F337053

General Info

Members Datasets Scaffolds Average Seq Length
224 153 448 203

Family's Representative Sequence

Representative Sequence 3300046462|Ga0495651_0391953|Ga0495651_0391953_151_855
Length 234
Sequence MRLEAAILFATTIIASKSKETTAPPQTAIVGGVETLDELTLLDWKRRIFELYASIRADPDPEHAWRRWRATRDELFRSHPQSPVPADRLATFDGLPYFDYDPAFRVRATVDAAEPVLREIATSGEQPYTFRRFARARFALADEERTLDLFWLEGYGGGTFLSFADATSGRETYGACRYLLDTVKGADLGERDGELLLDFNFAYNPSCSYDARWVCPLAPPENRLALEVRAGERL

Samples

Sample ID Description Type Environment
1 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
40 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
55 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
56 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
57 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
58 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
59 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
60 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
61 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
62 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
63 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
64 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
65 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
66 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
67 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
68 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
69 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
70 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
71 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
72 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
73 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
74 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
75 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
76 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
77 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
78 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
81 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
82 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
83 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
84 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
85 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
86 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
87 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
88 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
89 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
90 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
91 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
92 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
93 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
94 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
95 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
96 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
97 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
98 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
99 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
100 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
101 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
102 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
103 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
104 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
105 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
106 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
107 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
108 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
109 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
110 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
