F336952

General Info

Members Datasets Scaffolds Average Seq Length
224 183 448 248

Family's Representative Sequence

Representative Sequence 3300036459|Ga0372808_002460|Ga0372808_002460_181_1050
Length 284
Sequence MPHEDKPGTPADPRDDLGHPVAVPRLVGRVVSLEAVASCAPRILVGATNWCSHPADLAVTRIGGTKSPDLAKIVALAPDVVLANEEENRAEDLDALRAVGLAVWVTRVQDLPEALASLGRLLTTACRLAPPAWLDAAAAAWSRLPVRSDSPERTAVVPIWRRPWMVLGRDTFAGDLLARLGVDNLYAGHGERYPRIGIDQIRGAGADLVVLPDEPYRFSASDGPEAFPGDSTALVSGRHLTWYGPSLTEAPAVLGRQLGAARVRCPGLPGRADHPHLRAARPGS

Samples

Sample ID Description Type Environment
1 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
15 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
16 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
17 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
25 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
27 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
30 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
31 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
32 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
33 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
34 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
37 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
55 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
56 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
57 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
58 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
59 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
60 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
61 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
62 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
63 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
64 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
65 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
66 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
67 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
68 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
69 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
70 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
71 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
72 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
73 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
74 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
75 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
76 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
77 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
78 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
79 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
80 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
81 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
82 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
83 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
84 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
85 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
86 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
87 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
88 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
89 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
90 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
91 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
92 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
93 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
94 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
95 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
96 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
97 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
98 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
99 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
100 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
101 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
102 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
103 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
104 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
105 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
106 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
107 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
108 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
109 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
110 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
111 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
112 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
113 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
114 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
115 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
