F336576

General Info

Members Datasets Scaffolds Average Seq Length
224 113 448 372

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100083756|Ga0075431_1000837563
Length 388
Sequence VIKGKESAFLAVIPVNEPLLSERDLEYVSECVRTGWISSAGRFIDEFEEKWATYCGRRYGIAVSNGTTALQVAVRCLDLEPGDEVIMPSFTIISCALAVVENGGVPVLVDCDPNTWCMDVHQIERKITPRTRAIMPVHIYGHPVDMDPLLEIAEKHGLAVIEDAAEVHGAEYLSGRKSANPSWRRCGSFGKLSCFSFYANKLITTGEGGMVLTNDPALAAKARSLRNLCFQPDRRFYHQDLGFNFRLTNMQAALGLAQFERIDEIIARKRWMGKEYTRRLRGLTVLQLPVEESWARNVYWMYGIVIAEKTGMDAVQLANRLRERGVETRPFFLGMHEQPVFHKRGLFVNERYPVTERLARQGLYLPSGLALTEDQLSKACDTVLDVLS

Samples

Sample ID Description Type Environment
1 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
30 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
52 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
74 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
76 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
77 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
78 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
79 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
80 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
81 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
82 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
83 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
84 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
85 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
86 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
87 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
88 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
89 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
97 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
98 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
99 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
100 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
101 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
102 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
104 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
105 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
106 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
107 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
108 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
109 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
110 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
111 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
112 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
113 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.11
Metatranscriptomes 0.89
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 97.32
Stem 0
Stem Tuber 0
Unclassified 14.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075431_100083756 3300006847 Unclassified 3292
2 Ga0058859_10010271 3300004798 Bacteria 4170
3 Ga0058860_10091358 3300004801 Bacteria 8896
4 Ga0065712_10006551 3300005290 Bacteria 3202
5 Ga0065712_10079234 3300005290 Unclassified 3242
6 Ga0070670_100262284 3300005331 Bacteria 1506
7 Ga0070680_100317892 3300005336 Unclassified 1321
8 Ga0070689_100037421 3300005340 Unclassified 3710
9 Ga0070689_100198183 3300005340 Unclassified 1638
