F336547

General Info

Members Datasets Scaffolds Average Seq Length
224 151 448 92

Family's Representative Sequence

Representative Sequence 3300006173|Ga0070716_101282946|Ga0070716_1012829461
Length 106
Sequence VIRSIRHKGLKRLYEDDDHRGVVSQHAERLRDILVRLDASATAADMDLPGFRLHPLKGEMKGFWAVTVRANWRVIFRFADGDAFDVDYLDYHSGIATEGLPWKYCH

Samples

Sample ID Description Type Environment
1 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
5 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
28 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
51 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
52 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
53 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
71 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
74 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
75 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
76 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
78 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
79 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
80 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
81 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
82 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
83 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
84 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
85 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
86 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
87 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
88 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
89 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
90 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
91 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
92 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
93 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
94 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
95 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
96 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
97 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
98 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
99 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
100 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
101 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
103 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
104 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
105 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
106 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
107 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
108 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
109 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
110 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
111 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
112 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
113 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
114 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
115 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
127 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
128 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
129 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
130 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
131 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
132 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
133 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
134 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
135 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
136 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
137 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
138 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
140 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
141 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
142 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
143 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
144 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
145 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
146 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
147 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
148 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
149 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
150 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
151 2739367865 Novosphingobium sp. GV013 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.21
Metatranscriptomes 0.89
Isolates 0.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.34
Nodule 0
Rhizoplane 0
Rhizosphere 91.52
Stem 0
Stem Tuber 0
Unclassified 24.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070716_101282946 3300006173 Unclassified 591
2 Ga0070683_100000002 3300005329 Bacteria 427530
3 Ga0070680_100646546 3300005336 Bacteria 909
4 Ga0070669_100509647 3300005353 Bacteria 999
5 Ga0070669_101091147 3300005353 Unclassified 687
6 Ga0070703_10020766 3300005406 Bacteria 1914
7 Ga0070709_10886476 3300005434 Unclassified 705
8 Ga0070714_100221074 3300005435 Bacteria 1740
9 Ga0070713_100625977 3300005436 Bacteria 1024
10 Ga0070713_101204463 3300005436 Bacteria 733
11 Ga0070710_10041643 3300005437 Unclassified 2537
12 Ga0070710_10538723 3300005437 Bacteria 805
13 Ga0070705_100002348 3300005440 Bacteria 9544
14 Ga0070694_100003392 3300005444 Bacteria 9543
15 Ga0070708_100008439 3300005445 Bacteria 8268
16 Ga0070708_100169159 3300005445 Bacteria 2040
17 Ga0070708_101093612 3300005445 Unclassified 747
18 Ga0070706_100020368 3300005467 Bacteria 6111
19 Ga0070707_100080731 3300005468 Bacteria 3139
20 Ga0070707_102237750 3300005468 Bacteria 514
21 Ga0070699_100021570 3300005518 Bacteria 5555
22 Ga0070699_100908074 3300005518 Bacteria 807
23 Ga0070679_100214788 3300005530 Bacteria 1886
24 Ga0070679_101425679 3300005530 Unclassified 639
25 Ga0070697_100443175 3300005536 Bacteria 1131
26 Ga0070697_100464655 3300005536 Bacteria 1103
27 Ga0070697_100575518 3300005536 Bacteria 989
28 Ga0070695_100024312 3300005545 Unclassified 3730
29 Ga0070696_100021919 3300005546 Bacteria 4334
30 Ga0070693_100001449 3300005547 Bacteria 10691
31 Ga0070665_102047009 3300005548 Bacteria 577
32 Ga0070665_102522075 3300005548 Unclassified 515
33 Ga0068857_100480381 3300005577 Bacteria 1164
34 Ga0068862_100057596 3300005844 Bacteria 3333
35 Ga0081455_10262578 3300005937 Bacteria 1257
36 Ga0081540_1060521 3300005983 Bacteria 1811
37 Ga0070717_10475339 3300006028 Bacteria 1128
38 Ga0070717_11488827 3300006028 Bacteria 614
39 Ga0070717_11859019 3300006028 Bacteria 544
40 Ga0075432_10341903 3300006058 Unclassified 632
41 Ga0070715_10201848 3300006163 Bacteria 1011
42 Ga0070716_100074873 3300006173 Bacteria 2001
43 Ga0070712_100642438 3300006175 Bacteria 901
44 Ga0075369_10416277 3300006186 Bacteria 634
45 Ga0097621_100020342 3300006237 Bacteria 5113
46 Ga0097621_101589451 3300006237 Bacteria 621
47 Ga0068871_100116435 3300006358 Bacteria 2253
48 Ga0068871_100710932 3300006358 Bacteria 921
49 Ga0075428_100081802 3300006844 Bacteria 3524
50 Ga0075430_100600842 3300006846 Bacteria 908
51 Ga0075431_100071262 3300006847 Bacteria 3586
52 Ga0075433_10455917 3300006852 Unclassified 1127
53 Ga0075434_100495211 3300006871 Unclassified 1243
54 Ga0075429_100058133 3300006880 Bacteria 3368
55 Ga0099794_10055675 3300007265 Bacteria 1912
56 Ga0099794_10078247 3300007265 Unclassified 1628
57 Ga0099794_10092274 3300007265 Bacteria 1504
58 Ga0099794_10116142 3300007265 Bacteria 1344
59 Ga0099794_10230592 3300007265 Unclassified 953
60 Ga0111539_10154585 3300009094 Bacteria 2685
61 Ga0105245_11356571 3300009098 Unclassified 761
62 Ga0105247_11844632 3300009101 Unclassified 504
63 Ga0114129_10125527 3300009147 Bacteria 3529
64 Ga0114129_12728016 3300009147 Unclassified 588
65 Ga0105242_10136471 3300009176 Bacteria 2124
66 Ga0105249_10052979 3300009553 Bacteria 3707
67 Ga0099796_10035627 3300010159 Bacteria 1652
68 Ga0163162_12944815 3300013306 Unclassified 547
69 Ga0163162_13286635 3300013306 Unclassified 518
70 Ga0157379_11478990 3300014968 Unclassified 660
71 Ga0157376_11891894 3300014969 Unclassified 633
72 Ga0213873_10262817 3300021358 Unclassified 549
73 Ga0213876_10108396 3300021384 Bacteria 1473