116 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
117 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
118 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
119 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
120 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
121 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
122 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
123 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
124 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
130 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
132 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
133 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
134 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
135 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
136 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
137 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
138 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
139 2506783011 Frankia datiscae Dg1 Isolate Nodule
140 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
141 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
142 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
143 2643221548 Streptomyces sp. Root55 Isolate Unclassified
144 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
145 2643221647 Streptomyces sp. Root369 Isolate Unclassified
146 2643221670 Streptomyces sp. Root431 Isolate Unclassified
147 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
148 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
149 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
150 2773857933 Frankia sp. BMG5.30 Isolate Nodule
151 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
152 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
153 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
154 2862574272 Streptomyces sp. AcE210 Isolate Nodule
155 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
156 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
157 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
158 2867428634 Streptomyces sp. RP5T Isolate Unclassified
159 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
160 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
161 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
162 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
163 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
164 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
165 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
166 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
167 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
168 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
169 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
170 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
171 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
172 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
173 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
174 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
175 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
176 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
177 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
178 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
179 8002775197 Frankia nepalensis CN7 Isolate Nodule
180 8002784119 Frankia sp. AgB1.9 Isolate Nodule
181 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
182 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
183 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 78.57
Metatranscriptomes 1.34
Isolates 20.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.89
Nodule 2.68
Rhizoplane 2.23
Rhizosphere 76.79
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0372808_002460 3300036459 Bacteria 2143
2 Ga0070658_10026724 3300005327 Bacteria 4632
3 Ga0068868_100034477 3300005338 Bacteria 3908
4 Ga0068868_100193952 3300005338 Bacteria 1690
5 Ga0070660_100302238 3300005339 Bacteria 1312
6 Ga0070659_100000483 3300005366 Bacteria 29241
7 Ga0070714_100321173 3300005435 Bacteria 1448
8 Ga0070708_100207707 3300005445 Bacteria 1835
9 Ga0070708_100320372 3300005445 Bacteria 1460
10 Ga0070708_100485930 3300005445 Bacteria 1165
11 Ga0070663_100002182 3300005455 Bacteria 10939
12 Ga0070706_100107110 3300005467 Bacteria 2600
13 Ga0070679_100040124 3300005530 Bacteria 4657
14 Ga0070679_100294821 3300005530 Bacteria 1573
15 Ga0070684_100018347 3300005535 Bacteria 5762
16 Ga0070665_100265837 3300005548 Bacteria 1717
17 Ga0068855_100603047 3300005563 Bacteria 1184
18 Ga0068859_100001588 3300005617 Bacteria 23180
19 Ga0068864_100325891 3300005618 Bacteria 1444
20 Ga0068858_100000084 3300005842 Bacteria 98433
