F336796

General Info

Members Datasets Scaffolds Average Seq Length
224 137 224 414

Family's Representative Sequence

Representative Sequence 3300025915|Ga0207693_10081758|Ga0207693_100817583
Length 494
Sequence VLVRLVLLCGLVAVLAAPGVATASSSIRYGVQDDAWIADGNGTLAQRLNRLKELGVQIVRYNLRWDQVAKRKPKSPTSTTDPAYDWQPSDVFLKGLKARGIAPLVTIYGTPTWANGGRAPSWAPKTGAMMAAFAHAAAKRYPWVKRWAIWNEPNQRRWLKPSSPVIYTVRLLNPAYAAIHAVIRGAQVAGGVTAPRGNAGGVSPVDWIQGMKRAGARLDAYAHNPYPLSPHTETPWSGGCEGCRTLTMATLPKLINDVTKAFGPKRIWLTEYGYQTNPPDPYIGVSDALQAEYMSAAALRAYLAPRVDVLIHFLVRDEPDLAGWQSGVLNIKGVAKPSYRAFQLPLAQESRAGSRTVLWGQVRPGHGRRTYRLQKLVNGRWAWYGGTARTSSGGFFTRSVTGAAHDRFRLWAPSLRVFGPPRGPERLGPVSFEIDGIHAHDVSEILDRHGVAVRAGHHCAQPATARASFGVYTTEEEIDRLVEGLQDARRIFGL

