F336796
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 224 | 137 | 224 | 414 |
Family's Representative Sequence
| Representative Sequence | 3300025915|Ga0207693_10081758|Ga0207693_100817583 |
| Length | 494 |
| Sequence | VLVRLVLLCGLVAVLAAPGVATASSSIRYGVQDDAWIADGNGTLAQRLNRLKELGVQIVRYNLRWDQVAKRKPKSPTSTTDPAYDWQPSDVFLKGLKARGIAPLVTIYGTPTWANGGRAPSWAPKTGAMMAAFAHAAAKRYPWVKRWAIWNEPNQRRWLKPSSPVIYTVRLLNPAYAAIHAVIRGAQVAGGVTAPRGNAGGVSPVDWIQGMKRAGARLDAYAHNPYPLSPHTETPWSGGCEGCRTLTMATLPKLINDVTKAFGPKRIWLTEYGYQTNPPDPYIGVSDALQAEYMSAAALRAYLAPRVDVLIHFLVRDEPDLAGWQSGVLNIKGVAKPSYRAFQLPLAQESRAGSRTVLWGQVRPGHGRRTYRLQKLVNGRWAWYGGTARTSSGGFFTRSVTGAAHDRFRLWAPSLRVFGPPRGPERLGPVSFEIDGIHAHDVSEILDRHGVAVRAGHHCAQPATARASFGVYTTEEEIDRLVEGLQDARRIFGL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 6 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 17 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 22 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 23 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 25 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 26 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 27 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 28 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 29 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 30 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 32 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 33 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 34 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 50 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 73 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 74 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 75 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 76 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 77 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 78 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 79 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 80 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 81 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 82 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 83 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 84 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 85 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 86 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 87 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 88 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 89 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 90 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 91 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 92 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 93 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 94 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 95 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 96 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 97 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 98 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 99 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 100 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 101 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 102 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 103 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 105 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 106 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 107 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 108 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 109 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 110 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 111 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 112 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 113 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 114 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 115 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 116 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 117 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 118 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 119 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 120 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 121 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 122 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 123 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 124 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 125 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 126 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 127 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 128 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 129 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 130 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 131 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 132 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 133 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 134 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 135 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 136 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 137 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.11 |
