F337115

General Info

Members Datasets Scaffolds Average Seq Length
224 172 448 137

Family's Representative Sequence

Representative Sequence 3300048905|Ga0496102_0068188|Ga0496102_0068188_2746_3249
Length 167
Sequence MVGHWTTMSRMAARFRPQDVSENAGHTTGRTIVMKYLLLKHYRGGPTRAVEYPPMDQWTPQEVDAHIKYMNDFAARLEEAGEFVGGQALAPEGAFVRYDGEGRPPVTDGPFAETKDLIAGWMVIDVDSWDRAVELAGELSAAPGPGGTPLHEWLEVRPFLTAPPTIE

Samples

Sample ID Description Type Environment
1 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
59 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
60 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
86 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
87 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
88 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
89 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
90 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
91 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
92 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
95 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
96 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
97 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
98 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
99 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
100 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
101 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
105 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
106 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
107 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
108 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
109 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
110 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
111 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
112 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
113 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
114 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
115 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
116 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
117 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
118 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
119 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
120 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
121 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
122 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
123 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
124 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
125 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
126 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
127 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
128 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
129 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
130 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
131 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
132 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
133 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
134 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
135 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
136 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
137 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
138 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
139 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
140 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
141 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
142 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
143 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
144 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
145 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
146 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
147 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
150 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
151 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
152 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
153 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
154 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