21 Ga0068862_100001306 3300005844 Bacteria 23208
22 Ga0068862_100599935 3300005844 Bacteria 1057
23 Ga0081455_10000424 3300005937 Bacteria 55362
24 Ga0070717_10167724 3300006028 Bacteria 1908
25 Ga0075363_100135822 3300006048 Bacteria 1382
26 Ga0075428_100021287 3300006844 Bacteria 7181
27 Ga0075430_100026035 3300006846 Bacteria 4977
28 Ga0075431_100048574 3300006847 Bacteria 4377
29 Ga0075431_100320846 3300006847 Bacteria 1562
30 Ga0075429_100014077 3300006880 Bacteria 6932
31 Ga0097620_100001588 3300006931 Bacteria 23180
32 Ga0099826_10031793 3300006948 Bacteria 3813
33 Ga0105247_10010933 3300009101 Bacteria 5480
34 Ga0114129_10000822 3300009147 Bacteria 40015
35 Ga0105248_10093294 3300009177 Bacteria 3390
36 Ga0105249_10017077 3300009553 Bacteria 6440
37 Ga0157372_10173282 3300013307 Bacteria 2496
38 Ga0163163_10021569 3300014325 Bacteria 6081
39 Ga0163163_10538622 3300014325 Bacteria 1230
40 Ga0157379_10000076 3300014968 Bacteria 63779
41 Ga0197907_10156750 3300020069 Bacteria 863
42 Ga0206353_11749115 3300020082 Bacteria 1489
43 Ga0213875_10037587 3300021388 Bacteria 2281
44 Ga0207710_10000023 3300025900 Bacteria 329909
45 Ga0207684_10272871 3300025910 Bacteria 1459
46 Ga0207684_10460937 3300025910 Bacteria 1091
47 Ga0207660_10209463 3300025917 Bacteria 1526
48 Ga0207657_10106499 3300025919 Bacteria 2320
49 Ga0207652_10019415 3300025921 Bacteria 5590
50 Ga0207652_10191435 3300025921 Bacteria 1840
51 Ga0207664_10528440 3300025929 Bacteria 1057
52 Ga0207690_10002958 3300025932 Bacteria 10230
53 Ga0207711_10042971 3300025941 Bacteria 3853
54 Ga0207667_10149239 3300025949 Bacteria 2406
55 Ga0207712_10209085 3300025961 Bacteria 1553
56 Ga0207658_10116500 3300025986 Bacteria 2122
57 Ga0207677_10021665 3300026023 Bacteria 3932
58 Ga0207677_10165157 3300026023 Bacteria 1725
59 Ga0207703_10000003 3300026035 Bacteria 532213
60 Ga0207678_10000391 3300026067 Bacteria 39957
61 Ga0207641_10064280 3300026088 Bacteria 3136
62 Ga0207676_10074123 3300026095 Bacteria 2741
63 Ga0268265_10000024 3300028380 Bacteria 266266
64 Ga0307515_10023232 3300028794 Bacteria 10878
65 Ga0307515_10275844 3300028794 Bacteria 1395
66 Ga0307512_10000948 3300030522 Bacteria 42647
67 Ga0307512_10011178 3300030522 Bacteria 8521
68 Ga0307512_10048273 3300030522 Bacteria 3449
69 Ga0307513_10068045 3300031456 Bacteria 3732
70 Ga0316579_10000264 3300031691 Bacteria 16033
71 Ga0307413_10249046 3300031824 Bacteria 1317
72 Ga0307518_10000241 3300031838 Bacteria 41161
73 Ga0307406_10107940 3300031901 Bacteria 1910
74 Ga0307407_10322814 3300031903 Bacteria 1084
75 Ga0307507_10010614 3300033179 Bacteria 11856
76 Ga0307507_10169532 3300033179 Bacteria 1590
77 Ga0373956_0000783 3300035119 Bacteria 13162
78 Ga0373955_0114953 3300035172 Bacteria 1559
79 Ga0373937_0313311 3300036401 Bacteria 1484
80 Ga0436364_0797680 3300037853 Bacteria 5014
81 Ga0395901_0034370 3300038443 Bacteria 5235
82 Ga0436363_1683835 3300039450 Bacteria 1894
83 Ga0450898_000025 3300042134 Bacteria 11730
84 Ga0466969_0008814 3300044656 Bacteria 5347
85 Ga0466969_0035090 3300044656 Bacteria 2538
86 Ga0466969_0035140 3300044656 Bacteria 2536
87 Ga0466972_0022673 3300044658 Bacteria 3124
88 Ga0466966_0008860 3300044684 Bacteria 6664
89 Ga0466966_0025879 3300044684 Bacteria 3832
90 Ga0466961_0023361 3300044693 Bacteria 3978
91 Ga0466961_0134949 3300044693 Bacteria 1546
92 Ga0466961_0137371 3300044693 Bacteria 1531
93 Ga0466961_0147984 3300044693 Bacteria 1468
94 Ga0466963_0024791 3300044694 Bacteria 3820
95 Ga0466963_0055865 3300044694 Bacteria 2626
96 Ga0466971_0026835 3300044719 Bacteria 2576
97 Ga0466968_0063880 3300044735 Bacteria 1592
98 Ga0466957_0488347 3300044842 Bacteria 852
99 Ga0466959_0013969 3300045049 Bacteria 5829
100 Ga0466959_0031801 3300045049 Bacteria 3905
101 Ga0466959_0415748 3300045049 Bacteria 913
102 Ga0466958_0037424 3300045836 Bacteria 2907
103 Ga0466958_0279549 3300045836 Bacteria 1070
104 Ga0495592_0037034 3300046454 Bacteria 3673
105 Ga0495603_0015403 3300046455 Bacteria 4626
106 Ga0495638_0190455 3300046460 Bacteria 1164
107 Ga0495651_0000834 3300046462 Bacteria 23983
108 Ga0495651_0236975 3300046462 Bacteria 1253
109 Ga0495653_0046989 3300046463 Bacteria 3340
110 Ga0495585_0038139 3300046492 Bacteria 2705
111 Ga0495606_0000832 3300046507 Bacteria 46538
112 Ga0495608_0001639 3300046511 Bacteria 16079
113 Ga0495618_0006780 3300046514 Bacteria 6937
114 Ga0495628_0028036 3300046516 Bacteria 4579
115 Ga0495628_0030326 3300046516 Bacteria 4379
116 Ga0495628_0455824 3300046516 Bacteria 928
117 Ga0495652_0000776 3300046529 Bacteria 36808
118 Ga0495652_0002071 3300046529 Bacteria 21204
119 Ga0495652_0039121 3300046529 Bacteria 4102
120 Ga0495640_0284853 3300046533 Bacteria 1028
121 Ga0495587_0125119 3300046536 Bacteria 1471