111 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
112 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
113 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
114 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
115 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
116 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
117 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
118 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
119 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
120 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
121 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
122 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
123 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
124 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
125 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
126 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
127 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
128 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
129 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
130 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
131 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
132 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
133 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
134 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
135 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
136 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
137 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
138 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
139 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
140 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
141 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
142 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
143 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
144 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
145 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
146 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
147 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
148 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
149 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
150 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
151 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
152 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
153 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.11
Metatranscriptomes 0.89
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.71
Rhizosphere 88.84
Stem 0
Stem Tuber 0
Unclassified 2.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495651_0391953 3300046462 Bacteria 908
2 JGI25406J46586_10011613 3300003203 Bacteria 3857
3 Ga0070658_10013865 3300005327 Bacteria 6470
4 Ga0070680_100003687 3300005336 Bacteria 11434
5 Ga0070680_100019219 3300005336 Bacteria 5413
6 Ga0070682_100067923 3300005337 Bacteria 2271
7 Ga0070660_100002585 3300005339 Bacteria 12420
8 Ga0070660_100003281 3300005339 Bacteria 11114
9 Ga0070661_100067417 3300005344 Bacteria 2630
10 Ga0070659_100036824 3300005366 Bacteria 3814
11 Ga0070659_100063228 3300005366 Bacteria 2928
12 Ga0070667_100614788 3300005367 Bacteria 1002
13 Ga0070714_100376358 3300005435 Bacteria 1338
14 Ga0070711_100123041 3300005439 Bacteria 1922
15 Ga0070708_100001096 3300005445 Bacteria 20638
16 Ga0070708_100632040 3300005445 Bacteria 1009
17 Ga0070681_10020805 3300005458 Bacteria 6572
18 Ga0070707_100201236 3300005468 Bacteria 1941
19 Ga0070698_100530143 3300005471 Bacteria 1116
20 Ga0070699_100138102 3300005518 Bacteria 2151
21 Ga0070679_100003764 3300005530 Bacteria 13915