| Metatranscriptomes | 0.89 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.12 |
| Nodule | 0 |
| Rhizoplane | 4.46 |
| Rhizosphere | 92.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARcpr5oldR_c002523 | 3300000041 | Unclassified | 1686 |
| 2 | Ga0070658_10014170 | 3300005327 | Bacteria | 6399 |
| 3 | Ga0070683_100009572 | 3300005329 | Bacteria | 8295 |
| 4 | Ga0070683_100013904 | 3300005329 | Bacteria | 7032 |
| 5 | Ga0070683_100068492 | 3300005329 | Bacteria | 3307 |
| 6 | Ga0070683_100168592 | 3300005329 | Bacteria | 2078 |
| 7 | Ga0070683_100179313 | 3300005329 | Bacteria | 2011 |
| 8 | Ga0070680_100046448 | 3300005336 | Bacteria | 3532 |
| 9 | Ga0068868_100028190 | 3300005338 | Unclassified | 4291 |
| 10 | Ga0070660_100000505 | 3300005339 | Bacteria | 26077 |
| 11 | Ga0070661_100030112 | 3300005344 | Bacteria | 3920 |
| 12 | Ga0070674_100178899 | 3300005356 | Bacteria | 1623 |
| 13 | Ga0070688_100123743 | 3300005365 | Bacteria | 1735 |
| 14 | Ga0070659_100003363 | 3300005366 | Bacteria | 11382 |
| 15 | Ga0070659_100081987 | 3300005366 | Bacteria | 2576 |
| 16 | Ga0070659_100102512 | 3300005366 | Bacteria | 2304 |
| 17 | Ga0070709_10004173 | 3300005434 | Bacteria | 7787 |
| 18 | Ga0070714_100233140 | 3300005435 | Unclassified | 1696 |
| 19 | Ga0070708_100216110 | 3300005445 | Bacteria | 1797 |
| 20 | Ga0070662_100080172 | 3300005457 | Bacteria | 2430 |
| 21 | Ga0070681_10000545 | 3300005458 | Bacteria | 31026 |
| 22 | Ga0070681_10038180 | 3300005458 | Bacteria | 4816 |
| 23 | Ga0070681_10048820 | 3300005458 | Bacteria | 4227 |
| 24 | Ga0070681_10118136 | 3300005458 | Bacteria | 2588 |
| 25 | Ga0070681_10209714 | 3300005458 | Bacteria | 1864 |
| 26 | Ga0068867_100100895 | 3300005459 | Bacteria | 2204 |
| 27 | Ga0070706_100141715 | 3300005467 | Bacteria | 2244 |
| 28 | Ga0070707_100091675 | 3300005468 | Bacteria | 2942 |
| 29 | Ga0070679_100038252 | 3300005530 | Bacteria | 4769 |
| 30 | Ga0070679_100042438 | 3300005530 | Bacteria | 4529 |
| 31 | Ga0070679_100090308 | 3300005530 | Bacteria | 3051 |
| 32 | Ga0070679_100113267 | 3300005530 | Bacteria | 2698 |
| 33 | Ga0070679_100287264 | 3300005530 | Unclassified | 1597 |
| 34 | Ga0070684_100136845 | 3300005535 | Bacteria | 2213 |
| 35 | Ga0068853_100153311 | 3300005539 | Bacteria | 2075 |
| 36 | Ga0068855_100053947 | 3300005563 | Bacteria | 4728 |
| 37 | Ga0068855_100084051 | 3300005563 | Bacteria | 3686 |
| 38 | Ga0068855_100113115 | 3300005563 | Bacteria | 3114 |
| 39 | Ga0070664_100333456 | 3300005564 | Bacteria | 1377 |
| 40 | Ga0068857_100014399 | 3300005577 | Bacteria | 6896 |
| 41 | Ga0068856_100191353 | 3300005614 | Unclassified | 2060 |
| 42 | Ga0081455_10020460 | 3300005937 | Bacteria | 6227 |
| 43 | Ga0081455_10029594 | 3300005937 | Bacteria | 4991 |
| 44 | Ga0081455_10132597 | 3300005937 | Bacteria | 1946 |
| 45 | Ga0081539_10007768 | 3300005985 | Bacteria | 9606 |
| 46 | Ga0075365_10005836 | 3300006038 | Bacteria | 6694 |
| 47 | Ga0075364_10119641 | 3300006051 | Bacteria | 1762 |
| 48 | Ga0070712_100032131 | 3300006175 | Bacteria | 3542 |
| 49 | Ga0075428_100020693 | 3300006844 | Bacteria | 7286 |
| 50 | Ga0075428_100264163 | 3300006844 | Bacteria | 1853 |
| 51 | Ga0075433_10045559 | 3300006852 | Bacteria | 3813 |
| 52 | Ga0075429_100015563 | 3300006880 | Bacteria | 6590 |
| 53 | Ga0105240_10063569 | 3300009093 | Bacteria | 4591 |
| 54 | Ga0105240_10169007 | 3300009093 | Bacteria | 2591 |
| 55 | Ga0105245_10018625 | 3300009098 | Bacteria | 6072 |
| 56 | Ga0105245_10051176 | 3300009098 | Bacteria | 3703 |
| 57 | Ga0105245_10086653 | 3300009098 | Bacteria | 2873 |
| 58 | Ga0105245_10125535 | 3300009098 | Bacteria | 2402 |
| 59 | Ga0114129_10083419 | 3300009147 | Bacteria | 4440 |
| 60 | Ga0105243_10049356 | 3300009148 | Bacteria | 3320 |
| 61 | Ga0105242_10109470 | 3300009176 | Bacteria | 2352 |
| 62 | Ga0105237_10045480 | 3300009545 | Bacteria | 4417 |
| 63 | Ga0105238_10064488 | 3300009551 | Bacteria | 3663 |
| 64 | Ga0105249_10260353 | 3300009553 | Unclassified | 1723 |
| 65 | Ga0105239_10296746 | 3300010375 | Bacteria | 1820 |