155 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
156 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
157 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
158 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
159 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
160 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
164 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
165 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
166 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
167 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
168 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
169 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
170 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
171 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
172 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.32
Metatranscriptomes 2.23
Isolates 0.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.79
Nodule 0
Rhizoplane 8.48
Rhizosphere 83.04
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496102_0068188 3300048905 Bacteria 3264
2 Ga0070658_10161053 3300005327 Bacteria 1882
3 Ga0070683_100162702 3300005329 Bacteria 2117
4 Ga0070680_100082906 3300005336 Bacteria 2648
5 Ga0070682_100093416 3300005337 Bacteria 1972
6 Ga0070691_11061226 3300005341 Bacteria 508
7 Ga0070668_100372201 3300005347 Bacteria 1214
8 Ga0070674_100182724 3300005356 Bacteria 1608
9 Ga0070688_100200827 3300005365 Bacteria 1395
10 Ga0070659_100903856 3300005366 Bacteria 772
11 Ga0070714_100148032 3300005435 Bacteria 2113
12 Ga0070714_100507542 3300005435 Bacteria 1150
13 Ga0070714_100780222 3300005435 Bacteria 925
14 Ga0070714_101474021 3300005435 Bacteria 665
15 Ga0070713_100261418 3300005436 Bacteria 1582
16 Ga0070713_100313237 3300005436 Bacteria 1448
17 Ga0070713_100894576 3300005436 Bacteria 854
18 Ga0070710_10969563 3300005437 Bacteria 618
19 Ga0070678_100168991 3300005456 Bacteria 1779
20 Ga0070662_100769687 3300005457 Bacteria 817
21 Ga0070681_10139845 3300005458 Bacteria 2351
22 Ga0068867_100306153 3300005459 Bacteria 1312
23 Ga0068867_101193248 3300005459 Bacteria 699
24 Ga0070685_10096132 3300005466 Bacteria 1802
25 Ga0070679_100197555 3300005530 Bacteria 1978
26 Ga0070679_100804103 3300005530 Bacteria 883
27 Ga0070684_100040635 3300005535 Bacteria 4006
28 Ga0070665_100133173 3300005548 Bacteria 2487
29 Ga0070665_101304689 3300005548 Bacteria 736
30 Ga0068857_100104623 3300005577 Bacteria 2541
31 Ga0068852_100695271 3300005616 Bacteria 1027
32 Ga0068852_100782383 3300005616 Bacteria 968
33 Ga0068866_10165125 3300005718 Bacteria 1295
34 Ga0068861_100510221 3300005719 Bacteria 1089
35 Ga0068863_100001436 3300005841 Bacteria 23608
36 Ga0068863_101120910 3300005841 Bacteria 792
37 Ga0068858_100679961 3300005842 Bacteria 1001
38 Ga0068858_101346768 3300005842 Bacteria 703
39 Ga0068860_100576698 3300005843 Bacteria 1129
40 Ga0068862_100144716 3300005844 Bacteria 2112
41 Ga0081538_10046516 3300005981 Bacteria 2675
42 Ga0081538_10067984 3300005981 Bacteria 1984
43 Ga0081538_10071915 3300005981 Bacteria 1900
44 Ga0081538_10337519 3300005981 Bacteria 547
45 Ga0070717_10075349 3300006028 Bacteria 2822
46 Ga0075363_100005471 3300006048 Bacteria 5656
47 Ga0070716_100074393 3300006173 Bacteria 2007
48 Ga0075430_100340906 3300006846 Bacteria 1238
49 Ga0075431_100001557 3300006847 Bacteria 21285
50 Ga0075434_100866912 3300006871 Bacteria 918
51 Ga0068865_100768780 3300006881 Bacteria 829
52 Ga0068865_101266202 3300006881 Bacteria 655
53 Ga0075436_100460783 3300006914 Bacteria 926
54 Ga0105251_10011440 3300009011 Bacteria 5071
55 Ga0105247_10010495 3300009101 Bacteria 5599
56 Ga0105243_10766158 3300009148 Bacteria 948
57 Ga0105243_10784035 3300009148 Bacteria 938
58 Ga0105241_11605784 3300009174 Bacteria 629
59 Ga0105241_12174898 3300009174 Bacteria 550
60 Ga0105242_10372075 3300009176 Bacteria 1326
61 Ga0105248_10000111 3300009177 Bacteria 91627
62 Ga0105248_10029567 3300009177 Bacteria 6113
63 Ga0105248_10409241 3300009177 Bacteria 1527
64 Ga0105249_11169414 3300009553 Bacteria 840
65 Ga0105249_11333155 3300009553 Bacteria 789
66 Ga0105239_10389065 3300010375 Bacteria 1577