10 Ga0070675_100000040 3300005354 Bacteria 78869
11 Ga0070675_100000584 3300005354 Bacteria 25027
12 Ga0070675_100114340 3300005354 Bacteria 2287
13 Ga0070671_100088217 3300005355 Bacteria 2596
14 Ga0070673_100004453 3300005364 Bacteria 8855
15 Ga0070673_100192060 3300005364 Bacteria 1754
16 Ga0070688_100031120 3300005365 Unclassified 3208
17 Ga0070688_100048133 3300005365 Bacteria 2648
18 Ga0070688_100161872 3300005365 Bacteria 1538
19 Ga0070667_100021307 3300005367 Bacteria 5384
20 Ga0070708_100078851 3300005445 Unclassified 2978
21 Ga0070685_10004072 3300005466 Bacteria 7387
22 Ga0070685_10005832 3300005466 Bacteria 6265
23 Ga0070706_100050448 3300005467 Bacteria 3840
24 Ga0070706_100089503 3300005467 Unclassified 2854
25 Ga0070698_100006224 3300005471 Bacteria 12988
26 Ga0070698_100006763 3300005471 Bacteria 12433
27 Ga0070698_100172304 3300005471 Bacteria 2105
28 Ga0070699_100002726 3300005518 Bacteria 15756
29 Ga0070699_100023637 3300005518 Bacteria 5294
30 Ga0070697_100052020 3300005536 Bacteria 3329
31 Ga0070672_100008443 3300005543 Bacteria 7042
32 Ga0070686_100006365 3300005544 Bacteria 6553
33 Ga0070686_100019147 3300005544 Bacteria 4029
34 Ga0070686_100093132 3300005544 Bacteria 2020
35 Ga0070695_100118854 3300005545 Unclassified 1805
36 Ga0070704_100024661 3300005549 Bacteria 3949
37 Ga0068857_100072823 3300005577 Unclassified 3061
38 Ga0068857_100223048 3300005577 Bacteria 1722
39 Ga0068859_100000034 3300005617 Bacteria 171376
40 Ga0068859_100002044 3300005617 Bacteria 20607
41 Ga0068859_100020029 3300005617 Bacteria 6718
42 Ga0068859_100087240 3300005617 Bacteria 3168
43 Ga0068863_100000221 3300005841 Bacteria 60285
44 Ga0068858_100030481 3300005842 Bacteria 5008
45 Ga0068858_100032350 3300005842 Bacteria 4857
46 Ga0068858_100302861 3300005842 Bacteria 1525
47 Ga0068860_100003049 3300005843 Bacteria 17298
48 Ga0081455_10014751 3300005937 Bacteria 7626
49 Ga0081455_10026771 3300005937 Bacteria 5295
50 Ga0081538_10003396 3300005981 Bacteria 15070
51 Ga0075427_10000663 3300006194 Unclassified 4081
52 Ga0068871_100003879 3300006358 Bacteria 10310
53 Ga0075428_100005776 3300006844 Bacteria 13738
54 Ga0075428_100005919 3300006844 Bacteria 13592
55 Ga0075428_100061673 3300006844 Unclassified 4106
56 Ga0075428_100154411 3300006844 Bacteria 2494
57 Ga0075428_100455065 3300006844 Bacteria 1371
58 Ga0075430_100014067 3300006846 Bacteria 6821
59 Ga0075430_100033491 3300006846 Bacteria 4361
60 Ga0075431_100003548 3300006847 Bacteria 15103
61 Ga0075431_100013498 3300006847 Bacteria 8251
62 Ga0075431_100023058 3300006847 Bacteria 6364
63 Ga0075431_100305940 3300006847 Bacteria 1605
64 Ga0075431_100441101 3300006847 Bacteria 1299
65 Ga0075433_10027192 3300006852 Unclassified 4849
66 Ga0075433_10061065 3300006852 Bacteria 3301
67 Ga0075433_10117118 3300006852 Bacteria 2364
68 Ga0075433_10163999 3300006852 Bacteria 1978
69 Ga0075433_10215196 3300006852 Bacteria 1707
70 Ga0075434_100001928 3300006871 Bacteria 17990
71 Ga0075434_100033915 3300006871 Bacteria 5040
72 Ga0075434_100195553 3300006871 Bacteria 2042
73 Ga0075434_100226099 3300006871 Bacteria 1891
74 Ga0075434_100381848 3300006871 Bacteria 1429
75 Ga0075429_100005886 3300006880 Bacteria 10583
76 Ga0075429_100085498 3300006880 Bacteria 2749
77 Ga0075429_100119393 3300006880 Bacteria 2304
78 Ga0075429_100198639 3300006880 Bacteria 1757
79 Ga0075436_100095745 3300006914 Bacteria 2065
80 Ga0097620_100000034 3300006931 Bacteria 171376
81 Ga0097620_100002044 3300006931 Bacteria 20607
82 Ga0097620_100020029 3300006931 Bacteria 6718
83 Ga0097620_100087239 3300006931 Bacteria 3168
84 Ga0075435_100036826 3300007076 Bacteria 3891
85 Ga0111539_10033023 3300009094 Bacteria 6283
86 Ga0111539_10105026 3300009094 Bacteria 3314
87 Ga0111539_10167142 3300009094 Unclassified 2571
88 Ga0111539_10179431 3300009094 Bacteria 2474
89 Ga0105245_10034692 3300009098 Unclassified 4476
90 Ga0114129_10006272 3300009147 Bacteria 16850
91 Ga0114129_10006793 3300009147 Bacteria 16243
92 Ga0114129_10007347 3300009147 Bacteria 15683
93 Ga0114129_10010694 3300009147 Bacteria 13088
94 Ga0114129_10012634 3300009147 Bacteria 12024
95 Ga0114129_10033647 3300009147 Bacteria 7242
96 Ga0114129_10040323 3300009147 Bacteria 6582
97 Ga0114129_10063028 3300009147 Bacteria 5178
98 Ga0114129_10112255 3300009147 Bacteria 3759
99 Ga0114129_10128352 3300009147 Bacteria 3485
100 Ga0114129_10130484 3300009147 Bacteria 3452
101 Ga0114129_10143014 3300009147 Bacteria 3278
102 Ga0114129_10245606 3300009147 Bacteria 2405
103 Ga0114129_10281616 3300009147 Bacteria 2221
104 Ga0114129_10345284 3300009147 Bacteria 1973
105 Ga0105248_10000048 3300009177 Bacteria 154635
106 Ga0105249_10097400 3300009553 Bacteria 2761
107 Ga0105246_10230993 3300011119 Unclassified 1457
108 Ga0157374_10128116 3300013296 Unclassified 2455
109 Ga0163162_10001405 3300013306 Bacteria 22418
110 Ga0163162_10001921 3300013306 Bacteria 19564
111 Ga0163162_10079129 3300013306 Bacteria 3353
112 Ga0157375_10000262 3300013308 Bacteria 47771
113 Ga0157375_10165364 3300013308 Bacteria 2357
114 Ga0157379_10000264 3300014968 Bacteria 41186
115 Ga0157379_10000780 3300014968 Bacteria 25852
116 Ga0157376_10043412 3300014969 Bacteria 3690
117 Ga0213876_10001541 3300021384 Bacteria 14216
118 Ga0213876_10071270 3300021384 Bacteria 1835
119 Ga0207697_10108431 3300025315 Bacteria 1188
120 Ga0207680_10011977 3300025903 Bacteria 4404
121 Ga0207680_10091306 3300025903 Bacteria 1938
122 Ga0207684_10039596 3300025910 Unclassified 3997
123 Ga0207684_10080234 3300025910 Bacteria 2776
124 Ga0207659_10000173 3300025926 Bacteria 38585
125 Ga0207659_10000459 3300025926 Bacteria 24492
126 Ga0207644_10156419 3300025931 Unclassified 1768
127 Ga0207706_10133492 3300025933 Unclassified 2183
128 Ga0207686_10116832 3300025934 Bacteria 1809
129 Ga0207670_10010594 3300025936 Bacteria 5318
130 Ga0207691_10035133 3300025940 Bacteria 4657
131 Ga0207711_10000648 3300025941 Bacteria 34717
132 Ga0207679_10103796 3300025945 Bacteria 2229
133 Ga0207651_10053170 3300025960 Bacteria 2766
134 Ga0207658_10049502 3300025986 Bacteria 3088
135 Ga0207703_10030612 3300026035 Bacteria 4254
136 Ga0207708_10021512 3300026075 Bacteria 4864
137 Ga0207641_10000561 3300026088 Bacteria 41567
138 Ga0207674_10267856 3300026116 Bacteria 1656
139 Ga0207675_100148301 3300026118 Bacteria 2232
140 Ga0210002_1011000 3300027617 Unclassified 1395
141 Ga0209998_10005980 3300027717 Bacteria 2532
142 Ga0209974_10026862 3300027876 Bacteria 1904
143 Ga0207428_10015971 3300027907 Bacteria 6474
144 Ga0207428_10142053 3300027907 Bacteria 1831
145 Ga0268264_10015857 3300028381 Bacteria 6170
146 Ga0265319_1000049 3300028563 Bacteria 98925
147 Ga0265318_10000565 3300028577 Bacteria 26087
148 Ga0265322_10022565 3300028654 Bacteria 1801
149 Ga0265320_10001376 3300031240 Bacteria 17685
150 Ga0265316_10060423 3300031344 Bacteria 2946
151 Ga0265313_10028981 3300031595 Bacteria 2869
152 Ga0265314_10001656 3300031711 Bacteria 24340
153 Ga0436365_0852836 3300039437 Bacteria 6605
154 Ga0436365_1891555 3300039437 Bacteria 1989
155 Ga0451577_0044517 3300042876 Bacteria 3974
156 Ga0453683_0000218 3300044673 Bacteria 76321
157 Ga0453684_0005329 3300044712 Bacteria 25628
158 Ga0453684_0008338 3300044712 Bacteria 18633
159 Ga0453684_0073835 3300044712 Unclassified 4298
160 Ga0451576_0006602 3300045051 Bacteria 14183
161 Ga0451576_0007104 3300045051 Bacteria 13521
162 Ga0451576_0436597 3300045051 Bacteria 1374
163 Ga0495629_0049119 3300046459 Unclassified 2958
164 Ga0495684_0069298 3300047471 Unclassified 2682
165 Ga0501031_0106367 3300049568 Bacteria 1831
166 Ga0501034_0043660 3300049571 Bacteria 4536
167 Ga0501036_0090213 3300049572 Bacteria 2589
168 Ga0501040_0058179 3300049576 Bacteria 2654
169 Ga0501041_0051078 3300049577 Bacteria 2519
170 Ga0501042_0054118 3300049578 Bacteria 2862
171 Ga0501046_0194765 3300049580 Bacteria 1510
172 Ga0501067_0125489 3300049583 Bacteria 1428
173 Ga0501070_0150229 3300049586 Bacteria 1922
174 Ga0501072_0010566 3300049588 Bacteria 7029
175 Ga0501076_0102673 3300049592 Bacteria 2305
176 Ga0501077_0023501 3300049593 Bacteria 3909
177 Ga0501081_0011802 3300049743 Bacteria 5722
178 Ga0501044_0132769 3300049823 Unclassified 2483
179 Ga0501045_0012161 3300049824 Bacteria 6059
180 nmdc:mga05p37_101561_c1 3300050507 Unclassified 3541
181 nmdc:mga05p37_136534_c1 3300050507 Unclassified 3007
182 nmdc:mga05p37_147418_c1 3300050507 Bacteria 1972
183 nmdc:mga05p37_16808_c1 3300050507 Bacteria 8821
184 nmdc:mga05p37_17829_c1 3300050507 Bacteria 8571
185 nmdc:mga05p37_182286_c1 3300050507 Bacteria 2554
186 nmdc:mga05p37_217618_c1 3300050507 Bacteria 2306
187 nmdc:mga05p37_26675_c1 3300050507 Bacteria 7026
188 nmdc:mga05p37_300823_c1 3300050507 Unclassified 1906
189 nmdc:mga05p37_31315_c1 3300050507 Bacteria 6497
190 nmdc:mga05p37_51333_c1 3300050507 Bacteria 5072
191 nmdc:mga05p37_56117_c1 3300050507 Bacteria 4849
192 nmdc:mga05p37_5815_c1 3300050507 Bacteria 14499
193 nmdc:mga05p37_63893_c1 3300050507 Unclassified 4531
194 nmdc:mga09592_16091_c1 3300050508 Bacteria 6113
195 nmdc:mga09592_4341_c1 3300050508 Bacteria 11465
196 nmdc:mga09592_990_c1 3300050508 Bacteria 22508
197 nmdc:mga0qj67_19473_c1 3300050509 Bacteria 5185
198 nmdc:mga0qj67_5553_c1 3300050509 Bacteria 9225
199 nmdc:mga06r32_161074_c1 3300050510 Bacteria 2226
200 nmdc:mga06r32_21235_c1 3300050510 Bacteria 5993
201 nmdc:mga06r32_53168_c1 3300050510 Unclassified 3880
202 nmdc:mga06r32_54130_c1 3300050510 Viruses 3847
203 nmdc:mga08y16_145580_c1 3300050511 Unclassified 2463
204 nmdc:mga08y16_240993_c1 3300050511 Unclassified 1869
205 nmdc:mga08y16_389642_c1 3300050511 Bacteria 1427
206 nmdc:mga08y16_53586_c1 3300050511 Bacteria 4217
207 nmdc:mga08y16_99224_c1 3300050511 Bacteria 3032
208 nmdc:mga0n895_20803_c1 3300050512 Bacteria 6127
209 nmdc:mga0n895_372771_c1 3300050512 Bacteria 1445
210 nmdc:mga0n895_57462_c1 3300050512 Bacteria 3835
211 nmdc:mga0n895_61276_c1 3300050512 Bacteria 3714
212 nmdc:mga0rr50_4370_c1 3300050513 Bacteria 2615
213 nmdc:mga08x19_94951_c1 3300050514 Bacteria 1433
214 nmdc:mga0a205_102059_c1 3300050515 Bacteria 2345
215 nmdc:mga0a205_11987_c1 3300050515 Bacteria 8007
216 nmdc:mga0a205_133072_c1 3300050515 Bacteria 2387
217 nmdc:mga0a205_162914_c1 3300050515 Bacteria 2126
218 nmdc:mga0a205_16735_c1 3300050515 Bacteria 6867
219 nmdc:mga0a205_2226_c1 3300050515 Bacteria 16238
220 nmdc:mga0a205_234793_c1 3300050515 Bacteria 1716
221 nmdc:mga0a205_289056_c1 3300050515 Bacteria 1514
222 nmdc:mga0a205_6822_c1 3300050515 Bacteria 10328
223 nmdc:mga0a205_92763_c1 3300050515 Unclassified 2918
224 Ga0501082_0019727 3300060353 Bacteria 5813
225 Ga0075431_100083756
226 Ga0058859_10010271
227 Ga0058860_10091358
228 Ga0065712_10006551
229 Ga0065712_10079234
230 Ga0070670_100262284
231 Ga0070680_100317892
232 Ga0070689_100037421
233 Ga0070689_100198183
234 Ga0070675_100000040
235 Ga0070675_100000584
236 Ga0070675_100114340
237 Ga0070671_100088217
238 Ga0070673_100004453
239 Ga0070673_100192060
240 Ga0070688_100031120
241 Ga0070688_100048133
242 Ga0070688_100161872
243 Ga0070667_100021307
244 Ga0070708_100078851
245 Ga0070685_10004072
246 Ga0070685_10005832
247 Ga0070706_100050448
248 Ga0070706_100089503
249 Ga0070698_100006224
250 Ga0070698_100006763
251 Ga0070698_100172304
252 Ga0070699_100002726
253 Ga0070699_100023637
254 Ga0070697_100052020
255 Ga0070672_100008443
256 Ga0070686_100006365
257 Ga0070686_100019147
258 Ga0070686_100093132
259 Ga0070695_100118854
260 Ga0070704_100024661
261 Ga0068857_100072823
262 Ga0068857_100223048
263 Ga0068859_100000034
264 Ga0068859_100002044
265 Ga0068859_100020029
266 Ga0068859_100087240
267 Ga0068863_100000221
268 Ga0068858_100030481
269 Ga0068858_100032350
270 Ga0068858_100302861
271 Ga0068860_100003049
272 Ga0081455_10014751
273 Ga0081455_10026771
274 Ga0081538_10003396
275 Ga0075427_10000663
276 Ga0068871_100003879
277 Ga0075428_100005776
278 Ga0075428_100005919
279 Ga0075428_100061673
280 Ga0075428_100154411
281 Ga0075428_100455065
282 Ga0075430_100014067
283 Ga0075430_100033491
284 Ga0075431_100003548
285 Ga0075431_100013498
286 Ga0075431_100023058
287 Ga0075431_100305940
288 Ga0075431_100441101
289 Ga0075433_10027192
290 Ga0075433_10061065
291 Ga0075433_10117118
292 Ga0075433_10163999
293 Ga0075433_10215196
294 Ga0075434_100001928
295 Ga0075434_100033915
296 Ga0075434_100195553
297 Ga0075434_100226099
298 Ga0075434_100381848
299 Ga0075429_100005886
300 Ga0075429_100085498
301 Ga0075429_100119393
302 Ga0075429_100198639
303 Ga0075436_100095745
304 Ga0097620_100000034
305 Ga0097620_100002044
306 Ga0097620_100020029
307 Ga0097620_100087239
308 Ga0075435_100036826
309 Ga0111539_10033023
310 Ga0111539_10105026
311 Ga0111539_10167142
312 Ga0111539_10179431
313 Ga0105245_10034692
314 Ga0114129_10006272
315 Ga0114129_10006793
316 Ga0114129_10007347
317 Ga0114129_10010694
318 Ga0114129_10012634
319 Ga0114129_10033647
320 Ga0114129_10040323
321 Ga0114129_10063028
322 Ga0114129_10112255
323 Ga0114129_10128352
324 Ga0114129_10130484
325 Ga0114129_10143014
326 Ga0114129_10245606
327 Ga0114129_10281616
328 Ga0114129_10345284
329 Ga0105248_10000048
330 Ga0105249_10097400
331 Ga0105246_10230993
332 Ga0157374_10128116
333 Ga0163162_10001405
334 Ga0163162_10001921
335 Ga0163162_10079129
336 Ga0157375_10000262
337 Ga0157375_10165364
338 Ga0157379_10000264
339 Ga0157379_10000780
340 Ga0157376_10043412
341 Ga0213876_10001541
342 Ga0213876_10071270
343 Ga0207697_10108431
344 Ga0207680_10011977
345 Ga0207680_10091306
346 Ga0207684_10039596
347 Ga0207684_10080234
348 Ga0207659_10000173
349 Ga0207659_10000459
350 Ga0207644_10156419
351 Ga0207706_10133492
352 Ga0207686_10116832
353 Ga0207670_10010594
354 Ga0207691_10035133
355 Ga0207711_10000648
356 Ga0207679_10103796
357 Ga0207651_10053170
358 Ga0207658_10049502
359 Ga0207703_10030612
360 Ga0207708_10021512
361 Ga0207641_10000561
362 Ga0207674_10267856
363 Ga0207675_100148301
364 Ga0210002_1011000
365 Ga0209998_10005980
366 Ga0209974_10026862
367 Ga0207428_10015971
368 Ga0207428_10142053
369 Ga0268264_10015857
370 Ga0265319_1000049
371 Ga0265318_10000565
372 Ga0265322_10022565
373 Ga0265320_10001376
374 Ga0265316_10060423
375 Ga0265313_10028981
376 Ga0265314_10001656
377 Ga0436365_0852836
378 Ga0436365_1891555
379 Ga0451577_0044517
380 Ga0453683_0000218
381 Ga0453684_0005329
382 Ga0453684_0008338
383 Ga0453684_0073835
384 Ga0451576_0006602
385 Ga0451576_0007104
386 Ga0451576_0436597
387 Ga0495629_0049119
388 Ga0495684_0069298
389 Ga0501031_0106367
390 Ga0501034_0043660
391 Ga0501036_0090213
392 Ga0501040_0058179
393 Ga0501041_0051078
394 Ga0501042_0054118
395 Ga0501046_0194765
396 Ga0501067_0125489
397 Ga0501070_0150229
398 Ga0501072_0010566
399 Ga0501076_0102673
400 Ga0501077_0023501
401 Ga0501081_0011802
402 Ga0501044_0132769
403 Ga0501045_0012161
404 nmdc:mga05p37_101561_c1
405 nmdc:mga05p37_136534_c1
406 nmdc:mga05p37_147418_c1
407 nmdc:mga05p37_16808_c1
408 nmdc:mga05p37_17829_c1
409 nmdc:mga05p37_182286_c1
410 nmdc:mga05p37_217618_c1
411 nmdc:mga05p37_26675_c1
412 nmdc:mga05p37_300823_c1
413 nmdc:mga05p37_31315_c1
414 nmdc:mga05p37_51333_c1
415 nmdc:mga05p37_56117_c1
416 nmdc:mga05p37_5815_c1
417 nmdc:mga05p37_63893_c1
418 nmdc:mga09592_16091_c1
419 nmdc:mga09592_4341_c1
420 nmdc:mga09592_990_c1
421 nmdc:mga0qj67_19473_c1
422 nmdc:mga0qj67_5553_c1
423 nmdc:mga06r32_161074_c1
424 nmdc:mga06r32_21235_c1
425 nmdc:mga06r32_53168_c1
426 nmdc:mga06r32_54130_c1
427 nmdc:mga08y16_145580_c1
428 nmdc:mga08y16_240993_c1
429 nmdc:mga08y16_389642_c1
430 nmdc:mga08y16_53586_c1
431 nmdc:mga08y16_99224_c1
432 nmdc:mga0n895_20803_c1
433 nmdc:mga0n895_372771_c1
434 nmdc:mga0n895_57462_c1
435 nmdc:mga0n895_61276_c1
436 nmdc:mga0rr50_4370_c1
437 nmdc:mga08x19_94951_c1
438 nmdc:mga0a205_102059_c1
439 nmdc:mga0a205_11987_c1
440 nmdc:mga0a205_133072_c1
441 nmdc:mga0a205_162914_c1
442 nmdc:mga0a205_16735_c1
443 nmdc:mga0a205_2226_c1
444 nmdc:mga0a205_234793_c1
445 nmdc:mga0a205_289056_c1
446 nmdc:mga0a205_6822_c1
447 nmdc:mga0a205_92763_c1
448 Ga0501082_0019727

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01041

DegT_DnrJ_EryC1

DegT/DnrJ/EryC1/StrS aminotransferase family

18

384

0.95

PF00155

Aminotran_1_2

Aminotransferase class I and II

37

165

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dr4-assembly1.cif.gz_A gdp-perosamine synthase k186a mutant from caulobacter crescentus with bound sugar ligand 0.968 3 377
3bn1-assembly2.cif.gz_C crystal structure of gdp-perosamine synthase 0.9676 4 377
3dr4-assembly1.cif.gz_A gdp-perosamine synthase k186a mutant from caulobacter crescentus with bound sugar ligand 0.9654 3 377
1mdo-assembly1.cif.gz_A crystal structure of arnb aminotransferase with pyridomine 5' phosphate 0.9625 2 377
4oca-assembly1.cif.gz_A-2 cryatal structure of arnb k188a complexted with plp and udp-ara4n 0.9624 2 375
ID Description Score Start End Superfamily
5u1zA01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9522 13 249 3.40.640.10
3bn1B01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9435 1 250 3.40.640.10
1mdxA01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9424 1 249 3.40.640.10
af_Q58466_257_386_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.939 255 376 3.90.1150.10
3bn1B01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9318 1 250 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A0M9E7E7-F1-model_v4 Perosamine synthetase 0.985 1 149 GO:0000271
GO:0008483
GO:0030170
AF-A0A3B9Q284-F1-model_v4 Aminotransferase DegT 0.9834 120 374 GO:0000271
GO:0008483
GO:0030170
AF-A0A246F2R5-F1-model_v4 Aminotransferase DegT 0.9797 1 125 GO:0000271
GO:0008483
GO:0030170
AF-A0A1E4LU18-F1-model_v4 deleted 0.9792 1 290
AF-X1L0T4-F1-model_v4 Aminotransferase class I/classII domain-containing protein 0.9788 37 151 GO:0000271
GO:0008483
GO:0030170

Map