22 Ga0070679_100050718 3300005530 Bacteria 4133
23 Ga0070679_100052973 3300005530 Bacteria 4039
24 Ga0068853_100168436 3300005539 Bacteria 1981
25 Ga0070693_100255258 3300005547 Bacteria 1164
26 Ga0070665_100912945 3300005548 Bacteria 891
27 Ga0068855_100059496 3300005563 Bacteria 4470
28 Ga0068864_100241215 3300005618 Bacteria 1675
29 Ga0081539_10000062 3300005985 Bacteria 249871
30 Ga0081539_10000088 3300005985 Bacteria 212765
31 Ga0081539_10002688 3300005985 Bacteria 24146
32 Ga0081539_10068510 3300005985 Bacteria 1914
33 Ga0070712_100335528 3300006175 Bacteria 1233
34 Ga0070712_100467341 3300006175 Bacteria 1053
35 Ga0075430_100471493 3300006846 Bacteria 1036
36 Ga0075431_100024193 3300006847 Bacteria 6219
37 Ga0075434_100014310 3300006871 Bacteria 7582
38 Ga0075434_100660367 3300006871 Bacteria 1064
39 Ga0075435_100510496 3300007076 Bacteria 1040
40 Ga0105240_10027559 3300009093 Bacteria 7436
41 Ga0105240_10877093 3300009093 Bacteria 967
42 Ga0111539_10085024 3300009094 Bacteria 3719
43 Ga0105245_10084020 3300009098 Bacteria 2915
44 Ga0114129_10468551 3300009147 Bacteria 1650
45 Ga0105242_10359365 3300009176 Bacteria 1347
46 Ga0105237_10838790 3300009545 Bacteria 926
47 Ga0105246_11042084 3300011119 Bacteria 743
48 Ga0157370_10005063 3300013104 Bacteria 14876
49 Ga0157369_10244877 3300013105 Bacteria 1872
50 Ga0157369_11219484 3300013105 Bacteria 768
51 Ga0157372_10209507 3300013307 Bacteria 2259
52 Ga0157372_10388271 3300013307 Bacteria 1627
53 Ga0182006_1058474 3300015261 Bacteria 1462
54 Ga0206353_11100663 3300020082 Bacteria 3124
55 Ga0224712_10216470 3300022467 Bacteria 875
56 Ga0207684_10259637 3300025910 Bacteria 1499
57 Ga0207707_10039883 3300025912 Bacteria 4103
58 Ga0207707_10271319 3300025912 Bacteria 1470
59 Ga0207693_10244033 3300025915 Bacteria 1410
60 Ga0207693_10500147 3300025915 Bacteria 949
61 Ga0207693_10761226 3300025915 Bacteria 748
62 Ga0207660_10486721 3300025917 Bacteria 1000
63 Ga0207657_10004199 3300025919 Bacteria 15254
64 Ga0207657_10019621 3300025919 Bacteria 6412
65 Ga0207649_10457484 3300025920 Bacteria 964
66 Ga0207652_10022437 3300025921 Bacteria 5222
67 Ga0207646_10107506 3300025922 Bacteria 2502
68 Ga0207659_10238708 3300025926 Bacteria 1469
69 Ga0207664_10227614 3300025929 Bacteria 1620
70 Ga0207690_10049622 3300025932 Bacteria 2799
71 Ga0207639_10138655 3300026041 Bacteria 2024
72 Ga0207639_10828232 3300026041 Bacteria 863
73 Ga0207428_10033032 3300027907 Bacteria 4252
74 Ga0265326_10027485 3300028558 Bacteria 1622
75 Ga0265334_10005182 3300028573 Bacteria 5712
76 Ga0265334_10083407 3300028573 Bacteria 1175
77 Ga0265318_10019062 3300028577 Bacteria 2787
78 Ga0265318_10047552 3300028577 Bacteria 1618
79 Ga0265318_10177625 3300028577 Bacteria 780
80 Ga0265323_10022992 3300028653 Bacteria 2379
81 Ga0265322_10032402 3300028654 Bacteria 1490
82 Ga0265336_10158265 3300028666 Bacteria 674
83 Ga0265338_10005569 3300028800 Bacteria 16384
84 Ga0265328_10046944 3300031239 Bacteria 1587
85 Ga0265325_10029492 3300031241 Bacteria 2949
86 Ga0265329_10015337 3300031242 Bacteria 2678
87 Ga0265340_10038493 3300031247 Bacteria 2365
88 Ga0265340_10100270 3300031247 Unclassified 1346
89 Ga0265339_10028952 3300031249 Bacteria 3146
90 Ga0265331_10046395 3300031250 Bacteria 2094
91 Ga0265327_10021628 3300031251 Bacteria 3875
92 Ga0265327_10055841 3300031251 Bacteria 2037
93 Ga0265316_10005982 3300031344 Bacteria 11711
94 Ga0265313_10002243 3300031595 Bacteria 17006
95 Ga0265314_10005747 3300031711 Bacteria 11127
96 Ga0265314_10038254 3300031711 Bacteria 3469
97 Ga0265342_10239673 3300031712 Bacteria 971
98 Ga0373926_0202317 3300035083 Bacteria 764
99 Ga0373943_0000121 3300035170 Bacteria 29176