| 66 | Ga0157370_10041019 | 3300013104 | Bacteria | 4468 |
| 67 | Ga0157370_10057690 | 3300013104 | Bacteria | 3690 |
| 68 | Ga0157370_10122406 | 3300013104 | Bacteria | 2429 |
| 69 | Ga0157369_10063912 | 3300013105 | Bacteria | 3965 |
| 70 | Ga0157369_10070430 | 3300013105 | Bacteria | 3757 |
| 71 | Ga0157372_10190131 | 3300013307 | Bacteria | 2378 |
| 72 | Ga0157375_10355550 | 3300013308 | Bacteria | 1631 |
| 73 | Ga0157380_10028824 | 3300014326 | Bacteria | 4238 |
| 74 | Ga0157380_10305957 | 3300014326 | Bacteria | 1466 |
| 75 | Ga0157380_10446139 | 3300014326 | Unclassified | 1241 |
| 76 | Ga0157377_10040516 | 3300014745 | Bacteria | 2580 |
| 77 | Ga0157377_10042656 | 3300014745 | Bacteria | 2520 |
| 78 | Ga0206353_11078444 | 3300020082 | Bacteria | 2144 |
| 79 | Ga0206353_11410606 | 3300020082 | Unclassified | 1798 |
| 80 | Ga0207699_10018344 | 3300025906 | Bacteria | 3706 |
| 81 | Ga0207705_10152970 | 3300025909 | Bacteria | 1729 |
| 82 | Ga0207707_10009760 | 3300025912 | Bacteria | 8328 |
| 83 | Ga0207695_10099307 | 3300025913 | Bacteria | 2909 |
| 84 | Ga0207671_10029537 | 3300025914 | Bacteria | 4093 |
| 85 | Ga0207693_10081758 | 3300025915 | Bacteria | 2529 |
| 86 | Ga0207660_10030504 | 3300025917 | Bacteria | 3706 |
| 87 | Ga0207660_10053615 | 3300025917 | Bacteria | 2875 |
| 88 | Ga0207660_10236979 | 3300025917 | Bacteria | 1436 |
| 89 | Ga0207657_10006496 | 3300025919 | Bacteria | 12116 |
| 90 | Ga0207657_10006895 | 3300025919 | Bacteria | 11718 |
| 91 | Ga0207652_10033508 | 3300025921 | Bacteria | 4326 |
| 92 | Ga0207652_10081320 | 3300025921 | Bacteria | 2834 |
| 93 | Ga0207652_10093930 | 3300025921 | Bacteria | 2640 |
| 94 | Ga0207652_10137228 | 3300025921 | Unclassified | 2185 |
| 95 | Ga0207652_10184701 | 3300025921 | Bacteria | 1875 |
| 96 | Ga0207646_10023255 | 3300025922 | Bacteria | 5695 |
| 97 | Ga0207700_10000004 | 3300025928 | Bacteria | 443409 |
| 98 | Ga0207690_10037331 | 3300025932 | Bacteria | 3154 |
| 99 | Ga0207690_10039952 | 3300025932 | Bacteria | 3064 |
| 100 | Ga0207709_10069860 | 3300025935 | Bacteria | 2225 |
| 101 | Ga0207709_10105294 | 3300025935 | Bacteria | 1874 |
| 102 | Ga0207669_10136179 | 3300025937 | Unclassified | 1697 |
| 103 | Ga0207704_10247018 | 3300025938 | Unclassified | 1337 |
| 104 | Ga0207665_10004989 | 3300025939 | Bacteria | 8858 |
| 105 | Ga0207661_10107466 | 3300025944 | Bacteria | 2354 |
| 106 | Ga0207667_10100609 | 3300025949 | Bacteria | 2982 |
| 107 | Ga0207639_10039839 | 3300026041 | Bacteria | 3504 |
| 108 | Ga0207639_10089650 | 3300026041 | Bacteria | 2458 |
| 109 | Ga0207708_10020293 | 3300026075 | Bacteria | 5012 |
| 110 | Ga0207674_10010915 | 3300026116 | Bacteria | 10228 |
| 111 | Ga0207674_10094087 | 3300026116 | Bacteria | 2984 |
| 112 | Ga0207698_10097720 | 3300026142 | Bacteria | 2424 |
| 113 | Ga0207698_10204326 | 3300026142 | Bacteria | 1772 |
| 114 | Ga0207428_10000383 | 3300027907 | Bacteria | 55634 |
| 115 | Ga0265322_10003057 | 3300028654 | Bacteria | 5099 |
| 116 | Ga0265338_10007452 | 3300028800 | Bacteria | 13579 |
| 117 | Ga0265325_10011650 | 3300031241 | Bacteria | 5049 |
| 118 | Ga0265339_10028529 | 3300031249 | Unclassified | 3173 |
| 119 | Ga0265316_10031810 | 3300031344 | Bacteria | 4311 |
| 120 | Ga0265314_10010645 | 3300031711 | Bacteria | 7653 |
| 121 | Ga0307416_100154131 | 3300032002 | Bacteria | 2112 |
| 122 | Ga0373936_0006669 | 3300035113 | Bacteria | 4347 |
| 123 | Ga0373943_0001805 | 3300035170 | Bacteria | 9679 |
| 124 | Ga0373937_0039747 | 3300036401 | Bacteria | 4287 |
| 125 | Ga0373925_0019056 | 3300037068 | Bacteria | 4989 |
| 126 | Ga0395899_0128195 | 3300037312 | Bacteria | 1813 |
| 127 | Ga0395900_0011636 | 3300037418 | Bacteria | 9003 |
| 128 | Ga0395900_0069820 | 3300037418 | Bacteria | 3611 |
| 129 | Ga0395900_0072448 | 3300037418 | Bacteria | 3542 |
| 130 | Ga0395900_0092178 | 3300037418 | Bacteria | 3113 |
| 131 | Ga0395900_0115905 | 3300037418 | Unclassified | 2749 |
| 132 | Ga0395900_0161935 | 3300037418 | Bacteria | 2281 |
| 133 | Ga0395898_0007918 | 3300037466 | Bacteria | 11273 |
| 134 | Ga0395898_0041036 | 3300037466 | Bacteria | 4573 |
| 135 | Ga0395898_0081456 | 3300037466 | Bacteria | 3121 |
| 136 | Ga0395905_0054383 | 3300037471 | Bacteria | 3747 |
| 137 | Ga0395905_0059329 | 3300037471 | Bacteria | 3577 |
| 138 | Ga0395905_0137133 | 3300037471 | Bacteria | 2302 |
| 139 | Ga0395901_0009303 | 3300038443 | Bacteria | 9957 |
| 140 | Ga0395901_0010015 | 3300038443 | Bacteria | 9609 |
| 141 | Ga0395901_0029481 | 3300038443 | Bacteria | 5651 |
| 142 | Ga0395901_0363273 | 3300038443 | Bacteria | 1492 |
| 143 | Ga0439433_0007863 | 3300041999 | Bacteria | 2305 |