122 Ga0495609_0048626 3300046538 Bacteria 1895
123 Ga0495645_0021600 3300046543 Bacteria 4651
124 Ga0495667_0012014 3300046559 Bacteria 5866
125 Ga0495668_0000390 3300046616 Bacteria 57867
126 Ga0495625_0000161 3300046660 Bacteria 103972
127 Ga0495635_0015650 3300046663 Bacteria 5298
128 Ga0495657_0020622 3300046675 Bacteria 4737
129 Ga0495599_0031893 3300046678 Bacteria 3307
130 Ga0495623_0010691 3300046679 Bacteria 5942
131 Ga0495623_0044924 3300046679 Bacteria 2806
132 Ga0495600_0004773 3300046809 Bacteria 8133
133 Ga0495600_0044932 3300046809 Bacteria 2881
134 Ga0495581_0150968 3300047315 Bacteria 1357
135 Ga0495604_0035121 3300047317 Bacteria 3961
136 Ga0495604_0088940 3300047317 Bacteria 2297
137 Ga0495674_0019785 3300047319 Bacteria 6242
138 Ga0495676_0023614 3300047321 Bacteria 5332
139 Ga0495676_0045341 3300047321 Bacteria 3579
140 Ga0495680_0028098 3300047322 Bacteria 4614
141 Ga0495683_0029868 3300047323 Bacteria 2784
142 Ga0495683_0081404 3300047323 Bacteria 1579
143 Ga0495675_0017817 3300047444 Bacteria 4503
144 Ga0495684_0015130 3300047471 Bacteria 5942
145 Ga0495686_0007601 3300047472 Bacteria 8095
146 Ga0495602_0040461 3300048088 Bacteria 4273
147 Ga0495626_0000051 3300048091 Bacteria 156449
148 Ga0496102_0025445 3300048905 Bacteria 5269
149 Ga0496103_0204366 3300048906 Bacteria 1270
150 Ga0496104_0213752 3300048907 Bacteria 1840
151 Ga0496112_0026936 3300048915 Bacteria 5540
152 Ga0496112_0089598 3300048915 Bacteria 3044
153 Ga0496116_0000430 3300048919 Bacteria 58902
154 Ga0496117_0007890 3300048920 Bacteria 10233
155 Ga0496118_0002122 3300048921 Bacteria 27753
156 Ga0496119_0007833 3300048922 Bacteria 9520
157 Ga0496120_0030296 3300048923 Bacteria 3291
158 Ga0496121_0026745 3300048924 Bacteria 5422
159 Ga0501031_0092019 3300049568 Bacteria 1979
160 Ga0501031_0346843 3300049568 Bacteria 961
161 Ga0501033_0101105 3300049570 Bacteria 2103
162 Ga0501033_0296287 3300049570 Bacteria 1140
163 Ga0501037_0085401 3300049573 Bacteria 2285
164 Ga0501046_0044794 3300049580 Bacteria 3518
165 Ga0501047_0121981 3300049581 Bacteria 2488
166 Ga0501047_0123555 3300049581 Bacteria 2469
167 Ga0501047_0260168 3300049581 Bacteria 1583
168 Ga0501071_0497862 3300049587 Bacteria 935
169 Ga0501035_0036693 3300049822 Bacteria 4441
170 Ga0501044_0103514 3300049823 Bacteria 2861
171 Ga0501044_0255878 3300049823 Bacteria 1690
172 nmdc:mga05p37_11285_c1 3300050507 Bacteria 10626
173 nmdc:mga09592_29875_c1 3300050508 Bacteria 4533
174 nmdc:mga0qj67_5698_c1 3300050509 Bacteria 9110
175 nmdc:mga06r32_12807_c1 3300050510 Bacteria 7583
176 nmdc:mga06r32_453755_c1 3300050510 Bacteria 1261
177 Ga0495601_0022754 3300053077 Bacteria 3851
178 Ga0495619_0026724 3300053085 Bacteria 3715
179 Ga0500616_0014465 3300053153 Bacteria 4534
180 2506867800 2506783011 Bacteria 5323186
181 2554259426 2554235005 Bacteria 6457341
182 2585303677 2582581313 Bacteria 10042643
183 2586064014 2585427649 Bacteria 9053857
184 2643760070 2643221548 Bacteria 8053412
185 2643946432 2643221587 Bacteria 7586415
186 2644268150 2643221647 Bacteria 10741251
187 2644389222 2643221670 Bacteria 6497041
188 2644434236 2643221677 Bacteria 7584031
189 2644460231 2643221682 Bacteria 6743283
190 2686538394 2684623035 Bacteria 8032739
191 2774901863 2773857933 Bacteria 5818019
192 2809586736 2808606522 Bacteria 9488490
193 2862186140 2862178590 Bacteria 8583590
194 2862289530 2862281513 Bacteria 9621493
195 2862583602 2862574272 Bacteria 10567477
196 2863406848 2863404153 Bacteria 9672205
197 2866618612 2866612099 Bacteria 7543886
198 2867303063 2867302475 Bacteria 7087181
199 2867433540 2867428634 Bacteria 9590268
200 2887485388 2887478801 Bacteria 8972725
201 2895889536 2895880812 Bacteria 11255272
202 2912759002 2912757875 Bacteria 7940295
203 2915776100 2915768154 Bacteria 8424322
204 2917740524 2917736166 Bacteria 9690793
205 2918502642 2918501144 Bacteria 8668083
206 2946074046 2946072368 Bacteria 8999607
207 2954388512 2954380949 Bacteria 10050426
208 2954699302 2954691527 Bacteria 10720516
209 2954702917 2954701450 Bacteria 10834262
210 2954718246 2954711539 Bacteria 10867210
211 2954728216 2954721474 Bacteria 10456478
212 2954733593 2954731030 Bacteria 10243860
213 2954747110 2954740390 Bacteria 10229294
214 2954752477 2954749733 Bacteria 10366972
215 2954766223 2954759201 Bacteria 9358192
216 3003009289 3002998708 Bacteria 11715108
217 3006323504 3006321560 Bacteria 8247479
218 3006491348 3006486233 Bacteria 8157040
219 8001783902 8001781756 Bacteria 9586736
220 8002775202 8002775197 Bacteria 10728764
221 8002785237 8002784119 Bacteria 9788632
222 8003322224 8003314358 Bacteria 10575343
223 8025530964 8025530807 Bacteria 8495698
224 8055173846 8055172936 Bacteria 9305943