100 Ga0373935_0263532 3300035692 Bacteria 1209
101 Ga0373947_0001423 3300035725 Bacteria 14714
102 Ga0373937_0354369 3300036401 Bacteria 1390
103 Ga0373925_0000937 3300037068 Bacteria 26571
104 Ga0395900_0179071 3300037418 Bacteria 2155
105 Ga0395905_0393520 3300037471 Bacteria 1280
106 Ga0395901_0046480 3300038443 Bacteria 4509
107 Ga0436365_0989482 3300039437 Bacteria 2167
108 Ga0436362_1172151 3300039453 Unclassified 715
109 Ga0466963_0266500 3300044694 Bacteria 1203
110 Ga0466964_0039226 3300044706 Bacteria 1907
111 Ga0466964_0052928 3300044706 Bacteria 1670
112 Ga0466957_0117154 3300044842 Bacteria 1695
113 Ga0466960_0141834 3300044901 Bacteria 1277
114 Ga0466959_0379618 3300045049 Bacteria 962
115 Ga0466958_0071526 3300045836 Bacteria 2124
116 Ga0466967_0012282 3300045976 Bacteria 6542
117 Ga0466967_0029146 3300045976 Bacteria 4616
118 Ga0466967_0057377 3300045976 Bacteria 3437
119 Ga0466967_0405917 3300045976 Bacteria 1326
120 Ga0466967_0852148 3300045976 Bacteria 906
121 Ga0495592_0032907 3300046454 Bacteria 3911
122 Ga0495603_0023346 3300046455 Bacteria 3744
123 Ga0495629_0139039 3300046459 Bacteria 1690
124 Ga0495641_0001166 3300046461 Bacteria 22610
125 Ga0495641_0014397 3300046461 Bacteria 4281
126 Ga0495641_0245802 3300046461 Bacteria 804
127 Ga0495651_0022416 3300046462 Bacteria 4908
128 Ga0495651_0188264 3300046462 Bacteria 1454
129 Ga0495651_0264660 3300046462 Bacteria 1168
130 Ga0495653_0394444 3300046463 Bacteria 881
131 Ga0495582_0000476 3300046473 Bacteria 21966
132 Ga0495639_0015678 3300046475 Bacteria 3286
133 Ga0495639_0050171 3300046475 Bacteria 1895
134 Ga0495662_0004536 3300046476 Bacteria 6964
135 Ga0495608_0047482 3300046511 Bacteria 2854
136 Ga0495608_0087745 3300046511 Bacteria 2014
137 Ga0495628_0046398 3300046516 Unclassified 3451
138 Ga0495630_0022832 3300046517 Bacteria 4621
139 Ga0495630_0028517 3300046517 Bacteria 4147
140 Ga0495630_0248401 3300046517 Bacteria 1359
141 Ga0495666_0001680 3300046526 Bacteria 10925
142 Ga0495652_0076377 3300046529 Bacteria 2779
143 Ga0495665_0001189 3300046531 Bacteria 13861
144 Ga0495640_0016563 3300046533 Bacteria 5511
145 Ga0495640_0028805 3300046533 Bacteria 3994
146 Ga0495640_0148827 3300046533 Bacteria 1505
147 Ga0495586_0155950 3300046535 Bacteria 1286
148 Ga0495586_0211314 3300046535 Bacteria 1101
149 Ga0495667_0001359 3300046559 Bacteria 16070
150 Ga0495667_0053993 3300046559 Bacteria 2645
151 Ga0495667_0125292 3300046559 Bacteria 1658
152 Ga0495634_0010271 3300046642 Bacteria 6860
153 Ga0495635_0048362 3300046663 Bacteria 2932
154 Ga0495657_0017551 3300046675 Bacteria 5193
155 Ga0495657_0068554 3300046675 Bacteria 2324
156 Ga0495599_0226307 3300046678 Bacteria 1143
157 Ga0495623_0108455 3300046679 Bacteria 1685
158 Ga0495646_0235671 3300046680 Bacteria 985
159 Ga0495647_0041919 3300046681 Bacteria 1746
160 Ga0495658_0052166 3300046683 Bacteria 2318
161 Ga0495658_0163301 3300046683 Unclassified 1375
162 Ga0495613_0000618 3300046689 Bacteria 28357
163 Ga0495613_0481133 3300046689 Bacteria 838
164 Ga0495624_0025226 3300046690 Bacteria 3906
165 Ga0495600_0102903 3300046809 Bacteria 1861
166 Ga0495604_0313368 3300047317 Bacteria 1050
167 Ga0495674_0001118 3300047319 Bacteria 25782
168 Ga0495674_0053175 3300047319 Bacteria 3561
169 Ga0495674_0084385 3300047319 Bacteria 2722
170 Ga0495676_0001540 3300047321 Bacteria 19962
171 Ga0495676_0462314 3300047321 Bacteria 836
172 Ga0495680_0010585 3300047322 Bacteria 8227
173 Ga0495680_0038925 3300047322 Bacteria 3797
174 Ga0495680_0039413 3300047322 Bacteria 3770
175 Ga0495675_0286693 3300047444 Bacteria 981
176 Ga0495684_0006886 3300047471 Bacteria 8827
177 Ga0495684_0019249 3300047471 Bacteria 5255
178 Ga0495593_0004413 3300047673 Bacteria 8359
179 Ga0495602_0031256 3300048088 Bacteria 5037
180 Ga0495602_0152505 3300048088 Bacteria 1814
181 Ga0496100_0686657 3300048903 Bacteria 798
182 Ga0496101_0021254 3300048904 Bacteria 4457
183 Ga0496101_0047210 3300048904 Bacteria 3090
184 Ga0496101_0058561 3300048904 Bacteria 2790
185 Ga0496102_0242898 3300048905 Bacteria 1698
186 Ga0496104_0113962 3300048907 Bacteria 2593
187 Ga0496105_0106729 3300048908 Bacteria 2312
188 Ga0496105_0347906 3300048908 Bacteria 1184
189 Ga0496106_0038102 3300048909 Bacteria 3597
190 Ga0496106_0116113 3300048909 Bacteria 2088
191 Ga0496106_0130931 3300048909 Bacteria 1967
192 Ga0496107_0014676 3300048910 Bacteria 5484
193 Ga0496108_0315705 3300048911 Bacteria 1362
194 Ga0496109_0052645 3300048912 Bacteria 3711
195 Ga0496110_0069334 3300048913 Bacteria 3123
196 Ga0496110_0153674 3300048913 Bacteria 2084
197 Ga0496111_0199168 3300048914 Bacteria 1489
198 Ga0496112_0036697 3300048915 Bacteria 4782
199 Ga0496112_0039553 3300048915 Bacteria 4609
200 Ga0496112_1186474 3300048915 Bacteria 680
201 Ga0496114_0019010 3300048917 Bacteria 5566
202 Ga0496114_0022861 3300048917 Bacteria 5096
203 Ga0496115_0006773 3300048918 Bacteria 8406
204 Ga0496115_0399742 3300048918 Bacteria 1115
205 Ga0501069_0438308 3300049585 Bacteria 776
206 Ga0501074_0318502 3300049590 Bacteria 1104
207 Ga0501080_0153435 3300049742 Bacteria 2128
208 nmdc:mga05p37_1023577_c1 3300050507 Bacteria 874
209 nmdc:mga05p37_140292_c1 3300050507 Bacteria 2961
210 nmdc:mga05p37_564561_c1 3300050507 Unclassified 1292
211 nmdc:mga05p37_609216_c1 3300050507 Bacteria 1231
212 nmdc:mga06r32_625962_c1 3300050510 Bacteria 1046
213 nmdc:mga08y16_43216_c1 3300050511 Bacteria 4721
214 nmdc:mga0n895_1039534_c1 3300050512 Unclassified 799
215 nmdc:mga0n895_151334_c1 3300050512 Bacteria 2351
216 nmdc:mga0n895_705890_c1 3300050512 Bacteria 1004
217 nmdc:mga0rr50_260485_c1 3300050513 Bacteria 1443
218 nmdc:mga08x19_595808_c1 3300050514 Bacteria 783
219 Ga0495612_0018829 3300053078 Bacteria 2765
220 Ga0495612_0135245 3300053078 Bacteria 1067
221 Ga0495595_0162683 3300053084 Bacteria 1102
222 Ga0495619_0002232 3300053085 Bacteria 12806
223 Ga0495619_0012872 3300053085 Bacteria 5269
224 Ga0466962_0177071 3300061719 Bacteria 1039
225 Ga0495651_0391953
226 JGI25406J46586_10011613
227 Ga0070658_10013865
228 Ga0070680_100003687
229 Ga0070680_100019219
230 Ga0070682_100067923
231 Ga0070660_100002585
232 Ga0070660_100003281
233 Ga0070661_100067417
234 Ga0070659_100036824
235 Ga0070659_100063228
236 Ga0070667_100614788
237 Ga0070714_100376358
238 Ga0070711_100123041
239 Ga0070708_100001096
240 Ga0070708_100632040
241 Ga0070681_10020805
242 Ga0070707_100201236
243 Ga0070698_100530143
244 Ga0070699_100138102
245 Ga0070679_100003764
246 Ga0070679_100050718
247 Ga0070679_100052973
248 Ga0068853_100168436
249 Ga0070693_100255258
250 Ga0070665_100912945
251 Ga0068855_100059496
252 Ga0068864_100241215
253 Ga0081539_10000062
254 Ga0081539_10000088
255 Ga0081539_10002688
256 Ga0081539_10068510
257 Ga0070712_100335528
258 Ga0070712_100467341
259 Ga0075430_100471493
260 Ga0075431_100024193
261 Ga0075434_100014310
262 Ga0075434_100660367
263 Ga0075435_100510496
264 Ga0105240_10027559
265 Ga0105240_10877093
266 Ga0111539_10085024
267 Ga0105245_10084020
268 Ga0114129_10468551
269 Ga0105242_10359365
270 Ga0105237_10838790
271 Ga0105246_11042084
272 Ga0157370_10005063
273 Ga0157369_10244877
274 Ga0157369_11219484
275 Ga0157372_10209507
276 Ga0157372_10388271
277 Ga0182006_1058474
278 Ga0206353_11100663
279 Ga0224712_10216470
280 Ga0207684_10259637
281 Ga0207707_10039883
282 Ga0207707_10271319
283 Ga0207693_10244033
284 Ga0207693_10500147
285 Ga0207693_10761226
286 Ga0207660_10486721
287 Ga0207657_10004199
288 Ga0207657_10019621
289 Ga0207649_10457484
290 Ga0207652_10022437
291 Ga0207646_10107506
292 Ga0207659_10238708
293 Ga0207664_10227614
294 Ga0207690_10049622
295 Ga0207639_10138655
296 Ga0207639_10828232
297 Ga0207428_10033032
298 Ga0265326_10027485
299 Ga0265334_10005182
300 Ga0265334_10083407
301 Ga0265318_10019062
302 Ga0265318_10047552
303 Ga0265318_10177625
304 Ga0265323_10022992
305 Ga0265322_10032402
306 Ga0265336_10158265
307 Ga0265338_10005569
308 Ga0265328_10046944
309 Ga0265325_10029492
310 Ga0265329_10015337
311 Ga0265340_10038493
312 Ga0265340_10100270
313 Ga0265339_10028952
314 Ga0265331_10046395
315 Ga0265327_10021628
316 Ga0265327_10055841
317 Ga0265316_10005982
318 Ga0265313_10002243
319 Ga0265314_10005747
320 Ga0265314_10038254
321 Ga0265342_10239673
322 Ga0373926_0202317
323 Ga0373943_0000121
324 Ga0373935_0263532
325 Ga0373947_0001423
326 Ga0373937_0354369
327 Ga0373925_0000937
328 Ga0395900_0179071
329 Ga0395905_0393520
330 Ga0395901_0046480
331 Ga0436365_0989482
332 Ga0436362_1172151
333 Ga0466963_0266500
334 Ga0466964_0039226
335 Ga0466964_0052928
336 Ga0466957_0117154
337 Ga0466960_0141834
338 Ga0466959_0379618
339 Ga0466958_0071526
340 Ga0466967_0012282
341 Ga0466967_0029146
342 Ga0466967_0057377
343 Ga0466967_0405917
344 Ga0466967_0852148
345 Ga0495592_0032907
346 Ga0495603_0023346
347 Ga0495629_0139039
348 Ga0495641_0001166
349 Ga0495641_0014397
350 Ga0495641_0245802
351 Ga0495651_0022416
352 Ga0495651_0188264
353 Ga0495651_0264660
354 Ga0495653_0394444
355 Ga0495582_0000476
356 Ga0495639_0015678
357 Ga0495639_0050171
358 Ga0495662_0004536
359 Ga0495608_0047482
360 Ga0495608_0087745
361 Ga0495628_0046398
362 Ga0495630_0022832
363 Ga0495630_0028517
364 Ga0495630_0248401
365 Ga0495666_0001680
366 Ga0495652_0076377
367 Ga0495665_0001189
368 Ga0495640_0016563
369 Ga0495640_0028805
370 Ga0495640_0148827
371 Ga0495586_0155950
372 Ga0495586_0211314
373 Ga0495667_0001359
374 Ga0495667_0053993
375 Ga0495667_0125292
376 Ga0495634_0010271
377 Ga0495635_0048362
378 Ga0495657_0017551
379 Ga0495657_0068554
380 Ga0495599_0226307
381 Ga0495623_0108455
382 Ga0495646_0235671
383 Ga0495647_0041919
384 Ga0495658_0052166
385 Ga0495658_0163301
386 Ga0495613_0000618
387 Ga0495613_0481133
388 Ga0495624_0025226
389 Ga0495600_0102903
390 Ga0495604_0313368
391 Ga0495674_0001118
392 Ga0495674_0053175
393 Ga0495674_0084385
394 Ga0495676_0001540
395 Ga0495676_0462314
396 Ga0495680_0010585
397 Ga0495680_0038925
398 Ga0495680_0039413
399 Ga0495675_0286693
400 Ga0495684_0006886
401 Ga0495684_0019249
402 Ga0495593_0004413
403 Ga0495602_0031256
404 Ga0495602_0152505
405 Ga0496100_0686657
406 Ga0496101_0021254
407 Ga0496101_0047210
408 Ga0496101_0058561
409 Ga0496102_0242898
410 Ga0496104_0113962
411 Ga0496105_0106729
412 Ga0496105_0347906
413 Ga0496106_0038102
414 Ga0496106_0116113
415 Ga0496106_0130931
416 Ga0496107_0014676
417 Ga0496108_0315705
418 Ga0496109_0052645
419 Ga0496110_0069334
420 Ga0496110_0153674
421 Ga0496111_0199168
422 Ga0496112_0036697
423 Ga0496112_0039553
424 Ga0496112_1186474
425 Ga0496114_0019010
426 Ga0496114_0022861
427 Ga0496115_0006773
428 Ga0496115_0399742
429 Ga0501069_0438308
430 Ga0501074_0318502
431 Ga0501080_0153435
432 nmdc:mga05p37_1023577_c1
433 nmdc:mga05p37_140292_c1
434 nmdc:mga05p37_564561_c1
435 nmdc:mga05p37_609216_c1
436 nmdc:mga06r32_625962_c1
437 nmdc:mga08y16_43216_c1
438 nmdc:mga0n895_1039534_c1
439 nmdc:mga0n895_151334_c1
440 nmdc:mga0n895_705890_c1
441 nmdc:mga0rr50_260485_c1
442 nmdc:mga08x19_595808_c1
443 Ga0495612_0018829
444 Ga0495612_0135245
445 Ga0495595_0162683
446 Ga0495619_0002232
447 Ga0495619_0012872
448 Ga0466962_0177071

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07920

DUF1684

Protein of unknown function (DUF1684)

90

233

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fj4-assembly1.cif.gz_B crystal structure of the protein q9hre7 complexed with mercury from halobacterium salinarium at the resolution 2.1a, northeast structural genomics consortium target hsr50 0.8708 45 217
4dlh-assembly2.cif.gz_B crystal structure of the protein q9hre7 from halobacterium salinarium at the resolution 1.9a, northeast structural genomics consortium (nesg) target hsr50 0.8668 45 214
4fj4-assembly2.cif.gz_A crystal structure of the protein q9hre7 complexed with mercury from halobacterium salinarium at the resolution 2.1a, northeast structural genomics consortium target hsr50 0.8389 15 214
4fj4-assembly1.cif.gz_B crystal structure of the protein q9hre7 complexed with mercury from halobacterium salinarium at the resolution 2.1a, northeast structural genomics consortium target hsr50 0.8342 45 217
4fj4-assembly2.cif.gz_A crystal structure of the protein q9hre7 complexed with mercury from halobacterium salinarium at the resolution 2.1a, northeast structural genomics consortium target hsr50 0.8254 15 214
ID Description Score Start End Superfamily
af_A0A096MKD7_310_419_3.30.505.10 Alpha Beta;2-Layer Sandwich;SHC Adaptor Protein;SH2 domain 0.8494 114 143 3.30.505.10
af_Q54MR5_6_129_3.30.1520.10 Alpha Beta;2-Layer Sandwich;PX Domain;Phox-like domain 0.7452 112 143 3.30.1520.10
af_A0A0R4IFZ8_580_758_3.30.505.10 Alpha Beta;2-Layer Sandwich;SHC Adaptor Protein;SH2 domain 0.7442 114 138 3.30.505.10
af_Q7JVF1_173_338_3.30.505.10 Alpha Beta;2-Layer Sandwich;SHC Adaptor Protein;SH2 domain 0.7202 114 135 3.30.505.10
af_Q9W4A9_63_168_3.30.505.10 Alpha Beta;2-Layer Sandwich;SHC Adaptor Protein;SH2 domain 0.6554 116 141 3.30.505.10
ID Description Score Start End GO Terms
AF-A0A2W6BN72-F1-model_v4 DUF1684 domain-containing protein 0.9776 17 216
AF-A0A537Y9Z5-F1-model_v4 DUF1684 domain-containing protein 0.9746 23 216
AF-A0A536ZQ33-F1-model_v4 DUF1684 domain-containing protein 0.9745 112 217
AF-A0A538HX90-F1-model_v4 DUF1684 domain-containing protein 0.9743 96 216
AF-A0A534ZXT2-F1-model_v4 DUF1684 domain-containing protein 0.972 20 214

Map