Ga0207693_10000279 Ga0207693_100002797 293
133 3300025916 Ga0207663_10036614 Ga0207663_100366141 293
134 3300025928 Ga0207700_10037017 Ga0207700_100370173 293
135 3300025934 Ga0207686_10183501 Ga0207686_101835012 293
136 3300025941 Ga0207711_10061195 Ga0207711_100611953 293
137 3300025986 Ga0207658_10040582 Ga0207658_100405823 293
138 3300026035 Ga0207703_10060761 Ga0207703_100607613 293
139 3300026041 Ga0207639_10358271 Ga0207639_103582711 293
140 3300026078 Ga0207702_10244761 Ga0207702_102447612 293
141 3300026089 Ga0207648_10032265 Ga0207648_100322654 293
142 3300026121 Ga0207683_10001002 Ga0207683_100010026 293
143 3300028379 Ga0268266_10407591 Ga0268266_104075911 293
144 3300005335 Ga0070666_10011531 Ga0070666_100115311 294
145 3300005347 Ga0070668_100000138 Ga0070668_10000013822 294
146 3300005353 Ga0070669_100125689 Ga0070669_1001256892 294
147 3300005367 Ga0070667_100000146 Ga0070667_10000014682 294
148 3300005548 Ga0070665_100000915 Ga0070665_10000091520 294
149 3300005617 Ga0068859_100076114 Ga0068859_1000761144 294
150 3300005618 Ga0068864_100000137 Ga0068864_10000013730 294
151 3300005841 Ga0068863_100000165 Ga0068863_10000016548 294
152 3300005842 Ga0068858_100003996 Ga0068858_1000039967 294
153 3300005842 Ga0068858_100060202 Ga0068858_1000602022 294
154 3300005843 Ga0068860_100006101 Ga0068860_1000061014 294
155 3300005844 Ga0068862_100000129 Ga0068862_10000012916 294
156 3300006931 Ga0097620_100076118 Ga0097620_1000761184 294
157 3300009101 Ga0105247_10122582 Ga0105247_101225822 294
158 3300009177 Ga0105248_10008877 Ga0105248_100088777 294
159 3300009553 Ga0105249_10000337 Ga0105249_1000033724 294
160 3300014325 Ga0163163_10286464 Ga0163163_102864642 294
161 3300014968 Ga0157379_10008470 Ga0157379_100084704 294
162 3300025900 Ga0207710_10062983 Ga0207710_100629832 294
163 3300025925 Ga0207650_10000064 Ga0207650_1000006462 294
164 3300025929 Ga0207664_10412328 Ga0207664_104123281 294
165 3300025941 Ga0207711_10130618 Ga0207711_101306181 294
166 3300025961 Ga0207712_10001014 Ga0207712_1000101412 294
167 3300025972 Ga0207668_10000595 Ga0207668_100005951 294
168 3300025986 Ga0207658_10003467 Ga0207658_100034671 294
169 3300026035 Ga0207703_10004051 Ga0207703_100040518 294
170 3300026035 Ga0207703_10046614 Ga0207703_100466142 294
171 3300026088 Ga0207641_10003122 Ga0207641_100031227 294
172 3300026095 Ga0207676_10000302 Ga0207676_1000030233 294
173 3300028379 Ga0268266_10003199 Ga0268266_100031994 294
174 3300028380 Ga0268265_10000677 Ga0268265_1000067714 294
175 3300028381 Ga0268264_10000118 Ga0268264_100001187 294
176 3300037068 Ga0373925_0217862 Ga0373925_0217862_193_1080 294
177 3300045051 Ga0451576_0254819 Ga0451576_0254819_343_1230 294
178 3300048905 Ga0496102_0071019 Ga0496102_0071019_297_1184 294
179 3300003320 rootH2_10218721 rootH2_102187212 296
180 3300005328 Ga0070676_10001154 Ga0070676_100011542 296
181 3300005335 Ga0070666_10016929 Ga0070666_100169294 296
182 3300005355 Ga0070671_100008684 Ga0070671_1000086846 296
183 3300005356 Ga0070674_100059171 Ga0070674_1000591711 296
184 3300005367 Ga0070667_100017872 Ga0070667_1000178725 296
185 3300005441 Ga0070700_100032063 Ga0070700_1000320632 296
186 3300005459 Ga0068867_100003668 Ga0068867_1000036689 296
187 3300005543 Ga0070672_100057277 Ga0070672_1000572773 296
188 3300005548 Ga0070665_100018686 Ga0070665_1000186866 296
189 3300005617 Ga0068859_100000635 Ga0068859_10000063533 296
190 3300005842 Ga0068858_100047773 Ga0068858_1000477737 296
191 3300005843 Ga0068860_100012167 Ga0068860_1000121675 296
192 3300006931 Ga0097620_100000635 Ga0097620_1000006356 296
193 3300009092 Ga0105250_10007061 Ga0105250_100070613 296
194 3300009094 Ga0111539_10482404 Ga0111539_104824042 296
195 3300009101 Ga0105247_10000254 Ga0105247_1000025446 296
196 3300009177 Ga0105248_10015301 Ga0105248_100153019 296
197 3300014325 Ga0163163_10008511 Ga0163163_100085118 296
198 3300014326 Ga0157380_10059060 Ga0157380_100590602 296
199 3300014968 Ga0157379_10004358 Ga0157379_100043585 296
200 3300025907 Ga0207645_10003134 Ga0207645_100031342 296
201 3300025923 Ga0207681_10080518 Ga0207681_100805182 296
202 3300025931 Ga0207644_10022505 Ga0207644_100225052 296
203 3300025933 Ga0207706_10231310 Ga0207706_102313101 296
204 3300025940 Ga0207691_10218005 Ga0207691_102180052 296
205 3300025941 Ga0207711_10016284 Ga0207711_100162841 296
206 3300025961 Ga0207712_10007509 Ga0207712_100075095 296
207 3300025986 Ga0207658_10117661 Ga0207658_101176613 296
208 3300026035 Ga0207703_10026296 Ga0207703_100262962 296
209 3300026075 Ga0207708_10041725 Ga0207708_100417252 296
210 3300026088 Ga0207641_10016800 Ga0207641_100168002 296
211 3300026089 Ga0207648_10000682 Ga0207648_1000068220 296
212 3300026118 Ga0207675_100004106 Ga0207675_1000041061 296
213 3300028381 Ga0268264_10004107 Ga0268264_100041078 296
214 3300047320 Ga0495672_0035808 Ga0495672_0035808_1870_2790 296
215 3300048912 Ga0496109_0066288 Ga0496109_0066288_241_1140 296
216 3300048915 Ga0496112_0300734 Ga0496112_0300734_338_1228 296
217 3300048922 Ga0496119_0001037 Ga0496119_0001037_773_1663 296
218 3300048923 Ga0496120_0000843 Ga0496120_0000843_34641_35531 296
219 3300048924 Ga0496121_0001029 Ga0496121_0001029_6454_7344 296
220 3300048927 Ga0496124_0009135 Ga0496124_0009135_8708_9598 296
221 3300048928 Ga0496125_0023296 Ga0496125_0023296_4261_5151 296
222 3300049521 Ga0501298_016407 Ga0501298_016407_311_1225 296
223 3300049581 Ga0501047_0239370 Ga0501047_0239370_443_1345 296
224 3300049679 Ga0501249_021640 Ga0501249_021640_388_1302 296