225 Ga0372808_002460
226 Ga0070658_10026724
227 Ga0068868_100034477
228 Ga0068868_100193952
229 Ga0070660_100302238
230 Ga0070659_100000483
231 Ga0070714_100321173
232 Ga0070708_100207707
233 Ga0070708_100320372
234 Ga0070708_100485930
235 Ga0070663_100002182
236 Ga0070706_100107110
237 Ga0070679_100040124
238 Ga0070679_100294821
239 Ga0070684_100018347
240 Ga0070665_100265837
241 Ga0068855_100603047
242 Ga0068859_100001588
243 Ga0068864_100325891
244 Ga0068858_100000084
245 Ga0068862_100001306
246 Ga0068862_100599935
247 Ga0081455_10000424
248 Ga0070717_10167724
249 Ga0075363_100135822
250 Ga0075428_100021287
251 Ga0075430_100026035
252 Ga0075431_100048574
253 Ga0075431_100320846
254 Ga0075429_100014077
255 Ga0097620_100001588
256 Ga0099826_10031793
257 Ga0105247_10010933
258 Ga0114129_10000822
259 Ga0105248_10093294
260 Ga0105249_10017077
261 Ga0157372_10173282
262 Ga0163163_10021569
263 Ga0163163_10538622
264 Ga0157379_10000076
265 Ga0197907_10156750
266 Ga0206353_11749115
267 Ga0213875_10037587
268 Ga0207710_10000023
269 Ga0207684_10272871
270 Ga0207684_10460937
271 Ga0207660_10209463
272 Ga0207657_10106499
273 Ga0207652_10019415
274 Ga0207652_10191435
275 Ga0207664_10528440
276 Ga0207690_10002958
277 Ga0207711_10042971
278 Ga0207667_10149239
279 Ga0207712_10209085
280 Ga0207658_10116500
281 Ga0207677_10021665
282 Ga0207677_10165157
283 Ga0207703_10000003
284 Ga0207678_10000391
285 Ga0207641_10064280
286 Ga0207676_10074123
287 Ga0268265_10000024
288 Ga0307515_10023232
289 Ga0307515_10275844
290 Ga0307512_10000948
291 Ga0307512_10011178
292 Ga0307512_10048273
293 Ga0307513_10068045
294 Ga0316579_10000264
295 Ga0307413_10249046
296 Ga0307518_10000241
297 Ga0307406_10107940
298 Ga0307407_10322814
299 Ga0307507_10010614
300 Ga0307507_10169532
301 Ga0373956_0000783
302 Ga0373955_0114953
303 Ga0373937_0313311
304 Ga0436364_0797680
305 Ga0395901_0034370
306 Ga0436363_1683835
307 Ga0450898_000025
308 Ga0466969_0008814
309 Ga0466969_0035090
310 Ga0466969_0035140
311 Ga0466972_0022673
312 Ga0466966_0008860
313 Ga0466966_0025879
314 Ga0466961_0023361
315 Ga0466961_0134949
316 Ga0466961_0137371
317 Ga0466961_0147984
318 Ga0466963_0024791
319 Ga0466963_0055865
320 Ga0466971_0026835
321 Ga0466968_0063880
322 Ga0466957_0488347
323 Ga0466959_0013969
324 Ga0466959_0031801
325 Ga0466959_0415748
326 Ga0466958_0037424
327 Ga0466958_0279549
328 Ga0495592_0037034
329 Ga0495603_0015403
330 Ga0495638_0190455
331 Ga0495651_0000834
332 Ga0495651_0236975
333 Ga0495653_0046989
334 Ga0495585_0038139
335 Ga0495606_0000832
336 Ga0495608_0001639
337 Ga0495618_0006780
338 Ga0495628_0028036
339 Ga0495628_0030326
340 Ga0495628_0455824
341 Ga0495652_0000776
342 Ga0495652_0002071
343 Ga0495652_0039121
344 Ga0495640_0284853
345 Ga0495587_0125119
346 Ga0495609_0048626
347 Ga0495645_0021600
348 Ga0495667_0012014
349 Ga0495668_0000390
350 Ga0495625_0000161
351 Ga0495635_0015650
352 Ga0495657_0020622
353 Ga0495599_0031893
354 Ga0495623_0010691
355 Ga0495623_0044924
356 Ga0495600_0004773
357 Ga0495600_0044932
358 Ga0495581_0150968
359 Ga0495604_0035121
360 Ga0495604_0088940
361 Ga0495674_0019785
362 Ga0495676_0023614
363 Ga0495676_0045341
364 Ga0495680_0028098
365 Ga0495683_0029868
366 Ga0495683_0081404
367 Ga0495675_0017817
368 Ga0495684_0015130
369 Ga0495686_0007601
370 Ga0495602_0040461
371 Ga0495626_0000051
372 Ga0496102_0025445
373 Ga0496103_0204366
374 Ga0496104_0213752
375 Ga0496112_0026936
376 Ga0496112_0089598
377 Ga0496116_0000430
378 Ga0496117_0007890
379 Ga0496118_0002122
380 Ga0496119_0007833
381 Ga0496120_0030296
382 Ga0496121_0026745
383 Ga0501031_0092019
384 Ga0501031_0346843
385 Ga0501033_0101105
386 Ga0501033_0296287
387 Ga0501037_0085401
388 Ga0501046_0044794
389 Ga0501047_0121981
390 Ga0501047_0123555
391 Ga0501047_0260168
392 Ga0501071_0497862
393 Ga0501035_0036693
394 Ga0501044_0103514
395 Ga0501044_0255878
396 nmdc:mga05p37_11285_c1
397 nmdc:mga09592_29875_c1
398 nmdc:mga0qj67_5698_c1
399 nmdc:mga06r32_12807_c1
400 nmdc:mga06r32_453755_c1
401 Ga0495601_0022754
402 Ga0495619_0026724
403 Ga0500616_0014465
404 2506867800
405 2554259426
406 2585303677
407 2586064014
408 2643760070
409 2643946432
410 2644268150
411 2644389222
412 2644434236
413 2644460231
414 2686538394
415 2774901863
416 2809586736
417 2862186140
418 2862289530
419 2862583602
420 2863406848
421 2866618612
422 2867303063
423 2867433540
424 2887485388
425 2895889536
426 2912759002
427 2915776100
428 2917740524
429 2918502642
430 2946074046
431 2954388512
432 2954699302
433 2954702917
434 2954718246
435 2954728216
436 2954733593
437 2954747110
438 2954752477
439 2954766223
440 3003009289
441 3006323504
442 3006491348
443 8001783902
444 8002775202
445 8002785237
446 8003322224
447 8025530964
448 8055173846