Samples

Sample ID Description Type Environment
1 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
49 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
73 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
74 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
75 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
76 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
77 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
78 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
79 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
80 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
81 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
82 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
84 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
85 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
86 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
87 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
88 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
89 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
90 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
91 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
92 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
93 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
94 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
95 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
96 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
97 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
98 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
99 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
100 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
101 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
102 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
103 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
104 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
105 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
106 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
107 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
108 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
109 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
110 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
116 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
117 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
118 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
119 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
120 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
121 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
122 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
123 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
124 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
125 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
126 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
127 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
128 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
129 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
130 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
131 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
132 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
133 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
134 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
135 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
136 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
137 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.11
Metatranscriptomes 0.89
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.12
Nodule 0
Rhizoplane 4.46
Rhizosphere 92.41
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c002523 3300000041 Unclassified 1686
2 Ga0070658_10014170 3300005327 Bacteria 6399
3 Ga0070683_100009572 3300005329 Bacteria 8295
4 Ga0070683_100013904 3300005329 Bacteria 7032
5 Ga0070683_100068492 3300005329 Bacteria 3307
6 Ga0070683_100168592 3300005329 Bacteria 2078
7 Ga0070683_100179313 3300005329 Bacteria 2011
8 Ga0070680_100046448 3300005336 Bacteria 3532
9 Ga0068868_100028190 3300005338 Unclassified 4291
10 Ga0070660_100000505 3300005339 Bacteria 26077
11 Ga0070661_100030112 3300005344 Bacteria 3920
12 Ga0070674_100178899 3300005356 Bacteria 1623
13 Ga0070688_100123743 3300005365 Bacteria 1735
14 Ga0070659_100003363 3300005366 Bacteria 11382
15 Ga0070659_100081987 3300005366 Bacteria 2576
16 Ga0070659_100102512 3300005366 Bacteria 2304
17 Ga0070709_10004173 3300005434 Bacteria 7787
18 Ga0070714_100233140 3300005435 Unclassified 1696
19 Ga0070708_100216110 3300005445 Bacteria 1797
20 Ga0070662_100080172 3300005457 Bacteria 2430
21 Ga0070681_10000545 3300005458 Bacteria 31026
22 Ga0070681_10038180 3300005458 Bacteria 4816
23 Ga0070681_10048820 3300005458 Bacteria 4227