67 Ga0105239_13003145 3300010375 Bacteria 550
68 Ga0157370_10143866 3300013104 Bacteria 2221
69 Ga0157369_10056273 3300013105 Bacteria 4244
70 Ga0157369_10360629 3300013105 Bacteria 1509
71 Ga0163162_10115049 3300013306 Bacteria 2790
72 Ga0163162_10347357 3300013306 Bacteria 1616
73 Ga0157372_12670888 3300013307 Bacteria 573
74 Ga0157375_10311216 3300013308 Bacteria 1739
75 Ga0163163_10132242 3300014325 Bacteria 2535
76 Ga0163163_10981670 3300014325 Bacteria 908
77 Ga0163163_12244341 3300014325 Bacteria 605
78 Ga0157379_10076804 3300014968 Bacteria 2991
79 Ga0163161_10843295 3300017792 Bacteria 773
80 Ga0206350_10049470 3300020080 Bacteria 549
81 Ga0206354_11356117 3300020081 Bacteria 1734
82 Ga0206353_10105680 3300020082 Bacteria 3255
83 Ga0206353_11795632 3300020082 Bacteria 1479
84 Ga0213876_10265157 3300021384 Bacteria 913
85 Ga0213875_10060980 3300021388 Bacteria 1763
86 Ga0224712_10120766 3300022467 Bacteria 1135
87 Ga0207713_1030919 3300025735 Bacteria 2377
88 Ga0207710_10000504 3300025900 Bacteria 24301
89 Ga0207688_10408992 3300025901 Bacteria 842
90 Ga0207685_10471653 3300025905 Bacteria 656
91 Ga0207705_11092031 3300025909 Bacteria 615
92 Ga0207707_10235374 3300025912 Bacteria 1593
93 Ga0207693_10596706 3300025915 Bacteria 860
94 Ga0207660_10330512 3300025917 Bacteria 1219
95 Ga0207662_10883274 3300025918 Bacteria 632
96 Ga0207694_10574171 3300025924 Bacteria 947
97 Ga0207687_11003409 3300025927 Bacteria 716
98 Ga0207700_11472669 3300025928 Bacteria 604
99 Ga0207664_10089441 3300025929 Bacteria 2521
100 Ga0207664_10332897 3300025929 Bacteria 1341
101 Ga0207664_10612947 3300025929 Bacteria 978
102 Ga0207644_11772781 3300025931 Bacteria 517
103 Ga0207709_10312632 3300025935 Bacteria 1173
104 Ga0207711_10000605 3300025941 Bacteria 36233
105 Ga0207711_10017881 3300025941 Bacteria 5890
106 Ga0207711_10835025 3300025941 Bacteria 858
107 Ga0207661_10048385 3300025944 Bacteria 3379
108 Ga0207703_10298673 3300026035 Bacteria 1468
109 Ga0207641_10002854 3300026088 Bacteria 15701
110 Ga0207641_10967781 3300026088 Bacteria 847
111 Ga0207648_10279093 3300026089 Bacteria 1494
112 Ga0207648_10800859 3300026089 Bacteria 877
113 Ga0207674_10072621 3300026116 Bacteria 3456
114 Ga0207674_10791129 3300026116 Bacteria 915
115 Ga0207675_100072404 3300026118 Bacteria 3223
116 Ga0207683_10170267 3300026121 Bacteria 1972
117 Ga0207683_10332719 3300026121 Bacteria 1392
118 Ga0268266_10262158 3300028379 Bacteria 1602
119 Ga0268266_11081053 3300028379 Bacteria 776
120 Ga0268266_11612921 3300028379 Bacteria 624
121 Ga0265338_10001322 3300028800 Bacteria 40480
122 Ga0265338_10010206 3300028800 Bacteria 11068
123 Ga0307511_10000813 3300030521 Bacteria 33347
124 Ga0307408_100016971 3300031548 Bacteria 4868
125 Ga0307405_10043180 3300031731 Bacteria 2748
126 Ga0307518_10034999 3300031838 Bacteria 3646
127 Ga0307406_10675067 3300031901 Bacteria 860
128 Ga0307412_10074539 3300031911 Bacteria 2325
129 Ga0307409_100055381 3300031995 Bacteria 3061
130 Ga0307409_100440446 3300031995 Bacteria 1255
131 Ga0307416_101569021 3300032002 Bacteria 764
132 Ga0307414_10304990 3300032004 Bacteria 1349
133 Ga0307414_11603815 3300032004 Bacteria 606
134 Ga0307411_10444932 3300032005 Bacteria 1082
135 Ga0307415_100462705 3300032126 Bacteria 1099
136 Ga0373959_0119927 3300034820 Bacteria 642
137 Ga0373940_0050674 3300035088 Bacteria 1165
138 Ga0373939_0200912 3300035114 Bacteria 754
139 Ga0373942_0002181 3300035207 Bacteria 4817
140 Ga0373962_0098254 3300035242 Bacteria 910
141 Ga0395898_0450258 3300037466 Bacteria 1226
142 Ga0395905_0059535 3300037471 Bacteria 3570
143 Ga0436364_0303464 3300037853 Bacteria 6760
144 Ga0436364_1282647 3300037853 Bacteria 4179
145 Ga0395901_1329497 3300038443 Bacteria 679
146 Ga0439466_0009140 3300041411 Bacteria 3715
147 Ga0439465_0032407 3300041413 Bacteria 1668
148 Ga0451789_0957924 3300041443 Bacteria 1857
149 Ga0451793_0403416 3300041452 Bacteria 9394
150 Ga0451797_1519131 3300041453 Bacteria 2677
151 Ga0451806_528319 3300041462 Bacteria 854
152 Ga0451841_1030469 3300041498 Bacteria 2940
153 Ga0451841_1040796 3300041498 Bacteria 696
154 Ga0451843_1047599 3300041509 Bacteria 7640
155 Ga0451853_1913383 3300041512 Bacteria 1656
156 Ga0439431_0074528 3300041997 Bacteria 908
157 Ga0439443_037995 3300042003 Bacteria 815
158 Ga0439448_0014096 3300042005 Bacteria 2408
159 Ga0439450_021038 3300042008 Bacteria 1397
160 Ga0439451_030350 3300042009 Bacteria 1087
161 Ga0439456_043362 3300042013 Bacteria 978
162 Ga0450905_075479 3300042142 Bacteria 580
163 Ga0439464_0082144 3300042439 Bacteria 963
164 Ga0466963_0119946 3300044694 Bacteria 1809
165 Ga0466963_0975835 3300044694 Bacteria 597
166 Ga0466968_0554880 3300044735 Bacteria 577
167 Ga0466958_0146328 3300045836 Bacteria 1489
168 Ga0466958_0970456 3300045836 Bacteria 554
169 Ga0466967_0148914 3300045976 Bacteria 2186
170 Ga0466967_0738701 3300045976 Bacteria 976
171 Ga0466967_0794586 3300045976 Bacteria 939
172 Ga0495592_0228603 3300046454 Bacteria 1240
173 Ga0495641_0387452 3300046461 Bacteria 634
174 Ga0495651_0016287 3300046462 Bacteria 5756
175 Ga0495653_0614666 3300046463 Bacteria 667
176 Ga0495664_0781671 3300046477 Bacteria 562
177 Ga0495608_0417449 3300046511 Bacteria 819
178 Ga0495620_0100580 3300046515 Bacteria 1153
179 Ga0495628_0442877 3300046516 Bacteria 944
180 Ga0495652_0051435 3300046529 Bacteria 3518
181 Ga0495597_0223636 3300046542 Bacteria 747
182 Ga0495645_0228776 3300046543 Bacteria 1247
183 Ga0495667_0118847 3300046559 Bacteria 1707
184 Ga0495656_0487972 3300046615 Bacteria 652
185 Ga0495646_0451968 3300046680 Bacteria 663
186 Ga0495589_0479058 3300046794 Bacteria 569
187 Ga0495600_0313296 3300046809 Bacteria 988
188 Ga0495604_0032597 3300047317 Bacteria 4129
189 Ga0495636_0314370 3300047318 Bacteria 735
190 Ga0495674_0184558 3300047319 Bacteria 1736
191 Ga0496100_0248225 3300048903 Bacteria 1316
192 Ga0496100_0925699 3300048903 Bacteria 685
193 Ga0496102_1759073 3300048905 Bacteria 537
194 Ga0496103_0216014 3300048906 Bacteria 1233
195 Ga0496104_0409012 3300048907 Bacteria 1269
196 Ga0496104_1606039 3300048907 Bacteria 553
197 Ga0496105_0734744 3300048908 Bacteria 755
198 Ga0496106_0037530 3300048909 Bacteria 3625
199 Ga0496106_0692844 3300048909 Bacteria 812
200 Ga0496108_0132801 3300048911 Bacteria 2140
201 Ga0496109_1421405 3300048912 Bacteria 629
202 Ga0496110_0388343 3300048913 Bacteria 1272
203 Ga0496110_1254944 3300048913 Bacteria 650
204 Ga0496111_1094250 3300048914 Bacteria 568
205 Ga0496117_0160437 3300048920 Bacteria 1318
206 Ga0496118_0014056 3300048921 Bacteria 7516
207 Ga0496119_0003932 3300048922 Bacteria 15069
208 Ga0496120_0000223 3300048923 Bacteria 97882
209 Ga0496121_0149134 3300048924 Bacteria 1724
210 Ga0501034_0205518 3300049571 Bacteria 1926
211 Ga0501038_0217681 3300049574 Bacteria 1525
212 Ga0501047_0066112 3300049581 Bacteria 3485
213 Ga0501044_0345534 3300049823 Bacteria 1408
214 Ga0501044_1377498 3300049823 Bacteria 571
215 nmdc:mga03n38_31056_c1 3300050490 Bacteria 2251
216 nmdc:mga00v17_749534_c1 3300050491 Bacteria 624
217 nmdc:mga0yw44_252299_c1 3300050492 Bacteria 1174
218 nmdc:mga0qj67_225_c1 3300050509 Bacteria 38360
219 nmdc:mga0qj67_628596_c1 3300050509 Bacteria 858
220 nmdc:mga06r32_28021_c1 3300050510 Bacteria 5268
221 nmdc:mga08x19_188368_c1 3300050514 Bacteria 1411
222 Ga0495619_0523988 3300053085 Bacteria 814
223 Ga0466962_0146024 3300061719 Bacteria 1147
224 2515756687 2515154137 Bacteria 5711575
225 Ga0496102_0068188
226 Ga0070658_10161053
227 Ga0070683_100162702
228 Ga0070680_100082906
229 Ga0070682_100093416
230 Ga0070691_11061226
231 Ga0070668_100372201
232 Ga0070674_100182724
233 Ga0070688_100200827
234 Ga0070659_100903856
235 Ga0070714_100148032
236 Ga0070714_100507542
237 Ga0070714_100780222
238 Ga0070714_101474021
239 Ga0070713_100261418
240 Ga0070713_100313237
241 Ga0070713_100894576
242 Ga0070710_10969563
243 Ga0070678_100168991
244 Ga0070662_100769687
245 Ga0070681_10139845
246 Ga0068867_100306153
247 Ga0068867_101193248
248 Ga0070685_10096132
249 Ga0070679_100197555
250 Ga0070679_100804103
251 Ga0070684_100040635
252 Ga0070665_100133173
253 Ga0070665_101304689
254 Ga0068857_100104623
255 Ga0068852_100695271
256 Ga0068852_100782383
257 Ga0068866_10165125
258 Ga0068861_100510221
259 Ga0068863_100001436
260 Ga0068863_101120910
261 Ga0068858_100679961
262 Ga0068858_101346768
263 Ga0068860_100576698
264 Ga0068862_100144716
265 Ga0081538_10046516
266 Ga0081538_10067984
267 Ga0081538_10071915
268 Ga0081538_10337519
269 Ga0070717_10075349
270 Ga0075363_100005471
271 Ga0070716_100074393
272 Ga0075430_100340906
273 Ga0075431_100001557
274 Ga0075434_100866912
275 Ga0068865_100768780
276 Ga0068865_101266202
277 Ga0075436_100460783
278 Ga0105251_10011440
279 Ga0105247_10010495
280 Ga0105243_10766158
281 Ga0105243_10784035
282 Ga0105241_11605784
283 Ga0105241_12174898
284 Ga0105242_10372075
285 Ga0105248_10000111
286 Ga0105248_10029567
287 Ga0105248_10409241
288 Ga0105249_11169414
289 Ga0105249_11333155
290 Ga0105239_10389065
291 Ga0105239_13003145
292 Ga0157370_10143866
293 Ga0157369_10056273
294 Ga0157369_10360629
295 Ga0163162_10115049
296 Ga0163162_10347357
297 Ga0157372_12670888
298 Ga0157375_10311216
299 Ga0163163_10132242
300 Ga0163163_10981670
301 Ga0163163_12244341
302 Ga0157379_10076804
303 Ga0163161_10843295
304 Ga0206350_10049470
305 Ga0206354_11356117
306 Ga0206353_10105680
307 Ga0206353_11795632
308 Ga0213876_10265157
309 Ga0213875_10060980
310 Ga0224712_10120766
311 Ga0207713_1030919
312 Ga0207710_10000504
313 Ga0207688_10408992
314 Ga0207685_10471653
315 Ga0207705_11092031
316 Ga0207707_10235374
317 Ga0207693_10596706
318 Ga0207660_10330512
319 Ga0207662_10883274
320 Ga0207694_10574171
321 Ga0207687_11003409
322 Ga0207700_11472669
323 Ga0207664_10089441
324 Ga0207664_10332897
325 Ga0207664_10612947
326 Ga0207644_11772781
327 Ga0207709_10312632
328 Ga0207711_10000605
329 Ga0207711_10017881
330 Ga0207711_10835025
331 Ga0207661_10048385
332 Ga0207703_10298673
333 Ga0207641_10002854
334 Ga0207641_10967781
335 Ga0207648_10279093
336 Ga0207648_10800859
337 Ga0207674_10072621
338 Ga0207674_10791129
339 Ga0207675_100072404
340 Ga0207683_10170267
341 Ga0207683_10332719
342 Ga0268266_10262158
343 Ga0268266_11081053
344 Ga0268266_11612921
345 Ga0265338_10001322
346 Ga0265338_10010206
347 Ga0307511_10000813
348 Ga0307408_100016971
349 Ga0307405_10043180
350 Ga0307518_10034999
351 Ga0307406_10675067
352 Ga0307412_10074539
353 Ga0307409_100055381
354 Ga0307409_100440446
355 Ga0307416_101569021
356 Ga0307414_10304990
357 Ga0307414_11603815
358 Ga0307411_10444932
359 Ga0307415_100462705
360 Ga0373959_0119927
361 Ga0373940_0050674
362 Ga0373939_0200912
363 Ga0373942_0002181
364 Ga0373962_0098254
365 Ga0395898_0450258
366 Ga0395905_0059535
367 Ga0436364_0303464
368 Ga0436364_1282647
369 Ga0395901_1329497
370 Ga0439466_0009140
371 Ga0439465_0032407
372 Ga0451789_0957924
373 Ga0451793_0403416
374 Ga0451797_1519131
375 Ga0451806_528319
376 Ga0451841_1030469
377 Ga0451841_1040796
378 Ga0451843_1047599
379 Ga0451853_1913383
380 Ga0439431_0074528
381 Ga0439443_037995
382 Ga0439448_0014096
383 Ga0439450_021038
384 Ga0439451_030350
385 Ga0439456_043362
386 Ga0450905_075479
387 Ga0439464_0082144
388 Ga0466963_0119946
389 Ga0466963_0975835
390 Ga0466968_0554880
391 Ga0466958_0146328
392 Ga0466958_0970456
393 Ga0466967_0148914
394 Ga0466967_0738701
395 Ga0466967_0794586
396 Ga0495592_0228603
397 Ga0495641_0387452
398 Ga0495651_0016287
399 Ga0495653_0614666
400 Ga0495664_0781671
401 Ga0495608_0417449
402 Ga0495620_0100580
403 Ga0495628_0442877
404 Ga0495652_0051435
405 Ga0495597_0223636
406 Ga0495645_0228776
407 Ga0495667_0118847
408 Ga0495656_0487972
409 Ga0495646_0451968
410 Ga0495589_0479058
411 Ga0495600_0313296
412 Ga0495604_0032597
413 Ga0495636_0314370
414 Ga0495674_0184558
415 Ga0496100_0248225
416 Ga0496100_0925699
417 Ga0496102_1759073
418 Ga0496103_0216014
419 Ga0496104_0409012
420 Ga0496104_1606039
421 Ga0496105_0734744
422 Ga0496106_0037530
423 Ga0496106_0692844
424 Ga0496108_0132801
425 Ga0496109_1421405
426 Ga0496110_0388343
427 Ga0496110_1254944
428 Ga0496111_1094250
429 Ga0496117_0160437
430 Ga0496118_0014056
431 Ga0496119_0003932
432 Ga0496120_0000223
433 Ga0496121_0149134
434 Ga0501034_0205518
435 Ga0501038_0217681
436 Ga0501047_0066112
437 Ga0501044_0345534
438 Ga0501044_1377498
439 nmdc:mga03n38_31056_c1
440 nmdc:mga00v17_749534_c1
441 nmdc:mga0yw44_252299_c1
442 nmdc:mga0qj67_225_c1
443 nmdc:mga0qj67_628596_c1
444 nmdc:mga06r32_28021_c1
445 nmdc:mga08x19_188368_c1
446 Ga0495619_0523988
447 Ga0466962_0146024
448 2515756687

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

34

146

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.7484 1 126
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.6765 1 126
4lbp-assembly1.cif.gz_A 5-chloro-2-hydroxyhydroquinone dehydrochlorinase (tftg) from burkholderia phenoliruptrix ac1100: complex with 2,5-dihydroxybenzoquinone 0.6494 1 129
3znu-assembly1.cif.gz_I crystal structure of clcf in crystal form 2 0.6453 1 130
4fpi-assembly1.cif.gz_C crystal structure of 5-chloromuconolactone isomerase from rhodococcus opacus 1cp 0.6371 1 135
ID Description Score Start End Superfamily
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7484 1 126 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7111 1 130 3.30.70.1060
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6765 1 126 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6719 1 130 3.30.70.1060
af_P0ACJ5_55_139_3.30.70.920 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.6374 2 123 3.30.70.920
ID Description Score Start End GO Terms
AF-X0PNH1-F1-model_v4 YCII-related domain-containing protein 0.9108 22 129
AF-A0A2Z4VDB5-F1-model_v4 YCII-related domain-containing protein 0.8837 22 130
AF-U5W0Z9-F1-model_v4 YCII-like protein 0.8817 2 129
AF-A0A0T1T7X3-F1-model_v4 YCII-related domain-containing protein 0.8766 31 130
AF-A0A536CMY1-F1-model_v4 Uncharacterized protein 0.8762 21 128

Map