| 144 | Ga0439451_003997 | 3300042009 | Bacteria | 2998 |
| 145 | Ga0450920_005071 | 3300042122 | Unclassified | 2335 |
| 146 | Ga0450907_012138 | 3300042146 | Bacteria | 1432 |
| 147 | Ga0439446_0014334 | 3300042156 | Bacteria | 2187 |
| 148 | Ga0439434_0018829 | 3300042435 | Bacteria | 2069 |
| 149 | Ga0466966_0046455 | 3300044684 | Bacteria | 2772 |
| 150 | Ga0466966_0052311 | 3300044684 | Bacteria | 2595 |
| 151 | Ga0466961_0002965 | 3300044693 | Bacteria | 10538 |
| 152 | Ga0466961_0030614 | 3300044693 | Bacteria | 3459 |
| 153 | Ga0466963_0012114 | 3300044694 | Bacteria | 5270 |
| 154 | Ga0466963_0016626 | 3300044694 | Bacteria | 4577 |
| 155 | Ga0466963_0048070 | 3300044694 | Bacteria | 2817 |
| 156 | Ga0466964_0015114 | 3300044706 | Bacteria | 2939 |
| 157 | Ga0466968_0003327 | 3300044735 | Bacteria | 5933 |
| 158 | Ga0466959_0007516 | 3300045049 | Bacteria | 7652 |
| 159 | Ga0466959_0135614 | 3300045049 | Bacteria | 1742 |
| 160 | Ga0466958_0026545 | 3300045836 | Bacteria | 3423 |
| 161 | Ga0466967_0041417 | 3300045976 | Bacteria | 3971 |
| 162 | Ga0466967_0046879 | 3300045976 | Bacteria | 3765 |
| 163 | Ga0466967_0069238 | 3300045976 | Bacteria | 3153 |
| 164 | Ga0466967_0077300 | 3300045976 | Bacteria | 2996 |
| 165 | Ga0466967_0084772 | 3300045976 | Bacteria | 2867 |
| 166 | Ga0466967_0087002 | 3300045976 | Bacteria | 2832 |
| 167 | Ga0466967_0138281 | 3300045976 | Bacteria | 2267 |
| 168 | Ga0466967_0162841 | 3300045976 | Bacteria | 2095 |
| 169 | Ga0495641_0043215 | 3300046461 | Bacteria | 2085 |
| 170 | Ga0496100_0037431 | 3300048903 | Bacteria | 3067 |
| 171 | Ga0496101_0083015 | 3300048904 | Bacteria | 2371 |
| 172 | Ga0496107_0028393 | 3300048910 | Bacteria | 3975 |
| 173 | Ga0496107_0033527 | 3300048910 | Bacteria | 3674 |
| 174 | Ga0496109_0164074 | 3300048912 | Bacteria | 2082 |
| 175 | Ga0496109_0303725 | 3300048912 | Bacteria | 1505 |
| 176 | Ga0496111_0073188 | 3300048914 | Bacteria | 2495 |
| 177 | Ga0496111_0160367 | 3300048914 | Bacteria | 1670 |
| 178 | Ga0496111_0190426 | 3300048914 | Bacteria | 1525 |
| 179 | Ga0496115_0244577 | 3300048918 | Unclassified | 1478 |
| 180 | Ga0501037_0094950 | 3300049573 | Unclassified | 2156 |
| 181 | Ga0501038_0027111 | 3300049574 | Bacteria | 5100 |
| 182 | Ga0501038_0233110 | 3300049574 | Unclassified | 1464 |
| 183 | Ga0501040_0005455 | 3300049576 | Bacteria | 8227 |
| 184 | Ga0501040_0063942 | 3300049576 | Bacteria | 2533 |
| 185 | Ga0501040_0128692 | 3300049576 | Unclassified | 1779 |
| 186 | Ga0501042_0085589 | 3300049578 | Unclassified | 2260 |
| 187 | Ga0501042_0204686 | 3300049578 | Bacteria | 1423 |
| 188 | Ga0501046_0021760 | 3300049580 | Archaea | 5287 |
| 189 | Ga0501046_0192137 | 3300049580 | Unclassified | 1522 |
| 190 | Ga0501067_0014686 | 3300049583 | Bacteria | 4333 |
| 191 | Ga0501068_0025281 | 3300049584 | Bacteria | 3493 |
| 192 | Ga0501068_0068277 | 3300049584 | Unclassified | 2166 |
| 193 | Ga0501069_0034416 | 3300049585 | Bacteria | 2790 |
| 194 | Ga0501071_0065797 | 3300049587 | Unclassified | 2633 |
| 195 | Ga0501072_0017922 | 3300049588 | Bacteria | 5444 |
| 196 | Ga0501074_0063120 | 3300049590 | Bacteria | 2668 |
| 197 | Ga0501075_0031562 | 3300049591 | Bacteria | 3933 |
| 198 | Ga0501075_0114165 | 3300049591 | Bacteria | 2054 |
| 199 | Ga0501075_0157855 | 3300049591 | Bacteria | 1730 |
| 200 | Ga0501075_0176680 | 3300049591 | Unclassified | 1629 |
| 201 | Ga0501076_0013174 | 3300049592 | Bacteria | 6193 |
| 202 | Ga0501077_0023563 | 3300049593 | Bacteria | 3903 |
| 203 | Ga0501079_0020024 | 3300049741 | Bacteria | 5111 |
| 204 | Ga0501079_0215122 | 3300049741 | Bacteria | 1501 |
| 205 | Ga0501080_0065205 | 3300049742 | Bacteria | 3388 |
| 206 | Ga0501081_0020095 | 3300049743 | Bacteria | 4451 |
| 207 | Ga0501081_0030600 | 3300049743 | Bacteria | 3644 |
| 208 | Ga0501045_0054128 | 3300049824 | Bacteria | 2933 |
| 209 | nmdc:mga00v17_28268_c1 | 3300050491 | Bacteria | 3283 |
| 210 | nmdc:mga0yw44_11949_c1 | 3300050492 | Bacteria | 4507 |
| 211 | nmdc:mga0yw44_43656_c1 | 3300050492 | Bacteria | 2678 |
| 212 | nmdc:mga0yw44_50080_c1 | 3300050492 | Bacteria | 2524 |
| 213 | nmdc:mga0yw44_70058_c1 | 3300050492 | Unclassified | 2173 |
| 214 | nmdc:mga05p37_13459_c1 | 3300050507 | Bacteria | 9803 |
| 215 | nmdc:mga05p37_170089_c1 | 3300050507 | Bacteria | 2658 |
| 216 | nmdc:mga09592_84265_c1 | 3300050508 | Bacteria | 2710 |
| 217 | nmdc:mga0n895_7930_c1 | 3300050512 | Bacteria | 9156 |
| 218 | nmdc:mga0a205_42610_c1 | 3300050515 | Bacteria | 4374 |
| 219 | Ga0501084_0017117 | 3300054114 | Bacteria | 6022 |
| 220 | Ga0501084_0088240 | 3300054114 | Bacteria | 2604 |
| 221 | Ga0501084_0248738 | 3300054114 | Bacteria | 1501 |