24 Ga0070681_10118136 3300005458 Bacteria 2588
25 Ga0070681_10209714 3300005458 Bacteria 1864
26 Ga0068867_100100895 3300005459 Bacteria 2204
27 Ga0070706_100141715 3300005467 Bacteria 2244
28 Ga0070707_100091675 3300005468 Bacteria 2942
29 Ga0070679_100038252 3300005530 Bacteria 4769
30 Ga0070679_100042438 3300005530 Bacteria 4529
31 Ga0070679_100090308 3300005530 Bacteria 3051
32 Ga0070679_100113267 3300005530 Bacteria 2698
33 Ga0070679_100287264 3300005530 Unclassified 1597
34 Ga0070684_100136845 3300005535 Bacteria 2213
35 Ga0068853_100153311 3300005539 Bacteria 2075
36 Ga0068855_100053947 3300005563 Bacteria 4728
37 Ga0068855_100084051 3300005563 Bacteria 3686
38 Ga0068855_100113115 3300005563 Bacteria 3114
39 Ga0070664_100333456 3300005564 Bacteria 1377
40 Ga0068857_100014399 3300005577 Bacteria 6896
41 Ga0068856_100191353 3300005614 Unclassified 2060
42 Ga0081455_10020460 3300005937 Bacteria 6227
43 Ga0081455_10029594 3300005937 Bacteria 4991
44 Ga0081455_10132597 3300005937 Bacteria 1946
45 Ga0081539_10007768 3300005985 Bacteria 9606
46 Ga0075365_10005836 3300006038 Bacteria 6694
47 Ga0075364_10119641 3300006051 Bacteria 1762
48 Ga0070712_100032131 3300006175 Bacteria 3542
49 Ga0075428_100020693 3300006844 Bacteria 7286
50 Ga0075428_100264163 3300006844 Bacteria 1853
51 Ga0075433_10045559 3300006852 Bacteria 3813
52 Ga0075429_100015563 3300006880 Bacteria 6590
53 Ga0105240_10063569 3300009093 Bacteria 4591
54 Ga0105240_10169007 3300009093 Bacteria 2591
55 Ga0105245_10018625 3300009098 Bacteria 6072
56 Ga0105245_10051176 3300009098 Bacteria 3703
57 Ga0105245_10086653 3300009098 Bacteria 2873
58 Ga0105245_10125535 3300009098 Bacteria 2402
59 Ga0114129_10083419 3300009147 Bacteria 4440
60 Ga0105243_10049356 3300009148 Bacteria 3320
61 Ga0105242_10109470 3300009176 Bacteria 2352
62 Ga0105237_10045480 3300009545 Bacteria 4417
63 Ga0105238_10064488 3300009551 Bacteria 3663
64 Ga0105249_10260353 3300009553 Unclassified 1723
65 Ga0105239_10296746 3300010375 Bacteria 1820
66 Ga0157370_10041019 3300013104 Bacteria 4468
67 Ga0157370_10057690 3300013104 Bacteria 3690
68 Ga0157370_10122406 3300013104 Bacteria 2429
69 Ga0157369_10063912 3300013105 Bacteria 3965
70 Ga0157369_10070430 3300013105 Bacteria 3757
71 Ga0157372_10190131 3300013307 Bacteria 2378
72 Ga0157375_10355550 3300013308 Bacteria 1631
73 Ga0157380_10028824 3300014326 Bacteria 4238
74 Ga0157380_10305957 3300014326 Bacteria 1466
75 Ga0157380_10446139 3300014326 Unclassified 1241
76 Ga0157377_10040516 3300014745 Bacteria 2580
77 Ga0157377_10042656 3300014745 Bacteria 2520
78 Ga0206353_11078444 3300020082 Bacteria 2144
79 Ga0206353_11410606 3300020082 Unclassified 1798
80 Ga0207699_10018344 3300025906 Bacteria 3706
81 Ga0207705_10152970 3300025909 Bacteria 1729
82 Ga0207707_10009760 3300025912 Bacteria 8328
83 Ga0207695_10099307 3300025913 Bacteria 2909
84 Ga0207671_10029537 3300025914 Bacteria 4093
85 Ga0207693_10081758 3300025915 Bacteria 2529
86 Ga0207660_10030504 3300025917 Bacteria 3706
87 Ga0207660_10053615 3300025917 Bacteria 2875
88 Ga0207660_10236979 3300025917 Bacteria 1436
89 Ga0207657_10006496 3300025919 Bacteria 12116
90 Ga0207657_10006895 3300025919 Bacteria 11718
91 Ga0207652_10033508 3300025921 Bacteria 4326
92 Ga0207652_10081320 3300025921 Bacteria 2834
93 Ga0207652_10093930 3300025921 Bacteria 2640
94 Ga0207652_10137228 3300025921 Unclassified 2185
95 Ga0207652_10184701 3300025921 Bacteria 1875
96 Ga0207646_10023255 3300025922 Bacteria 5695
97 Ga0207700_10000004 3300025928 Bacteria 443409
98 Ga0207690_10037331 3300025932 Bacteria 3154
99 Ga0207690_10039952 3300025932 Bacteria 3064
100 Ga0207709_10069860 3300025935 Bacteria 2225
101 Ga0207709_10105294 3300025935 Bacteria 1874
102 Ga0207669_10136179 3300025937 Unclassified 1697
103 Ga0207704_10247018 3300025938 Unclassified 1337
104 Ga0207665_10004989 3300025939 Bacteria 8858
105 Ga0207661_10107466 3300025944 Bacteria 2354
106 Ga0207667_10100609 3300025949 Bacteria 2982
107 Ga0207639_10039839 3300026041 Bacteria 3504
108 Ga0207639_10089650 3300026041 Bacteria 2458
109 Ga0207708_10020293 3300026075 Bacteria 5012
110 Ga0207674_10010915 3300026116 Bacteria 10228
111 Ga0207674_10094087 3300026116 Bacteria 2984
112 Ga0207698_10097720 3300026142 Bacteria 2424
113 Ga0207698_10204326 3300026142 Bacteria 1772
114 Ga0207428_10000383 3300027907 Bacteria 55634
115 Ga0265322_10003057 3300028654 Bacteria 5099
116 Ga0265338_10007452 3300028800 Bacteria 13579
117 Ga0265325_10011650 3300031241 Bacteria 5049
118 Ga0265339_10028529 3300031249 Unclassified 3173
119 Ga0265316_10031810 3300031344 Bacteria 4311
120 Ga0265314_10010645 3300031711 Bacteria 7653
121 Ga0307416_100154131 3300032002 Bacteria 2112
122 Ga0373936_0006669 3300035113 Bacteria 4347
123 Ga0373943_0001805 3300035170 Bacteria 9679
124 Ga0373937_0039747 3300036401 Bacteria 4287
125 Ga0373925_0019056 3300037068 Bacteria 4989
126 Ga0395899_0128195 3300037312 Bacteria 1813
127 Ga0395900_0011636 3300037418 Bacteria 9003
128 Ga0395900_0069820 3300037418 Bacteria 3611
129 Ga0395900_0072448 3300037418 Bacteria 3542
130 Ga0395900_0092178 3300037418 Bacteria 3113
131 Ga0395900_0115905 3300037418 Unclassified 2749
132 Ga0395900_0161935 3300037418 Bacteria 2281
133 Ga0395898_0007918 3300037466 Bacteria 11273
134 Ga0395898_0041036 3300037466 Bacteria 4573
135 Ga0395898_0081456 3300037466 Bacteria 3121
136 Ga0395905_0054383 3300037471 Bacteria 3747
137 Ga0395905_0059329 3300037471 Bacteria 3577
138 Ga0395905_0137133 3300037471 Bacteria 2302
139 Ga0395901_0009303 3300038443 Bacteria 9957
140 Ga0395901_0010015 3300038443 Bacteria 9609
141 Ga0395901_0029481 3300038443 Bacteria 5651
142 Ga0395901_0363273 3300038443 Bacteria 1492
143 Ga0439433_0007863 3300041999 Bacteria 2305
144 Ga0439451_003997 3300042009 Bacteria 2998
145 Ga0450920_005071 3300042122 Unclassified 2335
146 Ga0450907_012138 3300042146 Bacteria 1432
147 Ga0439446_0014334 3300042156 Bacteria 2187
148 Ga0439434_0018829 3300042435 Bacteria 2069
149 Ga0466966_0046455 3300044684 Bacteria 2772
150 Ga0466966_0052311 3300044684 Bacteria 2595
151 Ga0466961_0002965 3300044693 Bacteria 10538
152 Ga0466961_0030614 3300044693 Bacteria 3459
153 Ga0466963_0012114 3300044694 Bacteria 5270
154 Ga0466963_0016626 3300044694 Bacteria 4577
155 Ga0466963_0048070 3300044694 Bacteria 2817
156 Ga0466964_0015114 3300044706 Bacteria 2939
157 Ga0466968_0003327 3300044735 Bacteria 5933
158 Ga0466959_0007516 3300045049 Bacteria 7652
159 Ga0466959_0135614 3300045049 Bacteria 1742
160 Ga0466958_0026545 3300045836 Bacteria 3423
161 Ga0466967_0041417 3300045976 Bacteria 3971
162 Ga0466967_0046879 3300045976 Bacteria 3765
163 Ga0466967_0069238 3300045976 Bacteria 3153
164 Ga0466967_0077300 3300045976 Bacteria 2996
165 Ga0466967_0084772 3300045976 Bacteria 2867
166 Ga0466967_0087002 3300045976 Bacteria 2832
167 Ga0466967_0138281 3300045976 Bacteria 2267
168 Ga0466967_0162841 3300045976 Bacteria 2095
169 Ga0495641_0043215 3300046461 Bacteria 2085
170 Ga0496100_0037431 3300048903 Bacteria 3067
171 Ga0496101_0083015 3300048904 Bacteria 2371
172 Ga0496107_0028393 3300048910 Bacteria 3975
173 Ga0496107_0033527 3300048910 Bacteria 3674
174 Ga0496109_0164074 3300048912 Bacteria 2082
175 Ga0496109_0303725 3300048912 Bacteria 1505
176 Ga0496111_0073188 3300048914 Bacteria 2495
177 Ga0496111_0160367 3300048914 Bacteria 1670
178 Ga0496111_0190426 3300048914 Bacteria 1525
179 Ga0496115_0244577 3300048918 Unclassified 1478
180 Ga0501037_0094950 3300049573 Unclassified 2156
181 Ga0501038_0027111 3300049574 Bacteria 5100
182 Ga0501038_0233110 3300049574 Unclassified 1464
183 Ga0501040_0005455 3300049576 Bacteria 8227
184 Ga0501040_0063942 3300049576 Bacteria 2533
185 Ga0501040_0128692 3300049576 Unclassified 1779
186 Ga0501042_0085589 3300049578 Unclassified 2260
187 Ga0501042_0204686 3300049578 Bacteria 1423
188 Ga0501046_0021760 3300049580 Archaea 5287
189 Ga0501046_0192137 3300049580 Unclassified 1522
190 Ga0501067_0014686 3300049583 Bacteria 4333
191 Ga0501068_0025281 3300049584 Bacteria 3493
192 Ga0501068_0068277 3300049584 Unclassified 2166
193 Ga0501069_0034416 3300049585 Bacteria 2790
194 Ga0501071_0065797 3300049587 Unclassified 2633
195 Ga0501072_0017922 3300049588 Bacteria 5444
196 Ga0501074_0063120 3300049590 Bacteria 2668
197 Ga0501075_0031562 3300049591 Bacteria 3933
198 Ga0501075_0114165 3300049591 Bacteria 2054
199 Ga0501075_0157855 3300049591 Bacteria 1730
200 Ga0501075_0176680 3300049591 Unclassified 1629
201 Ga0501076_0013174 3300049592 Bacteria 6193
202 Ga0501077_0023563 3300049593 Bacteria 3903
203 Ga0501079_0020024 3300049741 Bacteria 5111
204 Ga0501079_0215122 3300049741 Bacteria 1501
205 Ga0501080_0065205 3300049742 Bacteria 3388
206 Ga0501081_0020095 3300049743 Bacteria 4451
207 Ga0501081_0030600 3300049743 Bacteria 3644
208 Ga0501045_0054128 3300049824 Bacteria 2933
209 nmdc:mga00v17_28268_c1 3300050491 Bacteria 3283
210 nmdc:mga0yw44_11949_c1 3300050492 Bacteria 4507
211 nmdc:mga0yw44_43656_c1 3300050492 Bacteria 2678
212 nmdc:mga0yw44_50080_c1 3300050492 Bacteria 2524
213 nmdc:mga0yw44_70058_c1 3300050492 Unclassified 2173
214 nmdc:mga05p37_13459_c1 3300050507 Bacteria 9803
215 nmdc:mga05p37_170089_c1 3300050507 Bacteria 2658
216 nmdc:mga09592_84265_c1 3300050508 Bacteria 2710
217 nmdc:mga0n895_7930_c1 3300050512 Bacteria 9156
218 nmdc:mga0a205_42610_c1 3300050515 Bacteria 4374
219 Ga0501084_0017117 3300054114 Bacteria 6022
220 Ga0501084_0088240 3300054114 Bacteria 2604
221 Ga0501084_0248738 3300054114 Bacteria 1501
222 Ga0590077_008788 3300059426 Bacteria 2068
223 Ga0466962_0032459 3300061719 Bacteria 2500
224 Ga0530510_0058227 3300061734 Bacteria 2794

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045976 Ga0466967_0069238 Ga0466967_0069238_1215_2444 383
2 3300009098 Ga0105245_10018625 Ga0105245_100186256 385
3 3300014745 Ga0157377_10042656 Ga0157377_100426561 385
4 3300048912 Ga0496109_0303725 Ga0496109_0303725_232_1431 388
5 3300042146 Ga0450907_012138 Ga0450907_012138_95_1339 389
6 3300048912 Ga0496109_0164074 Ga0496109_0164074_161_1405 392
7 3300048914 Ga0496111_0190426 Ga0496111_0190426_26_1270 392
8 3300009098 Ga0105245_10125535 Ga0105245_101255353 394
9 3300044694 Ga0466963_0048070 Ga0466963_0048070_1018_2262 395
10 3300042009 Ga0439451_003997 Ga0439451_003997_898_2175 396
11 3300014326 Ga0157380_10446139 Ga0157380_104461391 397
12 3300037418 Ga0395900_0069820 Ga0395900_0069820_2254_3501 397
13 3300038443 Ga0395901_0009303 Ga0395901_0009303_8444_9691 397
14 3300025913 Ga0207695_10099307 Ga0207695_100993072 398
15 3300037418 Ga0395900_0092178 Ga0395900_0092178_1271_2530 399
16 3300037466 Ga0395898_0041036 Ga0395898_0041036_1093_2340 399
17 3300037466 Ga0395898_0081456 Ga0395898_0081456_644_1903 399
18 3300037471 Ga0395905_0137133 Ga0395905_0137133_703_1950 399
19 3300005985 Ga0081539_10007768 Ga0081539_100077686 400
20 3300005459 Ga0068867_100100895 Ga0068867_1001008952 401
21 3300014326 Ga0157380_10028824 Ga0157380_100288242 401
22 3300045976 Ga0466967_0087002 Ga0466967_0087002_1257_2513 401
23 3300005535 Ga0070684_100136845 Ga0070684_1001368452 402
24 3300005564 Ga0070664_100333456 Ga0070664_1003334562 402
25 3300006051 Ga0075364_10119641 Ga0075364_101196412 402
26 3300050492 nmdc:mga0yw44_43656_c1 nmdc:mga0yw44_43656_c1_1131_2339 402
27 3300045976 Ga0466967_0041417 Ga0466967_0041417_1719_2975 403
28 3300006038 Ga0075365_10005836 Ga0075365_100058363 407
29 3300009553 Ga0105249_10260353 Ga0105249_102603532 407
30 3300025921 Ga0207652_10137228 Ga0207652_101372282 407
31 3300037418 Ga0395900_0115905 Ga0395900_0115905_815_2098 407
32 3300038443 Ga0395901_0029481 Ga0395901_0029481_240_1523 407
33 3300044684 Ga0466966_0052311 Ga0466966_0052311_106_1362 407
34 3300044693 Ga0466961_0030614 Ga0466961_0030614_512_1768 407
35 3300050492 nmdc:mga0yw44_50080_c1 nmdc:mga0yw44_50080_c1_887_2191 407
36 3300050492 nmdc:mga0yw44_70058_c1 nmdc:mga0yw44_70058_c1_894_2150 407
37 3300009098 Ga0105245_10051176 Ga0105245_100511764 408
38 3300049591 Ga0501075_0114165 Ga0501075_0114165_55_1290 409
39 3300050507 nmdc:mga05p37_13459_c1 nmdc:mga05p37_13459_c1_7954_9216 409
40 3300044693 Ga0466961_0002965 Ga0466961_0002965_7107_8342 410
41 3300045049 Ga0466959_0135614 Ga0466959_0135614_157_1392 410
42 3300045836 Ga0466958_0026545 Ga0466958_0026545_1160_2395 410
43 3300061719 Ga0466962_0032459 Ga0466962_0032459_728_1963 410
44 3300014326 Ga0157380_10305957 Ga0157380_103059572 411
45 3300028654 Ga0265322_10003057 Ga0265322_100030573 411
46 3300028800 Ga0265338_10007452 Ga0265338_1000745210 411
47 3300031241 Ga0265325_10011650 Ga0265325_100116505 411
48 3300031249 Ga0265339_10028529 Ga0265339_100285291 411
49 3300031344 Ga0265316_10031810 Ga0265316_100318103 411
50 3300031711 Ga0265314_10010645 Ga0265314_100106454 411
51 3300009176 Ga0105242_10109470 Ga0105242_101094703 412
52 3300025938 Ga0207704_10247018 Ga0207704_102470181 412
53 3300041999 Ga0439433_0007863 Ga0439433_0007863_1035_2276 412
54 3300042156 Ga0439446_0014334 Ga0439446_0014334_556_1797 412
55 3300042435 Ga0439434_0018829 Ga0439434_0018829_313_1554 412
56 3300044694 Ga0466963_0016626 Ga0466963_0016626_1935_3176 412
57 3300048903 Ga0496100_0037431 Ga0496100_0037431_385_1626 412
58 3300048904 Ga0496101_0083015 Ga0496101_0083015_23_1264 412
59 3300048910 Ga0496107_0028393 Ga0496107_0028393_2559_3800 412
60 3300048910 Ga0496107_0033527 Ga0496107_0033527_1014_2255 412
61 3300005327 Ga0070658_10014170 Ga0070658_100141704 413
62 3300005329 Ga0070683_100013904 Ga0070683_1000139043 413
63 3300005329 Ga0070683_100168592 Ga0070683_1001685922 413
64 3300005329 Ga0070683_100179313 Ga0070683_1001793132 413
65 3300005336 Ga0070680_100046448 Ga0070680_1000464483 413
66 3300005339 Ga0070660_100000505 Ga0070660_1000005054 413
67 3300005344 Ga0070661_100030112 Ga0070661_1000301127 413
68 3300005356 Ga0070674_100178899 Ga0070674_1001788992 413
69 3300005366 Ga0070659_100003363 Ga0070659_1000033634 413
70 3300005366 Ga0070659_100102512 Ga0070659_1001025122 413
71 3300005458 Ga0070681_10000545 Ga0070681_1000054519 413
72 3300005458 Ga0070681_10038180 Ga0070681_100381803 413
73 3300005458 Ga0070681_10118136 Ga0070681_101181363 413
74 3300005458 Ga0070681_10209714 Ga0070681_102097142 413
75 3300005530 Ga0070679_100038252 Ga0070679_1000382524 413
76 3300005530 Ga0070679_100042438 Ga0070679_1000424383 413
77 3300005530 Ga0070679_100090308 Ga0070679_1000903083 413
78 3300005530 Ga0070679_100113267 Ga0070679_1001132671 413
79 3300005539 Ga0068853_100153311 Ga0068853_1001533112 413
80 3300005563 Ga0068855_100084051 Ga0068855_1000840512 413
81 3300005563 Ga0068855_100113115 Ga0068855_1001131152 413
82 3300005577 Ga0068857_100014399 Ga0068857_1000143997 413
83 3300005614 Ga0068856_100191353 Ga0068856_1001913531 413
84 3300005937 Ga0081455_10020460 Ga0081455_100204604 413
85 3300006175 Ga0070712_100032131 Ga0070712_1000321313 413
86 3300009093 Ga0105240_10169007 Ga0105240_101690072 413
87 3300009098 Ga0105245_10086653 Ga0105245_100866532 413
88 3300009545 Ga0105237_10045480 Ga0105237_100454802 413
89 3300009551 Ga0105238_10064488 Ga0105238_100644884 413
90 3300010375 Ga0105239_10296746 Ga0105239_102967462 413
91 3300013104 Ga0157370_10041019 Ga0157370_100410196 413
92 3300013104 Ga0157370_10057690 Ga0157370_100576902 413
93 3300013104 Ga0157370_10122406 Ga0157370_101224062 413
94 3300013105 Ga0157369_10063912 Ga0157369_100639124 413
95 3300013105 Ga0157369_10070430 Ga0157369_100704303 413
96 3300013307 Ga0157372_10190131 Ga0157372_101901312 413
97 3300013308 Ga0157375_10355550 Ga0157375_103555502 413
98 3300020082 Ga0206353_11078444 Ga0206353_110784442 413
99 3300025912 Ga0207707_10009760 Ga0207707_1000976012 413
100 3300025914 Ga0207671_10029537 Ga0207671_100295376 413
101 3300025917 Ga0207660_10030504 Ga0207660_100305043 413
102 3300025917 Ga0207660_10053615 Ga0207660_100536154 413
103 3300025917 Ga0207660_10236979 Ga0207660_102369791 413
104 3300025919 Ga0207657_10006496 Ga0207657_1000649613 413
105 3300025919 Ga0207657_10006895 Ga0207657_1000689514 413
106 3300025921 Ga0207652_10033508 Ga0207652_100335084 413
107 3300025921 Ga0207652_10081320 Ga0207652_100813203 413
108 3300025921 Ga0207652_10093930 Ga0207652_100939301 413
109 3300025932 Ga0207690_10039952 Ga0207690_100399522 413
110 3300025935 Ga0207709_10105294 Ga0207709_101052941 413
111 3300025937 Ga0207669_10136179 Ga0207669_101361792 413
112 3300025944 Ga0207661_10107466 Ga0207661_101074662 413
113 3300025949 Ga0207667_10100609 Ga0207667_101006092 413
114 3300026041 Ga0207639_10089650 Ga0207639_100896502 413
115 3300026116 Ga0207674_10010915 Ga0207674_1001091511 413
116 3300026116 Ga0207674_10094087 Ga0207674_100940874 413
117 3300026142 Ga0207698_10097720 Ga0207698_100977202 413
118 3300032002 Ga0307416_100154131 Ga0307416_1001541312 413
119 3300035113 Ga0373936_0006669 Ga0373936_0006669_2158_3402 413
120 3300035170 Ga0373943_0001805 Ga0373943_0001805_6488_7732 413
121 3300037068 Ga0373925_0019056 Ga0373925_0019056_3178_4422 413
122 3300037312 Ga0395899_0128195 Ga0395899_0128195_49_1293 413
123 3300037418 Ga0395900_0072448 Ga0395900_0072448_571_1815 413
124 3300037418 Ga0395900_0161935 Ga0395900_0161935_60_1304 413
125 3300037466 Ga0395898_0007918 Ga0395898_0007918_4713_5957 413
126 3300038443 Ga0395901_0010015 Ga0395901_0010015_3743_4987 413
127 3300044684 Ga0466966_0046455 Ga0466966_0046455_10_1254 413
128 3300044694 Ga0466963_0012114 Ga0466963_0012114_2500_3744 413
129 3300044706 Ga0466964_0015114 Ga0466964_0015114_737_1981 413
130 3300044735 Ga0466968_0003327 Ga0466968_0003327_3031_4275 413
131 3300045049 Ga0466959_0007516 Ga0466959_0007516_457_1701 413
132 3300045976 Ga0466967_0046879 Ga0466967_0046879_739_1983 413
133 3300045976 Ga0466967_0077300 Ga0466967_0077300_413_1657 413
134 3300045976 Ga0466967_0084772 Ga0466967_0084772_12_1256 413
135 3300045976 Ga0466967_0138281 Ga0466967_0138281_228_1472 413
136 3300045976 Ga0466967_0162841 Ga0466967_0162841_689_1933 413
137 3300046461 Ga0495641_0043215 Ga0495641_0043215_127_1371 413
138 3300048918 Ga0496115_0244577 Ga0496115_0244577_48_1406 413
139 3300049583 Ga0501067_0014686 Ga0501067_0014686_3058_4302 413
140 3300049585 Ga0501069_0034416 Ga0501069_0034416_1046_2290 413
141 3300050512 nmdc:mga0n895_7930_c1 nmdc:mga0n895_7930_c1_7064_8395 413
142 3300061734 Ga0530510_0058227 Ga0530510_0058227_481_1725 413
143 3300005329 Ga0070683_100009572 Ga0070683_1000095721 414
144 3300005434 Ga0070709_10004173 Ga0070709_100041733 414
145 3300005435 Ga0070714_100233140 Ga0070714_1002331402 414
146 3300005445 Ga0070708_100216110 Ga0070708_1002161102 414
147 3300005467 Ga0070706_100141715 Ga0070706_1001417152 414
148 3300005468 Ga0070707_100091675 Ga0070707_1000916752 414
149 3300005563 Ga0068855_100053947 Ga0068855_1000539473 414
150 3300006844 Ga0075428_100264163 Ga0075428_1002641632 414
151 3300009093 Ga0105240_10063569 Ga0105240_100635694 414
152 3300009147 Ga0114129_10083419 Ga0114129_100834191 414
153 3300020082 Ga0206353_11410606 Ga0206353_114106062 414
154 3300025906 Ga0207699_10018344 Ga0207699_100183443 414
155 3300025909 Ga0207705_10152970 Ga0207705_101529702 414
156 3300025915 Ga0207693_10081758 Ga0207693_100817583 414
157 3300025922 Ga0207646_10023255 Ga0207646_100232555 414
158 3300025928 Ga0207700_10000004 Ga0207700_10000004306 414
159 3300025939 Ga0207665_10004989 Ga0207665_100049899 414
160 3300036401 Ga0373937_0039747 Ga0373937_0039747_2437_3711 414
161 3300037418 Ga0395900_0011636 Ga0395900_0011636_2213_3487 414
162 3300037471 Ga0395905_0054383 Ga0395905_0054383_887_2161 414
163 3300037471 Ga0395905_0059329 Ga0395905_0059329_1223_2476 414
164 3300038443 Ga0395901_0363273 Ga0395901_0363273_67_1320 414
165 3300042122 Ga0450920_005071 Ga0450920_005071_830_2077 414
166 3300048914 Ga0496111_0073188 Ga0496111_0073188_256_1533 414
167 3300048914 Ga0496111_0160367 Ga0496111_0160367_228_1502 414
168 3300049573 Ga0501037_0094950 Ga0501037_0094950_261_1508 414
169 3300049574 Ga0501038_0027111 Ga0501038_0027111_2922_4169 414
170 3300049576 Ga0501040_0005455 Ga0501040_0005455_3141_4388 414
171 3300049578 Ga0501042_0085589 Ga0501042_0085589_30_1277 414
172 3300049578 Ga0501042_0204686 Ga0501042_0204686_115_1362 414
173 3300049580 Ga0501046_0021760 Ga0501046_0021760_3405_4652 414
174 3300049587 Ga0501071_0065797 Ga0501071_0065797_1156_2403 414
175 3300049588 Ga0501072_0017922 Ga0501072_0017922_977_2224 414
176 3300049590 Ga0501074_0063120 Ga0501074_0063120_427_1674 414
177 3300049591 Ga0501075_0157855 Ga0501075_0157855_410_1657 414
178 3300049592 Ga0501076_0013174 Ga0501076_0013174_2919_4166 414
179 3300049741 Ga0501079_0215122 Ga0501079_0215122_76_1323 414
180 3300049742 Ga0501080_0065205 Ga0501080_0065205_1898_3145 414
181 3300049743 Ga0501081_0020095 Ga0501081_0020095_2934_4181 414
182 3300054114 Ga0501084_0017117 Ga0501084_0017117_1783_3030 414
183 3300059426 Ga0590077_008788 Ga0590077_008788_566_1813 414
184 3300005329 Ga0070683_100068492 Ga0070683_1000684922 416
185 3300005338 Ga0068868_100028190 Ga0068868_1000281905 416
186 3300005365 Ga0070688_100123743 Ga0070688_1001237431 416
187 3300005458 Ga0070681_10048820 Ga0070681_100488205 416
188 3300005530 Ga0070679_100287264 Ga0070679_1002872641 416
189 3300005937 Ga0081455_10132597 Ga0081455_101325972 416
190 3300054114 Ga0501084_0248738 Ga0501084_0248738_103_1356 416
191 3300000041 ARcpr5oldR_c002523 ARcpr5oldR_0025232 417
192 3300005366 Ga0070659_100081987 Ga0070659_1000819872 417
193 3300005457 Ga0070662_100080172 Ga0070662_1000801722 417
194 3300005937 Ga0081455_10029594 Ga0081455_100295943 417
195 3300006844 Ga0075428_100020693 Ga0075428_1000206933 417
196 3300006852 Ga0075433_10045559 Ga0075433_100455594 417
197 3300006880 Ga0075429_100015563 Ga0075429_1000155634 417
198 3300009148 Ga0105243_10049356 Ga0105243_100493564 417
199 3300014745 Ga0157377_10040516 Ga0157377_100405162 417
200 3300025921 Ga0207652_10184701 Ga0207652_101847012 417
201 3300025932 Ga0207690_10037331 Ga0207690_100373314 417
202 3300025935 Ga0207709_10069860 Ga0207709_100698602 417
203 3300026041 Ga0207639_10039839 Ga0207639_100398394 417
204 3300026075 Ga0207708_10020293 Ga0207708_100202933 417
205 3300026142 Ga0207698_10204326 Ga0207698_102043261 417
206 3300027907 Ga0207428_10000383 Ga0207428_1000038355 417
207 3300049574 Ga0501038_0233110 Ga0501038_0233110_197_1450 417
208 3300049576 Ga0501040_0063942 Ga0501040_0063942_593_1849 417
209 3300049576 Ga0501040_0128692 Ga0501040_0128692_473_1726 417
210 3300049580 Ga0501046_0192137 Ga0501046_0192137_259_1512 417
211 3300049584 Ga0501068_0025281 Ga0501068_0025281_2140_3396 417
212 3300049584 Ga0501068_0068277 Ga0501068_0068277_884_2137 417
213 3300049591 Ga0501075_0031562 Ga0501075_0031562_2644_3897 417
214 3300049591 Ga0501075_0176680 Ga0501075_0176680_154_1410 417
215 3300049593 Ga0501077_0023563 Ga0501077_0023563_51_1304 417
216 3300049741 Ga0501079_0020024 Ga0501079_0020024_89_1342 417
217 3300049743 Ga0501081_0030600 Ga0501081_0030600_2362_3615 417
218 3300049824 Ga0501045_0054128 Ga0501045_0054128_1609_2862 417
219 3300050491 nmdc:mga00v17_28268_c1 nmdc:mga00v17_28268_c1_1185_2438 417
220 3300050492 nmdc:mga0yw44_11949_c1 nmdc:mga0yw44_11949_c1_1255_2508 417
221 3300050507 nmdc:mga05p37_170089_c1 nmdc:mga05p37_170089_c1_631_1884 417
222 3300050508 nmdc:mga09592_84265_c1 nmdc:mga09592_84265_c1_1287_2540 417
223 3300050515 nmdc:mga0a205_42610_c1 nmdc:mga0a205_42610_c1_609_1862 417
224 3300054114 Ga0501084_0088240 Ga0501084_0088240_207_1463 417

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00266

Aminotran_5

Aminotransferase class-V

398

481

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7lr7-assembly1.cif.gz_A-2 crystal structure of gh5_18 from streptomyces cattleya in complex with glcnac 0.7258 28 335
7l1v-assembly1.cif.gz_S orexin receptor 2 (ox2r) in complex with g protein and small-molecule agonist compound 1 0.7234 336 417
8gq1-assembly1.cif.gz_H hyhel10 fab complexed with hen egg lysozyme carrying arginine cluster in framework region of light chain. 0.7227 336 417
6ufl-assembly1.cif.gz_A crystal structure of a gh128 (subgroup i) endo-beta-1,3-glucanase (e199q mutant) from amycolatopsis mediterranei (amgh128_i) in the complex with laminarihexaose 0.7218 30 335
2igl-assembly1.cif.gz_C crystal structure of e. coli yedx, a transthyretin related protein 0.7145 363 402
ID Description Score Start End Superfamily
af_A0A1D6MBA2_32_187_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.8127 47 103 3.20.20.80
af_Q7XSK1_17_299_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.8028 47 147 3.20.20.80
af_Q54UB6_27_345_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.7654 30 335 3.20.20.80
af_O73791_628_734_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7551 338 416 2.60.40.10
af_Q54UB6_27_345_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.7353 30 335 3.20.20.80
ID Description Score Start End GO Terms
AF-A0A0U2Q9Y5-F1-model_v4 Asl1-like glycosyl hydrolase catalytic domain-containing protein 0.9818 77 417 GO:0004553
AF-A0A7W0S8J4-F1-model_v4 Cellulase family glycosylhydrolase 0.9806 20 417 GO:0000272
GO:0004553
AF-A0A7Y5XU19-F1-model_v4 Asl1-like glycosyl hydrolase catalytic domain-containing protein 0.9788 140 417 GO:0004553
AF-A0A538MQN9-F1-model_v4 Uncharacterized protein 0.9755 261 417
AF-A0A7V9DIT7-F1-model_v4 Asl1-like glycosyl hydrolase catalytic domain-containing protein 0.9726 177 417

Feature Viewer

pLDDT pTM Quality
92.46 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map