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01497

Peripla_BP_2

Periplasmic binding protein

32

227

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
5m2q-assembly2.cif.gz_B structure of cobinamide-bound btuf mutant w66f, the periplasmic vitamin b12 binding protein in e.coli 0.8426 19 250
5m34-assembly2.cif.gz_B structure of cobinamide-bound btuf mutant w66y, the periplasmic vitamin b12 binding protein in e.coli 0.8417 19 250
2yx6-assembly1.cif.gz_A-2 crystal structure of ph0822 0.8308 67 102
5m29-assembly2.cif.gz_B structure of cobinamide-bound btuf, the periplasmic vitamin b12 binding protein in e.coli 0.8289 19 250
5m34-assembly1.cif.gz_A structure of cobinamide-bound btuf mutant w66y, the periplasmic vitamin b12 binding protein in e.coli 0.8261 19 251
ID Description Score Start End Superfamily
af_Q2G0F6_19_140_3.40.50.1980 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.8664 20 122 3.40.50.1980
af_P37028_21_140_3.40.50.1980 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.8597 19 121 3.40.50.1980
3pshA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.8591 3 104 3.40.50.1980
4hn9B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.8465 3 121 3.40.50.1980
2r79A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.8409 19 134 3.40.50.1980
ID Description Score Start End GO Terms
AF-A0A6G3DHX3-F1-model_v4 Cobalamin-binding protein 0.9997 21 98
AF-D3D3G8-F1-model_v4 Putative periplasmic substrate-binding protein 0.997 6 251
AF-A0A1S1QRX1-F1-model_v4 Cobalamin-binding protein 0.9937 6 252
AF-A0A7K3D9Y0-F1-model_v4 Cobalamin-binding protein 0.9925 21 119
AF-A0A7V9ZHZ8-F1-model_v4 ABC transporter substrate-binding protein 0.9921 18 103

Map