| 222 | Ga0590077_008788 | 3300059426 | Bacteria | 2068 |
| 223 | Ga0466962_0032459 | 3300061719 | Bacteria | 2500 |
| 224 | Ga0530510_0058227 | 3300061734 | Bacteria | 2794 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300045976 | Ga0466967_0069238 | Ga0466967_0069238_1215_2444 | 383 |
| 2 | 3300009098 | Ga0105245_10018625 | Ga0105245_100186256 | 385 |
| 3 | 3300014745 | Ga0157377_10042656 | Ga0157377_100426561 | 385 |
| 4 | 3300048912 | Ga0496109_0303725 | Ga0496109_0303725_232_1431 | 388 |
| 5 | 3300042146 | Ga0450907_012138 | Ga0450907_012138_95_1339 | 389 |
| 6 | 3300048912 | Ga0496109_0164074 | Ga0496109_0164074_161_1405 | 392 |
| 7 | 3300048914 | Ga0496111_0190426 | Ga0496111_0190426_26_1270 | 392 |
| 8 | 3300009098 | Ga0105245_10125535 | Ga0105245_101255353 | 394 |
| 9 | 3300044694 | Ga0466963_0048070 | Ga0466963_0048070_1018_2262 | 395 |
| 10 | 3300042009 | Ga0439451_003997 | Ga0439451_003997_898_2175 | 396 |
| 11 | 3300014326 | Ga0157380_10446139 | Ga0157380_104461391 | 397 |
| 12 | 3300037418 | Ga0395900_0069820 | Ga0395900_0069820_2254_3501 | 397 |
| 13 | 3300038443 | Ga0395901_0009303 | Ga0395901_0009303_8444_9691 | 397 |
| 14 | 3300025913 | Ga0207695_10099307 | Ga0207695_100993072 | 398 |
| 15 | 3300037418 | Ga0395900_0092178 | Ga0395900_0092178_1271_2530 | 399 |
| 16 | 3300037466 | Ga0395898_0041036 | Ga0395898_0041036_1093_2340 | 399 |
| 17 | 3300037466 | Ga0395898_0081456 | Ga0395898_0081456_644_1903 | 399 |
| 18 | 3300037471 | Ga0395905_0137133 | Ga0395905_0137133_703_1950 | 399 |
| 19 | 3300005985 | Ga0081539_10007768 | Ga0081539_100077686 | 400 |
| 20 | 3300005459 | Ga0068867_100100895 | Ga0068867_1001008952 | 401 |
| 21 | 3300014326 | Ga0157380_10028824 | Ga0157380_100288242 | 401 |
| 22 | 3300045976 | Ga0466967_0087002 | Ga0466967_0087002_1257_2513 | 401 |
| 23 | 3300005535 | Ga0070684_100136845 | Ga0070684_1001368452 | 402 |
| 24 | 3300005564 | Ga0070664_100333456 | Ga0070664_1003334562 | 402 |
| 25 | 3300006051 | Ga0075364_10119641 | Ga0075364_101196412 | 402 |
| 26 | 3300050492 | nmdc:mga0yw44_43656_c1 | nmdc:mga0yw44_43656_c1_1131_2339 | 402 |
| 27 | 3300045976 | Ga0466967_0041417 | Ga0466967_0041417_1719_2975 | 403 |
| 28 | 3300006038 | Ga0075365_10005836 | Ga0075365_100058363 | 407 |
| 29 | 3300009553 | Ga0105249_10260353 | Ga0105249_102603532 | 407 |
| 30 | 3300025921 | Ga0207652_10137228 | Ga0207652_101372282 | 407 |
| 31 | 3300037418 | Ga0395900_0115905 | Ga0395900_0115905_815_2098 | 407 |
| 32 | 3300038443 | Ga0395901_0029481 | Ga0395901_0029481_240_1523 | 407 |
| 33 | 3300044684 | Ga0466966_0052311 | Ga0466966_0052311_106_1362 | 407 |
| 34 | 3300044693 | Ga0466961_0030614 | Ga0466961_0030614_512_1768 | 407 |
| 35 | 3300050492 | nmdc:mga0yw44_50080_c1 | nmdc:mga0yw44_50080_c1_887_2191 | 407 |
| 36 | 3300050492 | nmdc:mga0yw44_70058_c1 | nmdc:mga0yw44_70058_c1_894_2150 | 407 |
| 37 | 3300009098 | Ga0105245_10051176 | Ga0105245_100511764 | 408 |
| 38 | 3300049591 | Ga0501075_0114165 | Ga0501075_0114165_55_1290 | 409 |
| 39 | 3300050507 | nmdc:mga05p37_13459_c1 | nmdc:mga05p37_13459_c1_7954_9216 | 409 |
| 40 | 3300044693 | Ga0466961_0002965 | Ga0466961_0002965_7107_8342 | 410 |
| 41 | 3300045049 | Ga0466959_0135614 | Ga0466959_0135614_157_1392 | 410 |
| 42 | 3300045836 | Ga0466958_0026545 | Ga0466958_0026545_1160_2395 | 410 |
| 43 | 3300061719 | Ga0466962_0032459 | Ga0466962_0032459_728_1963 | 410 |
| 44 | 3300014326 | Ga0157380_10305957 | Ga0157380_103059572 | 411 |
| 45 | 3300028654 | Ga0265322_10003057 | Ga0265322_100030573 | 411 |
| 46 | 3300028800 | Ga0265338_10007452 | Ga0265338_1000745210 | 411 |
| 47 | 3300031241 | Ga0265325_10011650 | Ga0265325_100116505 | 411 |
| 48 | 3300031249 | Ga0265339_10028529 | Ga0265339_100285291 | 411 |
| 49 | 3300031344 | Ga0265316_10031810 | Ga0265316_100318103 | 411 |
| 50 | 3300031711 | Ga0265314_10010645 | Ga0265314_100106454 | 411 |
| 51 | 3300009176 | Ga0105242_10109470 | Ga0105242_101094703 | 412 |
| 52 | 3300025938 | Ga0207704_10247018 | Ga0207704_102470181 | 412 |
| 53 | 3300041999 | Ga0439433_0007863 | Ga0439433_0007863_1035_2276 | 412 |
| 54 | 3300042156 | Ga0439446_0014334 | Ga0439446_0014334_556_1797 | 412 |
| 55 | 3300042435 | Ga0439434_0018829 | Ga0439434_0018829_313_1554 | 412 |
| 56 | 3300044694 | Ga0466963_0016626 | Ga0466963_0016626_1935_3176 | 412 |
| 57 | 3300048903 | Ga0496100_0037431 | Ga0496100_0037431_385_1626 | 412 |
| 58 | 3300048904 | Ga0496101_0083015 | Ga0496101_0083015_23_1264 | 412 |
| 59 | 3300048910 | Ga0496107_0028393 | Ga0496107_0028393_2559_3800 | 412 |
| 60 | 3300048910 | Ga0496107_0033527 | Ga0496107_0033527_1014_2255 | 412 |
| 61 | 3300005327 | Ga0070658_10014170 | Ga0070658_100141704 | 413 |