74 Ga0213876_10546963 3300021384 Unclassified 616
75 Ga0213875_10001252 3300021388 Bacteria 17132
76 Ga0213875_10006242 3300021388 Bacteria 6278
77 Ga0213875_10023124 3300021388 Bacteria 2969
78 Ga0213875_10253625 3300021388 Unclassified 830
79 Ga0207653_10019285 3300025885 Bacteria 2150
80 Ga0207692_10386558 3300025898 Bacteria 870
81 Ga0207692_10489704 3300025898 Bacteria 779
82 Ga0207685_10028503 3300025905 Bacteria 1967
83 Ga0207699_10773512 3300025906 Bacteria 705
84 Ga0207684_10017677 3300025910 Bacteria 6117
85 Ga0207684_11009437 3300025910 Bacteria 696
86 Ga0207707_10022076 3300025912 Bacteria 5563
87 Ga0207652_10367805 3300025921 Bacteria 1298
88 Ga0207646_10044595 3300025922 Bacteria 3980
89 Ga0207646_11504804 3300025922 Bacteria 583
90 Ga0207687_10395158 3300025927 Unclassified 1136
91 Ga0207700_12010143 3300025928 Bacteria 505
92 Ga0207664_10063623 3300025929 Bacteria 2949
93 Ga0207686_10091476 3300025934 Bacteria 2010
94 Ga0207665_10063572 3300025939 Bacteria 2507
95 Ga0207712_11565395 3300025961 Unclassified 591
96 Ga0207676_11491333 3300026095 Unclassified 673
97 Ga0207674_11843668 3300026116 Unclassified 571
98 Ga0209588_1006401 3300027671 Bacteria 3421
99 Ga0209588_1029855 3300027671 Bacteria 1740
100 Ga0207428_10319653 3300027907 Unclassified 1146
101 Ga0268266_10722547 3300028379 Bacteria 960
102 Ga0268265_10052798 3300028380 Bacteria 3076
103 Ga0265334_10000859 3300028573 Bacteria 15224
104 Ga0265336_10071545 3300028666 Bacteria 1037
105 Ga0265338_10052588 3300028800 Bacteria 3652
106 Ga0265338_10074974 3300028800 Bacteria 2873
107 Ga0265338_10250772 3300028800 Bacteria 1306
108 Ga0265760_10073588 3300031090 Unclassified 1050
109 Ga0265760_10200935 3300031090 Unclassified 673
110 Ga0265330_10305222 3300031235 Unclassified 671
111 Ga0265332_10131726 3300031238 Bacteria 1049
112 Ga0265320_10450099 3300031240 Unclassified 568
113 Ga0265325_10033735 3300031241 Bacteria 2728
114 Ga0265329_10121683 3300031242 Bacteria 837
115 Ga0265339_10005488 3300031249 Bacteria 8447
116 Ga0265316_10071273 3300031344 Bacteria 2679
117 Ga0265316_10105023 3300031344 Bacteria 2144
118 Ga0265316_10251963 3300031344 Bacteria 1296
119 Ga0265316_10389052 3300031344 Unclassified 1005
120 Ga0265316_10674195 3300031344 Unclassified 730
121 Ga0265313_10000131 3300031595 Bacteria 75926
122 Ga0265313_10119349 3300031595 Bacteria 1152
123 Ga0316579_10088651 3300031691 Bacteria 1476
124 Ga0265342_10139805 3300031712 Bacteria 1351
125 Ga0265342_10715848 3300031712 Unclassified 500
126 Ga0316576_10089354 3300031727 Unclassified 2294
127 Ga0316578_10024404 3300031728 Unclassified 3392
128 Ga0316583_10109153 3300032133 Bacteria 964
129 Ga0316585_10036030 3300032137 Bacteria 1567
130 Ga0316580_10011249 3300032139 Bacteria 2714
131 Ga0373953_0573231 3300035117 Unclassified 502
132 Ga0373954_0026072 3300035118 Bacteria 2677
133 Ga0316574_0392466 3300035398 Bacteria 874
134 Ga0373931_0593574 3300035691 Unclassified 723
135 Ga0373927_0501363 3300035695 Bacteria 802
136 Ga0373933_0455389 3300035724 Unclassified 837
137 Ga0373937_0219646 3300036401 Bacteria 1789
138 Ga0373937_0861624 3300036401 Bacteria 854
139 Ga0373937_1240338 3300036401 Unclassified 694
140 Ga0316582_0154874 3300036647 Unclassified 1550
141 Ga0316584_0210173 3300036712 Bacteria 1432
142 Ga0373925_0361572 3300037068 Bacteria 1180
143 Ga0373925_0582802 3300037068 Bacteria 921
144 Ga0436364_0268686 3300037853 Bacteria 657
145 Ga0436364_0275212 3300037853 Bacteria 4771
146 Ga0436364_0336053 3300037853 Bacteria 2057
147 Ga0436364_0366489 3300037853 Bacteria 2227
148 Ga0436364_0623202 3300037853 Bacteria 14823
149 Ga0436364_1331538 3300037853 Bacteria 6084
150 Ga0436365_0605453 3300039437 Bacteria 2579
151 Ga0436365_1118352 3300039437 Bacteria 1826
152 Ga0436361_0202222 3300039447 Bacteria 2235
153 Ga0436362_0259167 3300039453 Unclassified 1186
154 Ga0436362_0275269 3300039453 Bacteria 2141
155 Ga0436362_0464748 3300039453 Bacteria 2214
156 Ga0436362_0802123 3300039453 Bacteria 1045
157 Ga0436362_0905455 3300039453 Unclassified 512
158 Ga0436362_1067278 3300039453 Unclassified 531
159 Ga0453683_1075583 3300044673 Unclassified 536
160 Ga0495628_0992365 3300046516 Unclassified 578
161 Ga0495630_0078268 3300046517 Bacteria 2493
162 Ga0495645_0152083 3300046543 Bacteria 1607
163 Ga0495645_0155620 3300046543 Unclassified 1584
164 Ga0495667_0816605 3300046559 Bacteria 574
165 Ga0495599_0127006 3300046678 Bacteria 1585
166 Ga0495599_0256733 3300046678 Bacteria 1063
167 Ga0495623_0523789 3300046679 Unclassified 623
168 Ga0495674_0027832 3300047319 Bacteria 5162
169 Ga0495684_0037539 3300047471 Bacteria 3716
170 Ga0501032_0093504 3300049569 Bacteria 1994
171 Ga0501033_0130159 3300049570 Bacteria 1824
172 Ga0501036_0052651 3300049572 Bacteria 3447
173 Ga0501036_0260455 3300049572 Bacteria 1453
174 Ga0501038_0134134 3300049574 Bacteria 2030
175 Ga0501039_0036839 3300049575 Bacteria 3774
176 Ga0501039_0048044 3300049575 Bacteria 3299
177 Ga0501040_0014983 3300049576 Bacteria 5121
178 Ga0501040_0136112 3300049576 Bacteria 1729
179 Ga0501041_0019331 3300049577 Bacteria 4067
180 Ga0501041_0036911 3300049577 Bacteria 2960
181 Ga0501042_0028138 3300049578 Bacteria 3956
182 Ga0501042_0244938 3300049578 Bacteria 1293
183 Ga0501043_0092235 3300049579 Bacteria 2381
184 Ga0501046_0020640 3300049580 Bacteria 5446
185 Ga0501048_0018721 3300049582 Bacteria 5090
186 Ga0501048_0099495 3300049582 Bacteria 2051
187 Ga0501068_0176065 3300049584 Bacteria 1352
188 Ga0501071_0006453 3300049587 Bacteria 7613
189 Ga0501072_0026745 3300049588 Bacteria 4500
190 Ga0501072_0219323 3300049588 Unclassified 1516
191 Ga0501073_0337911 3300049589 Bacteria 1040
192 Ga0501073_0739572 3300049589 Bacteria 678
193 Ga0501073_0809691 3300049589 Unclassified 645
194 Ga0501074_0021938 3300049590 Bacteria 4637
195 Ga0501074_0191951 3300049590 Bacteria 1456
196 Ga0501075_0044607 3300049591 Bacteria 3327
197 Ga0501075_0060109 3300049591 Bacteria 2863
198 Ga0501076_0003264 3300049592 Bacteria 11354
199 Ga0501076_0071358 3300049592 Bacteria 2778
200 Ga0501077_0005607 3300049593 Bacteria 7644
201 Ga0501077_0027364 3300049593 Bacteria 3621
202 Ga0501079_0021828 3300049741 Bacteria 4901
203 Ga0501080_0017024 3300049742 Bacteria 6712
204 Ga0501080_0032441 3300049742 Bacteria 4872
205 Ga0501081_0019769 3300049743 Bacteria 4487
206 Ga0501081_0094856 3300049743 Bacteria 2102
207 Ga0501083_0021340 3300049744 Bacteria 4500
208 Ga0501083_0071189 3300049744 Bacteria 2312
209 Ga0501044_0320797 3300049823 Unclassified 1474
210 Ga0501044_0410889 3300049823 Bacteria 1265
211 Ga0501045_0040354 3300049824 Bacteria 3397
212 Ga0501045_0069241 3300049824 Bacteria 2593
213 nmdc:mga05p37_96213_c1 3300050507 Bacteria 3648
214 nmdc:mga09592_132469_c1 3300050508 Unclassified 2146
215 nmdc:mga0qj67_104309_c1 3300050509 Bacteria 2287
216 nmdc:mga06r32_114949_c1 3300050510 Unclassified 2650
217 nmdc:mga08y16_178842_c1 3300050511 Bacteria 2203
218 nmdc:mga0n895_575509_c1 3300050512 Unclassified 1130
219 nmdc:mga0sz30_184543_c1 3300050516 Bacteria 926
220 Ga0500641_0163466 3300053096 Bacteria 959
221 Ga0501084_0074159 3300054114 Bacteria 2849
222 Ga0501082_0243135 3300060353 Bacteria 1566
223 2739652288 2739367664 Bacteria 4114334
224 2740030762 2739367865 Bacteria 4114482
225 Ga0070716_101282946
226 Ga0070683_100000002
227 Ga0070680_100646546
228 Ga0070669_100509647
229 Ga0070669_101091147
230 Ga0070703_10020766
231 Ga0070709_10886476
232 Ga0070714_100221074
233 Ga0070713_100625977
234 Ga0070713_101204463
235 Ga0070710_10041643
236 Ga0070710_10538723
237 Ga0070705_100002348
238 Ga0070694_100003392
239 Ga0070708_100008439
240 Ga0070708_100169159
241 Ga0070708_101093612
242 Ga0070706_100020368
243 Ga0070707_100080731
244 Ga0070707_102237750
245 Ga0070699_100021570
246 Ga0070699_100908074
247 Ga0070679_100214788
248 Ga0070679_101425679
249 Ga0070697_100443175
250 Ga0070697_100464655
251 Ga0070697_100575518
252 Ga0070695_100024312
253 Ga0070696_100021919
254 Ga0070693_100001449
255 Ga0070665_102047009
256 Ga0070665_102522075
257 Ga0068857_100480381
258 Ga0068862_100057596
259 Ga0081455_10262578
260 Ga0081540_1060521
261 Ga0070717_10475339
262 Ga0070717_11488827
263 Ga0070717_11859019
264 Ga0075432_10341903
265 Ga0070715_10201848
266 Ga0070716_100074873
267 Ga0070712_100642438
268 Ga0075369_10416277
269 Ga0097621_100020342
270 Ga0097621_101589451
271 Ga0068871_100116435
272 Ga0068871_100710932
273 Ga0075428_100081802
274 Ga0075430_100600842
275 Ga0075431_100071262
276 Ga0075433_10455917
277 Ga0075434_100495211
278 Ga0075429_100058133
279 Ga0099794_10055675
280 Ga0099794_10078247
281 Ga0099794_10092274
282 Ga0099794_10116142
283 Ga0099794_10230592
284 Ga0111539_10154585
285 Ga0105245_11356571
286 Ga0105247_11844632
287 Ga0114129_10125527
288 Ga0114129_12728016
289 Ga0105242_10136471
290 Ga0105249_10052979
291 Ga0099796_10035627
292 Ga0163162_12944815
293 Ga0163162_13286635
294 Ga0157379_11478990
295 Ga0157376_11891894
296 Ga0213873_10262817
297 Ga0213876_10108396
298 Ga0213876_10546963
299 Ga0213875_10001252
300 Ga0213875_10006242
301 Ga0213875_10023124
302 Ga0213875_10253625
303 Ga0207653_10019285
304 Ga0207692_10386558
305 Ga0207692_10489704
306 Ga0207685_10028503
307 Ga0207699_10773512
308 Ga0207684_10017677
309 Ga0207684_11009437
310 Ga0207707_10022076
311 Ga0207652_10367805
312 Ga0207646_10044595
313 Ga0207646_11504804
314 Ga0207687_10395158
315 Ga0207700_12010143
316 Ga0207664_10063623
317 Ga0207686_10091476
318 Ga0207665_10063572
319 Ga0207712_11565395
320 Ga0207676_11491333
321 Ga0207674_11843668
322 Ga0209588_1006401
323 Ga0209588_1029855
324 Ga0207428_10319653
325 Ga0268266_10722547
326 Ga0268265_10052798
327 Ga0265334_10000859
328 Ga0265336_10071545
329 Ga0265338_10052588
330 Ga0265338_10074974
331 Ga0265338_10250772
332 Ga0265760_10073588
333 Ga0265760_10200935
334 Ga0265330_10305222
335 Ga0265332_10131726
336 Ga0265320_10450099
337 Ga0265325_10033735
338 Ga0265329_10121683
339 Ga0265339_10005488
340 Ga0265316_10071273
341 Ga0265316_10105023
342 Ga0265316_10251963
343 Ga0265316_10389052
344 Ga0265316_10674195
345 Ga0265313_10000131
346 Ga0265313_10119349
347 Ga0316579_10088651
348 Ga0265342_10139805
349 Ga0265342_10715848
350 Ga0316576_10089354
351 Ga0316578_10024404
352 Ga0316583_10109153
353 Ga0316585_10036030
354 Ga0316580_10011249
355 Ga0373953_0573231
356 Ga0373954_0026072
357 Ga0316574_0392466
358 Ga0373931_0593574
359 Ga0373927_0501363
360 Ga0373933_0455389
361 Ga0373937_0219646
362 Ga0373937_0861624
363 Ga0373937_1240338
364 Ga0316582_0154874
365 Ga0316584_0210173
366 Ga0373925_0361572
367 Ga0373925_0582802
368 Ga0436364_0268686
369 Ga0436364_0275212
370 Ga0436364_0336053
371 Ga0436364_0366489
372 Ga0436364_0623202
373 Ga0436364_1331538
374 Ga0436365_0605453
375 Ga0436365_1118352
376 Ga0436361_0202222
377 Ga0436362_0259167
378 Ga0436362_0275269
379 Ga0436362_0464748
380 Ga0436362_0802123
381 Ga0436362_0905455
382 Ga0436362_1067278
383 Ga0453683_1075583
384 Ga0495628_0992365
385 Ga0495630_0078268
386 Ga0495645_0152083
387 Ga0495645_0155620
388 Ga0495667_0816605
389 Ga0495599_0127006
390 Ga0495599_0256733
391 Ga0495623_0523789
392 Ga0495674_0027832
393 Ga0495684_0037539
394 Ga0501032_0093504
395 Ga0501033_0130159
396 Ga0501036_0052651
397 Ga0501036_0260455
398 Ga0501038_0134134
399 Ga0501039_0036839
400 Ga0501039_0048044
401 Ga0501040_0014983
402 Ga0501040_0136112
403 Ga0501041_0019331
404 Ga0501041_0036911
405 Ga0501042_0028138
406 Ga0501042_0244938
407 Ga0501043_0092235
408 Ga0501046_0020640
409 Ga0501048_0018721
410 Ga0501048_0099495
411 Ga0501068_0176065
412 Ga0501071_0006453
413 Ga0501072_0026745
414 Ga0501072_0219323
415 Ga0501073_0337911
416 Ga0501073_0739572
417 Ga0501073_0809691
418 Ga0501074_0021938
419 Ga0501074_0191951
420 Ga0501075_0044607
421 Ga0501075_0060109
422 Ga0501076_0003264
423 Ga0501076_0071358
424 Ga0501077_0005607
425 Ga0501077_0027364
426 Ga0501079_0021828
427 Ga0501080_0017024
428 Ga0501080_0032441
429 Ga0501081_0019769
430 Ga0501081_0094856
431 Ga0501083_0021340
432 Ga0501083_0071189
433 Ga0501044_0320797
434 Ga0501044_0410889
435 Ga0501045_0040354
436 Ga0501045_0069241
437 nmdc:mga05p37_96213_c1
438 nmdc:mga09592_132469_c1
439 nmdc:mga0qj67_104309_c1
440 nmdc:mga06r32_114949_c1
441 nmdc:mga08y16_178842_c1
442 nmdc:mga0n895_575509_c1
443 nmdc:mga0sz30_184543_c1
444 Ga0500641_0163466
445 Ga0501084_0074159
446 Ga0501082_0243135
447 2739652288
448 2740030762

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05015

HigB-like_toxin

RelE-like toxin of type II toxin-antitoxin system HigB

3

92

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ixl-assembly7.cif.gz_G structure of p. vulgaris higb toxin y91a variant 0.9726 1 92
4yzv-assembly2.cif.gz_XY precleavage 70s structure of the p. vulgaris higb deltah92 toxin bound to the aca codon 0.9712 1 91
4px8-assembly1.cif.gz_A structure of p. vulgaris higb toxin 0.9644 1 92
5ixl-assembly7.cif.gz_G structure of p. vulgaris higb toxin y91a variant 0.9624 1 92
4yzv-assembly2.cif.gz_XY precleavage 70s structure of the p. vulgaris higb deltah92 toxin bound to the aca codon 0.9609 1 91
ID Description Score Start End Superfamily
5ixlB00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.9576 1 92 3.30.2310.20
4mctB00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.9501 2 90 3.30.2310.20
5ixlB00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.9477 1 92 3.30.2310.20
4mctB00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.94 2 90 3.30.2310.20
af_Q0DEC4_91_476_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7082 51 90 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A6L7VZX2-F1-model_v4 Peptidase 0.9981 1 92
AF-A0A7C3LAP5-F1-model_v4 Peptidase 0.9962 1 92
AF-A0A1F2U388-F1-model_v4 Peptidase 0.9935 1 92
AF-A0A350Z411-F1-model_v4 deleted 0.9935 1 92
AF-A0A397NFG9-F1-model_v4 Proteic killer suppression protein 0.9926 1 92

Map