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

47

299

0.83

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

42

312

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fdu-assembly2.cif.gz_F crystal structure of a putative enoyl-coa hydratase/isomerase from acinetobacter baumannii 0.9347 6 255
4lk5-assembly1.cif.gz_B crystal structure of a enoyl-coa hydratase from mycobacterium avium subsp. paratuberculosis k-10 0.9334 1 278
4lk5-assembly1.cif.gz_B crystal structure of a enoyl-coa hydratase from mycobacterium avium subsp. paratuberculosis k-10 0.926 1 278
3fdu-assembly2.cif.gz_F crystal structure of a putative enoyl-coa hydratase/isomerase from acinetobacter baumannii 0.9222 6 255
3qre-assembly1.cif.gz_A crystal structure of an enoyl-coa hydratase echa12_1 from mycobacterium marinum 0.9202 4 239
ID Description Score Start End Superfamily
3rsiB02 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1; 0.95 116 217 3.90.226.20
4lk5B01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9413 1 202 3.90.226.10
3fduF00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9347 6 255 3.90.226.10
3fduC01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9335 2 201 3.90.226.10
4lk5B01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.925 1 202 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A6I2J468-F1-model_v4 deleted 0.9602 124 209
AF-A0A0L8MY38-F1-model_v4 deleted 0.9533 116 216
AF-A0A7S3B998-F1-model_v4 Enoyl-CoA hydratase 0.9402 104 213 GO:0005739
GO:0006635
GO:0016836
AF-A0A839RZS7-F1-model_v4 Enoyl-CoA hydratase/carnithine racemase 0.9323 2 152 GO:0003824
GO:0006631
AF-A0A3C1KRZ3-F1-model_v4 Enoyl-CoA hydratase (EC 4.2.1.17) 0.9313 2 118 GO:0004165
GO:0004300
GO:0005777

Feature Viewer

pLDDT pTM Quality
92 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map