| 62 | 3300005329 | Ga0070683_100013904 | Ga0070683_1000139043 | 413 |
| 63 | 3300005329 | Ga0070683_100168592 | Ga0070683_1001685922 | 413 |
| 64 | 3300005329 | Ga0070683_100179313 | Ga0070683_1001793132 | 413 |
| 65 | 3300005336 | Ga0070680_100046448 | Ga0070680_1000464483 | 413 |
| 66 | 3300005339 | Ga0070660_100000505 | Ga0070660_1000005054 | 413 |
| 67 | 3300005344 | Ga0070661_100030112 | Ga0070661_1000301127 | 413 |
| 68 | 3300005356 | Ga0070674_100178899 | Ga0070674_1001788992 | 413 |
| 69 | 3300005366 | Ga0070659_100003363 | Ga0070659_1000033634 | 413 |
| 70 | 3300005366 | Ga0070659_100102512 | Ga0070659_1001025122 | 413 |
| 71 | 3300005458 | Ga0070681_10000545 | Ga0070681_1000054519 | 413 |
| 72 | 3300005458 | Ga0070681_10038180 | Ga0070681_100381803 | 413 |
| 73 | 3300005458 | Ga0070681_10118136 | Ga0070681_101181363 | 413 |
| 74 | 3300005458 | Ga0070681_10209714 | Ga0070681_102097142 | 413 |
| 75 | 3300005530 | Ga0070679_100038252 | Ga0070679_1000382524 | 413 |
| 76 | 3300005530 | Ga0070679_100042438 | Ga0070679_1000424383 | 413 |
| 77 | 3300005530 | Ga0070679_100090308 | Ga0070679_1000903083 | 413 |
| 78 | 3300005530 | Ga0070679_100113267 | Ga0070679_1001132671 | 413 |
| 79 | 3300005539 | Ga0068853_100153311 | Ga0068853_1001533112 | 413 |
| 80 | 3300005563 | Ga0068855_100084051 | Ga0068855_1000840512 | 413 |
| 81 | 3300005563 | Ga0068855_100113115 | Ga0068855_1001131152 | 413 |
| 82 | 3300005577 | Ga0068857_100014399 | Ga0068857_1000143997 | 413 |
| 83 | 3300005614 | Ga0068856_100191353 | Ga0068856_1001913531 | 413 |
| 84 | 3300005937 | Ga0081455_10020460 | Ga0081455_100204604 | 413 |
| 85 | 3300006175 | Ga0070712_100032131 | Ga0070712_1000321313 | 413 |
| 86 | 3300009093 | Ga0105240_10169007 | Ga0105240_101690072 | 413 |
| 87 | 3300009098 | Ga0105245_10086653 | Ga0105245_100866532 | 413 |
| 88 | 3300009545 | Ga0105237_10045480 | Ga0105237_100454802 | 413 |
| 89 | 3300009551 | Ga0105238_10064488 | Ga0105238_100644884 | 413 |
| 90 | 3300010375 | Ga0105239_10296746 | Ga0105239_102967462 | 413 |
| 91 | 3300013104 | Ga0157370_10041019 | Ga0157370_100410196 | 413 |
| 92 | 3300013104 | Ga0157370_10057690 | Ga0157370_100576902 | 413 |
| 93 | 3300013104 | Ga0157370_10122406 | Ga0157370_101224062 | 413 |
| 94 | 3300013105 | Ga0157369_10063912 | Ga0157369_100639124 | 413 |
| 95 | 3300013105 | Ga0157369_10070430 | Ga0157369_100704303 | 413 |
| 96 | 3300013307 | Ga0157372_10190131 | Ga0157372_101901312 | 413 |
| 97 | 3300013308 | Ga0157375_10355550 | Ga0157375_103555502 | 413 |
| 98 | 3300020082 | Ga0206353_11078444 | Ga0206353_110784442 | 413 |
| 99 | 3300025912 | Ga0207707_10009760 | Ga0207707_1000976012 | 413 |
| 100 | 3300025914 | Ga0207671_10029537 | Ga0207671_100295376 | 413 |
| 101 | 3300025917 | Ga0207660_10030504 | Ga0207660_100305043 | 413 |
| 102 | 3300025917 | Ga0207660_10053615 | Ga0207660_100536154 | 413 |
| 103 | 3300025917 | Ga0207660_10236979 | Ga0207660_102369791 | 413 |
| 104 | 3300025919 | Ga0207657_10006496 | Ga0207657_1000649613 | 413 |
| 105 | 3300025919 | Ga0207657_10006895 | Ga0207657_1000689514 | 413 |
| 106 | 3300025921 | Ga0207652_10033508 | Ga0207652_100335084 | 413 |
| 107 | 3300025921 | Ga0207652_10081320 | Ga0207652_100813203 | 413 |
| 108 | 3300025921 | Ga0207652_10093930 | Ga0207652_100939301 | 413 |
| 109 | 3300025932 | Ga0207690_10039952 | Ga0207690_100399522 | 413 |
| 110 | 3300025935 | Ga0207709_10105294 | Ga0207709_101052941 | 413 |
| 111 | 3300025937 | Ga0207669_10136179 | Ga0207669_101361792 | 413 |
| 112 | 3300025944 | Ga0207661_10107466 | Ga0207661_101074662 | 413 |
| 113 | 3300025949 | Ga0207667_10100609 | Ga0207667_101006092 | 413 |
| 114 | 3300026041 | Ga0207639_10089650 | Ga0207639_100896502 | 413 |
| 115 | 3300026116 | Ga0207674_10010915 | Ga0207674_1001091511 | 413 |
| 116 | 3300026116 | Ga0207674_10094087 | Ga0207674_100940874 | 413 |
| 117 | 3300026142 | Ga0207698_10097720 | Ga0207698_100977202 | 413 |
| 118 | 3300032002 | Ga0307416_100154131 | Ga0307416_1001541312 | 413 |
| 119 | 3300035113 | Ga0373936_0006669 | Ga0373936_0006669_2158_3402 | 413 |
| 120 | 3300035170 | Ga0373943_0001805 | Ga0373943_0001805_6488_7732 | 413 |
| 121 | 3300037068 | Ga0373925_0019056 | Ga0373925_0019056_3178_4422 | 413 |
| 122 | 3300037312 | Ga0395899_0128195 | Ga0395899_0128195_49_1293 | 413 |
| 123 | 3300037418 | Ga0395900_0072448 | Ga0395900_0072448_571_1815 | 413 |
| 124 | 3300037418 | Ga0395900_0161935 | Ga0395900_0161935_60_1304 | 413 |
| 125 | 3300037466 | Ga0395898_0007918 | Ga0395898_0007918_4713_5957 | 413 |
| 126 | 3300038443 | Ga0395901_0010015 | Ga0395901_0010015_3743_4987 | 413 |
| 127 | 3300044684 | Ga0466966_0046455 | Ga0466966_0046455_10_1254 | 413 |
| 128 | 3300044694 | Ga0466963_0012114 | Ga0466963_0012114_2500_3744 | 413 |
| 129 | 3300044706 | Ga0466964_0015114 | Ga0466964_0015114_737_1981 | 413 |
| 130 | 3300044735 | Ga0466968_0003327 | Ga0466968_0003327_3031_4275 | 413 |
| 131 | 3300045049 | Ga0466959_0007516 | Ga0466959_0007516_457_1701 | 413 |
| 132 | 3300045976 | Ga0466967_0046879 | Ga0466967_0046879_739_1983 | 413 |
| 133 | 3300045976 | Ga0466967_0077300 | Ga0466967_0077300_413_1657 | 413 |
| 134 | 3300045976 | Ga0466967_0084772 | Ga0466967_0084772_12_1256 | 413 |
| 135 | 3300045976 | Ga0466967_0138281 | Ga0466967_0138281_228_1472 | 413 |
| 136 | 3300045976 | Ga0466967_0162841 | Ga0466967_0162841_689_1933 | 413 |
| 137 | 3300046461 | Ga0495641_0043215 | Ga0495641_0043215_127_1371 | 413 |
| 138 | 3300048918 | Ga0496115_0244577 | Ga0496115_0244577_48_1406 | 413 |
| 139 | 3300049583 | Ga0501067_0014686 | Ga0501067_0014686_3058_4302 | 413 |
| 140 | 3300049585 | Ga0501069_0034416 | Ga0501069_0034416_1046_2290 | 413 |
| 141 | 3300050512 | nmdc:mga0n895_7930_c1 | nmdc:mga0n895_7930_c1_7064_8395 | 413 |
| 142 | 3300061734 | Ga0530510_0058227 | Ga0530510_0058227_481_1725 | 413 |
| 143 | 3300005329 | Ga0070683_100009572 | Ga0070683_1000095721 | 414 |
| 144 | 3300005434 | Ga0070709_10004173 | Ga0070709_100041733 | 414 |
| 145 | 3300005435 | Ga0070714_100233140 | Ga0070714_1002331402 | 414 |
| 146 | 3300005445 | Ga0070708_100216110 | Ga0070708_1002161102 | 414 |
| 147 | 3300005467 | Ga0070706_100141715 | Ga0070706_1001417152 | 414 |
| 148 | 3300005468 | Ga0070707_100091675 | Ga0070707_1000916752 | 414 |
| 149 | 3300005563 | Ga0068855_100053947 | Ga0068855_1000539473 | 414 |
| 150 | 3300006844 | Ga0075428_100264163 | Ga0075428_1002641632 | 414 |
| 151 | 3300009093 | Ga0105240_10063569 | Ga0105240_100635694 | 414 |
| 152 | 3300009147 | Ga0114129_10083419 | Ga0114129_100834191 | 414 |
| 153 | 3300020082 | Ga0206353_11410606 | Ga0206353_114106062 | 414 |
| 154 | 3300025906 | Ga0207699_10018344 | Ga0207699_100183443 | 414 |
| 155 | 3300025909 | Ga0207705_10152970 | Ga0207705_101529702 | 414 |
| 156 | 3300025915 | Ga0207693_10081758 | Ga0207693_100817583 | 414 |
| 157 | 3300025922 | Ga0207646_10023255 | Ga0207646_100232555 | 414 |
| 158 | 3300025928 | Ga0207700_10000004 | Ga0207700_10000004306 | 414 |
| 159 | 3300025939 | Ga0207665_10004989 | Ga0207665_100049899 | 414 |
| 160 | 3300036401 | Ga0373937_0039747 | Ga0373937_0039747_2437_3711 | 414 |
| 161 | 3300037418 | Ga0395900_0011636 | Ga0395900_0011636_2213_3487 | 414 |
| 162 | 3300037471 | Ga0395905_0054383 | Ga0395905_0054383_887_2161 | 414 |
| 163 | 3300037471 | Ga0395905_0059329 | Ga0395905_0059329_1223_2476 | 414 |
| 164 | 3300038443 | Ga0395901_0363273 | Ga0395901_0363273_67_1320 | 414 |
| 165 | 3300042122 | Ga0450920_005071 | Ga0450920_005071_830_2077 | 414 |
| 166 | 3300048914 | Ga0496111_0073188 | Ga0496111_0073188_256_1533 | 414 |
| 167 | 3300048914 | Ga0496111_0160367 | Ga0496111_0160367_228_1502 | 414 |
| 168 | 3300049573 | Ga0501037_0094950 | Ga0501037_0094950_261_1508 | 414 |
| 169 | 3300049574 | Ga0501038_0027111 | Ga0501038_0027111_2922_4169 | 414 |
| 170 | 3300049576 | Ga0501040_0005455 | Ga0501040_0005455_3141_4388 | 414 |
| 171 | 3300049578 | Ga0501042_0085589 | Ga0501042_0085589_30_1277 | 414 |
| 172 | 3300049578 | Ga0501042_0204686 | Ga0501042_0204686_115_1362 | 414 |
| 173 | 3300049580 | Ga0501046_0021760 | Ga0501046_0021760_3405_4652 | 414 |
| 174 | 3300049587 | Ga0501071_0065797 | Ga0501071_0065797_1156_2403 | 414 |
| 175 | 3300049588 | Ga0501072_0017922 | Ga0501072_0017922_977_2224 | 414 |
| 176 | 3300049590 | Ga0501074_0063120 | Ga0501074_0063120_427_1674 | 414 |
| 177 | 3300049591 | Ga0501075_0157855 | Ga0501075_0157855_410_1657 | 414 |
| 178 | 3300049592 | Ga0501076_0013174 | Ga0501076_0013174_2919_4166 | 414 |
| 179 | 3300049741 | Ga0501079_0215122 | Ga0501079_0215122_76_1323 | 414 |
| 180 | 3300049742 | Ga0501080_0065205 | Ga0501080_0065205_1898_3145 | 414 |
| 181 | 3300049743 | Ga0501081_0020095 | Ga0501081_0020095_2934_4181 | 414 |
| 182 | 3300054114 | Ga0501084_0017117 | Ga0501084_0017117_1783_3030 | 414 |
| 183 | 3300059426 | Ga0590077_008788 | Ga0590077_008788_566_1813 | 414 |
| 184 | 3300005329 | Ga0070683_100068492 | Ga0070683_1000684922 | 416 |
| 185 | 3300005338 | Ga0068868_100028190 | Ga0068868_1000281905 | 416 |
| 186 | 3300005365 | Ga0070688_100123743 | Ga0070688_1001237431 | 416 |
| 187 | 3300005458 | Ga0070681_10048820 | Ga0070681_100488205 | 416 |
| 188 | 3300005530 | Ga0070679_100287264 | Ga0070679_1002872641 | 416 |
| 189 | 3300005937 | Ga0081455_10132597 | Ga0081455_101325972 | 416 |
| 190 | 3300054114 | Ga0501084_0248738 | Ga0501084_0248738_103_1356 | 416 |
| 191 | 3300000041 | ARcpr5oldR_c002523 | ARcpr5oldR_0025232 | 417 |
| 192 | 3300005366 | Ga0070659_100081987 | Ga0070659_1000819872 | 417 |
| 193 | 3300005457 | Ga0070662_100080172 | Ga0070662_1000801722 | 417 |
| 194 | 3300005937 | Ga0081455_10029594 | Ga0081455_100295943 | 417 |
| 195 | 3300006844 | Ga0075428_100020693 | Ga0075428_1000206933 | 417 |
| 196 | 3300006852 | Ga0075433_10045559 | Ga0075433_100455594 | 417 |
| 197 | 3300006880 | Ga0075429_100015563 | Ga0075429_1000155634 | 417 |
| 198 | 3300009148 | Ga0105243_10049356 | Ga0105243_100493564 | 417 |
| 199 | 3300014745 | Ga0157377_10040516 | Ga0157377_100405162 | 417 |
| 200 | 3300025921 | Ga0207652_10184701 | Ga0207652_101847012 | 417 |
| 201 | 3300025932 | Ga0207690_10037331 | Ga0207690_100373314 | 417 |
| 202 | 3300025935 | Ga0207709_10069860 | Ga0207709_100698602 | 417 |
| 203 | 3300026041 | Ga0207639_10039839 | Ga0207639_100398394 | 417 |
| 204 | 3300026075 | Ga0207708_10020293 | Ga0207708_100202933 | 417 |
| 205 | 3300026142 | Ga0207698_10204326 | Ga0207698_102043261 | 417 |
| 206 | 3300027907 | Ga0207428_10000383 | Ga0207428_1000038355 | 417 |
| 207 | 3300049574 | Ga0501038_0233110 | Ga0501038_0233110_197_1450 | 417 |
| 208 | 3300049576 | Ga0501040_0063942 | Ga0501040_0063942_593_1849 | 417 |
| 209 | 3300049576 | Ga0501040_0128692 | Ga0501040_0128692_473_1726 | 417 |
| 210 | 3300049580 | Ga0501046_0192137 | Ga0501046_0192137_259_1512 | 417 |
| 211 | 3300049584 | Ga0501068_0025281 | Ga0501068_0025281_2140_3396 | 417 |
| 212 | 3300049584 | Ga0501068_0068277 | Ga0501068_0068277_884_2137 | 417 |
| 213 | 3300049591 | Ga0501075_0031562 | Ga0501075_0031562_2644_3897 | 417 |
| 214 | 3300049591 | Ga0501075_0176680 | Ga0501075_0176680_154_1410 | 417 |
| 215 | 3300049593 | Ga0501077_0023563 | Ga0501077_0023563_51_1304 | 417 |
| 216 | 3300049741 | Ga0501079_0020024 | Ga0501079_0020024_89_1342 | 417 |
| 217 | 3300049743 | Ga0501081_0030600 | Ga0501081_0030600_2362_3615 | 417 |
| 218 | 3300049824 | Ga0501045_0054128 | Ga0501045_0054128_1609_2862 | 417 |
| 219 | 3300050491 | nmdc:mga00v17_28268_c1 | nmdc:mga00v17_28268_c1_1185_2438 | 417 |
| 220 | 3300050492 | nmdc:mga0yw44_11949_c1 | nmdc:mga0yw44_11949_c1_1255_2508 | 417 |
| 221 | 3300050507 | nmdc:mga05p37_170089_c1 | nmdc:mga05p37_170089_c1_631_1884 | 417 |
| 222 | 3300050508 | nmdc:mga09592_84265_c1 | nmdc:mga09592_84265_c1_1287_2540 | 417 |
| 223 | 3300050515 | nmdc:mga0a205_42610_c1 | nmdc:mga0a205_42610_c1_609_1862 | 417 |
| 224 | 3300054114 | Ga0501084_0088240 | Ga0501084_0088240_207_1463 | 417 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7lr7-assembly1.cif.gz_A-2 | crystal structure of gh5_18 from streptomyces cattleya in complex with glcnac | 0.7258 | 28 | 335 |
| 7l1v-assembly1.cif.gz_S | orexin receptor 2 (ox2r) in complex with g protein and small-molecule agonist compound 1 | 0.7234 | 336 | 417 |
| 8gq1-assembly1.cif.gz_H | hyhel10 fab complexed with hen egg lysozyme carrying arginine cluster in framework region of light chain. | 0.7227 | 336 | 417 |
| 6ufl-assembly1.cif.gz_A | crystal structure of a gh128 (subgroup i) endo-beta-1,3-glucanase (e199q mutant) from amycolatopsis mediterranei (amgh128_i) in the complex with laminarihexaose | 0.7218 | 30 | 335 |
| 2igl-assembly1.cif.gz_C | crystal structure of e. coli yedx, a transthyretin related protein | 0.7145 | 363 | 402 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6MBA2_32_187_3.20.20.80 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.8127 | 47 | 103 | 3.20.20.80 |
| af_Q7XSK1_17_299_3.20.20.80 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.8028 | 47 | 147 | 3.20.20.80 |
| af_Q54UB6_27_345_3.20.20.80 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.7654 | 30 | 335 | 3.20.20.80 |
| af_O73791_628_734_2.60.40.10 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.7551 | 338 | 416 | 2.60.40.10 |
| af_Q54UB6_27_345_3.20.20.80 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.7353 | 30 | 335 | 3.20.20.80 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0U2Q9Y5-F1-model_v4 | Asl1-like glycosyl hydrolase catalytic domain-containing protein | 0.9818 | 77 | 417 |
GO:0004553
|
| AF-A0A7W0S8J4-F1-model_v4 | Cellulase family glycosylhydrolase | 0.9806 | 20 | 417 |
GO:0000272
GO:0004553 |
| AF-A0A7Y5XU19-F1-model_v4 | Asl1-like glycosyl hydrolase catalytic domain-containing protein | 0.9788 | 140 | 417 |
GO:0004553
|
| AF-A0A538MQN9-F1-model_v4 | Uncharacterized protein | 0.9755 | 261 | 417 |
|
| AF-A0A7V9DIT7-F1-model_v4 | Asl1-like glycosyl hydrolase catalytic domain-containing protein | 0.9726 | 177 | 417 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar