F336519

General Info

Members Datasets Scaffolds Average Seq Length
224 134 212 161

Family's Representative Sequence

Representative Sequence 3300005981|Ga0081538_10001299|Ga0081538_100012991
Length 163
Sequence MRIGFGYDAHPLVPERALVLGGVTIPYERGLLGHSDADVVVHALCDAMLGALALGDLGQHFPSTDDRWRGVSSLVLLRQVTALLAERQYVLSNADITVVAQRPRLAPYISQMMQTLTATVAGAPGQISVKATTTDGLGFTGQEAGIAAYAVCMVCPQEPAQGR

Samples

Sample ID Description Type Environment
1 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
2 2740891818 Desulfofaba hansenii DSM 12642 Isolate Unclassified
3 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
4 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
5 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
6 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
7 2857472729 Cohnella sp. R-74144 Isolate Unclassified
8 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
9 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
22 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
25 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
26 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
29 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
35 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
36 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
43 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
44 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
45 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
46 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
47 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
48 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
49 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
50 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
51 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
52 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
53 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
54 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
55 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
56 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
57 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
58 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
59 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
60 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
61 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
62 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
63 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
64 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
65 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
66 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
67 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
68 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
69 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
70 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
71 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
72 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
73 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
74 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
75 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
76 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
77 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
78 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
79 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
80 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
81 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
82 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
83 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
84 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
85 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
86 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
87 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
88 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
89 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
90 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
91 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
92 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
93 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
94 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
95 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
96 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
97 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
98 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
113 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
114 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
115 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
116 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
117 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
118 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
119 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
122 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
123 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
124 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
125 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
126 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
127 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
128 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
129 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
130 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
131 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
132 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
133 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
134 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.64
Metatranscriptomes 0
Isolates 5.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.89
Nodule 0
Rhizoplane 5.36
Rhizosphere 85.71
Stem 0
Stem Tuber 0
Unclassified 8.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10147085 3300005295 Bacteria 1701
2 Ga0068869_100091358 3300005334 Bacteria 2290
3 Ga0070659_100014506 3300005366 Bacteria 5889
4 Ga0070714_100001996 3300005435 Bacteria 14913
5 Ga0070662_100874533 3300005457 Bacteria 766
6 Ga0070679_100017800 3300005530 Bacteria 6882
7 Ga0070697_100336997 3300005536 Unclassified 1301
8 Ga0068853_100892114 3300005539 Bacteria 854
9 Ga0070696_100712674 3300005546 Bacteria 819
10 Ga0068854_101482730 3300005578 Bacteria 615
11 Ga0068856_100353839 3300005614 Bacteria 1487
12 Ga0068866_10605936 3300005718 Bacteria 740
13 Ga0081538_10001299 3300005981 Bacteria 25836
14 Ga0075428_100736143 3300006844 Bacteria 1049
15 Ga0075428_100742764 3300006844 Unclassified 1044
16 Ga0075430_100266446 3300006846 Bacteria 1418
17 Ga0075435_100052376 3300007076 Bacteria 3290
18 Ga0111539_10007683 3300009094 Bacteria 13774
19 Ga0111539_10140563 3300009094 Bacteria 2827
20 Ga0111539_10159102 3300009094 Bacteria 2642
21 Ga0114129_10010508 3300009147 Bacteria 13205
22 Ga0114129_10634879 3300009147 Unclassified 1380
23 Ga0114129_11481326 3300009147 Bacteria 835
24 Ga0105241_10533789 3300009174 Unclassified 1051
25 Ga0105242_10976148 3300009176 Bacteria 853
26 Ga0105237_10227000 3300009545 Bacteria 1868
27 Ga0105249_12868336 3300009553 Bacteria 553
28 Ga0157373_10312707 3300013100 Unclassified 1116
29 Ga0157370_10003438 3300013104 Bacteria 18595
30 Ga0157375_11180767 3300013308 Bacteria 897
31 Ga0163163_10427932 3300014325 Bacteria 1383
32 Ga0207699_10955689 3300025906 Bacteria 633
33 Ga0207652_10597133 3300025921 Bacteria 990
34 Ga0207664_10003403 3300025929 Bacteria 10595
35 Ga0207690_11243178 3300025932 Bacteria 622
36 Ga0207706_10174558 3300025933 Bacteria 1888
37 Ga0207689_10256444 3300025942 Bacteria 1446
38 Ga0207428_10161728 3300027907 Bacteria 1700
39 Ga0265338_10042652 3300028800 Bacteria 4222
40 Ga0265324_10000120 3300029957 Bacteria 61840
41 Ga0265324_10005857 3300029957 Bacteria 5227
42 Ga0265320_10195118 3300031240 Bacteria 905
43 Ga0265325_10019397 3300031241 Bacteria 3759
44 Ga0265327_10011644 3300031251 Bacteria 6031
45 Ga0307408_100142328 3300031548 Bacteria 1884
46 Ga0307408_100273297 3300031548 Bacteria 1404
47 Ga0307408_100508253 3300031548 Bacteria 1056
48 Ga0316575_10000147 3300031665 Bacteria 17888
49 Ga0316575_10075510 3300031665 Bacteria 1356
50 Ga0316575_10083001 3300031665 Bacteria 1293
51 Ga0316579_10019630 3300031691 Bacteria 2988
52 Ga0316579_10021055 3300031691 Bacteria 2900
53 Ga0316579_10031428 3300031691 Bacteria 2431
54 Ga0265314_10000371 3300031711 Bacteria 61424
55 Ga0265314_10156123 3300031711 Bacteria 1393
56 Ga0265314_10395040 3300031711 Bacteria 749
57 Ga0316576_10593041 3300031727 Bacteria 809
58 Ga0316578_10007571 3300031728 Bacteria 5456
59 Ga0316578_10037573 3300031728 Bacteria 2790
60 Ga0316577_10366759 3300031733 Bacteria 818
61 Ga0307412_11569205 3300031911 Bacteria 600
62 Ga0316583_10009777 3300032133 Bacteria 3456
63 Ga0316583_10032223 3300032133 Bacteria 1864
64 Ga0316583_10174917 3300032133 Bacteria 747
65 Ga0316585_10101804 3300032137 Bacteria 943
66 Ga0316585_10258759 3300032137 Bacteria 577
67 Ga0373938_0194139 3300034957 Bacteria 560
68 Ga0373932_0111437 3300035112 Bacteria 902
69 Ga0373960_0111522 3300035121 Bacteria 898
70 Ga0373931_0251163 3300035691 Bacteria 1075
71 Ga0316582_0004812 3300036647 Bacteria 6884
72 Ga0316582_0016947 3300036647 Bacteria 4202
73 Ga0316582_0078141 3300036647 Bacteria 2155
74 Ga0316582_0270157 3300036647 Bacteria 1167
75 Ga0316584_0011242 3300036712 Bacteria 6284
76 Ga0316584_0512357 3300036712 Bacteria 842
77 Ga0395899_0022210 3300037312 Bacteria 4811
78 Ga0395899_0207589 3300037312 Bacteria 1363
79 Ga0395900_0218634 3300037418 Bacteria 1921
80 Ga0395900_0231430 3300037418 Bacteria 1858
81 Ga0395900_0402198 3300037418 Bacteria 1333
82 Ga0395900_1306617 3300037418 Bacteria 639
83 Ga0395898_0122709 3300037466 Bacteria 2489
84 Ga0395898_1146575 3300037466 Unclassified 710
85 Ga0316581_0154946 3300037588 Bacteria 706
86 Ga0395901_0145660 3300038443 Bacteria 2489
87 Ga0395901_0711817 3300038443 Bacteria 1001
88 Ga0395901_1201843 3300038443 Bacteria 724
89 Ga0400484_09670 3300038725 Bacteria 2745
90 Ga0400484_23199 3300038725 Bacteria 26008
91 Ga0400491_27814 3300038727 Bacteria 2775
92 Ga0400485_01789 3300038735 Bacteria 21984
93 Ga0400485_09653 3300038735 Bacteria 7588
94 Ga0400488_53790 3300038741 Bacteria 7889
95 Ga0400486_10230 3300038742 Bacteria 4152
96 Ga0400486_30679 3300038742 Bacteria 32707
97 Ga0400483_074111 3300039062 Bacteria 1236
98 Ga0400483_087037 3300039062 Bacteria 5067
99 Ga0400489_95091 3300039093 Bacteria 17612
100 Ga0400487_23018 3300039110 Bacteria 9803
101 Ga0400487_26362 3300039110 Bacteria 1656
102 Ga0451795_0309167 3300041456 Bacteria 719
103 Ga0451795_0419890 3300041456 Unclassified 512
104 Ga0451798_0110857 3300041458 Bacteria 697
105 Ga0439449_0025175 3300042007 Bacteria 2224
106 Ga0439455_0050583 3300042012 Bacteria 1085
107 Ga0439462_0039548 3300042015 Bacteria 1257
108 Ga0450890_039651 3300042127 Bacteria 693
109 Ga0450897_031965 3300042128 Bacteria 598
110 Ga0439446_0087823 3300042156 Bacteria 970
111 Ga0450909_013702 3300042185 Bacteria 1193
112 Ga0451577_0000175 3300042876 Bacteria 141754
113 Ga0451577_0027225 3300042876 Bacteria 5174
114 Ga0451577_0262172 3300042876 Bacteria 1565
115 Ga0453683_0004158 3300044673 Bacteria 10362
116 Ga0453684_0000004 3300044712 Bacteria 1469893
117 Ga0453684_0000029 3300044712 Bacteria 757969
118 Ga0453684_0001586 3300044712 Bacteria 62739
119 Ga0453684_0039523 3300044712 Bacteria 6427
120 Ga0453684_0361709 3300044712 Unclassified 1634
121 Ga0453684_0471871 3300044712 Bacteria 1393
122 Ga0451576_0000013 3300045051 Bacteria 665120
123 Ga0451576_0123534 3300045051 Bacteria 2696
124 Ga0495621_0016917 3300046539 Bacteria 2348
125 Ga0496101_0278530 3300048904 Bacteria 1307
126 Ga0496106_0383078 3300048909 Bacteria 1130
127 Ga0496108_0096421 3300048911 Bacteria 2519
128 Ga0496109_0319926 3300048912 Bacteria 1464
129 Ga0496110_0425846 3300048913 Bacteria 1210
130 Ga0496112_0553880 3300048915 Bacteria 1084
131 Ga0496114_0005402 3300048917 Bacteria 9993
132 Ga0496114_0194887 3300048917 Bacteria 1773
133 Ga0496114_1404977 3300048917 Bacteria 585
134 Ga0501031_0001054 3300049568 Bacteria 16719
135 Ga0501031_0012290 3300049568 Bacteria 5581
136 Ga0501031_0078757 3300049568 Bacteria 2147
137 Ga0501031_0272602 3300049568 Bacteria 1098
138 Ga0501032_0000306 3300049569 Bacteria 41367
139 Ga0501032_0004826 3300049569 Bacteria 10105
140 Ga0501033_0007242 3300049570 Bacteria 8656
141 Ga0501033_0018593 3300049570 Bacteria 5252
142 Ga0501033_0043447 3300049570 Bacteria 3347
143 Ga0501033_0088665 3300049570 Bacteria 2264
144 Ga0501034_0001385 3300049571 Bacteria 32621
145 Ga0501034_0278279 3300049571 Bacteria 1613
146 Ga0501036_0000487 3300049572 Bacteria 28375
147 Ga0501036_0003738 3300049572 Bacteria 12192
148 Ga0501036_0007541 3300049572 Bacteria 8876
149 Ga0501037_0000868 3300049573 Bacteria 22587
150 Ga0501037_0018483 3300049573 Bacteria 5138
151 Ga0501037_0109318 3300049573 Bacteria 1992
152 Ga0501038_0004594 3300049574 Bacteria 12845
153 Ga0501038_0005103 3300049574 Bacteria 12203
154 Ga0501038_0030854 3300049574 Bacteria 4739
155 Ga0501038_0032588 3300049574 Bacteria 4596
156 Ga0501038_0063137 3300049574 Bacteria 3163
157 Ga0501038_0097239 3300049574 Bacteria 2456
158 Ga0501039_0008271 3300049575 Bacteria 7929
159 Ga0501039_0012954 3300049575 Bacteria 6375
160 Ga0501039_0977144 3300049575 Bacteria 658
161 Ga0501040_0000121 3300049576 Bacteria 41506
162 Ga0501042_0000089 3300049578 Bacteria 35548
163 Ga0501043_0000665 3300049579 Bacteria 30366
164 Ga0501043_0510057 3300049579 Bacteria 897
165 Ga0501046_0001686 3300049580 Bacteria 21120
166 Ga0501046_0003715 3300049580 Bacteria 13969
167 Ga0501046_0009568 3300049580 Bacteria 8362
168 Ga0501046_0869039 3300049580 Bacteria 630
169 Ga0501047_0006522 3300049581 Bacteria 10983
170 Ga0501047_0007839 3300049581 Bacteria 10060
171 Ga0501048_0002466 3300049582 Bacteria 14121
172 Ga0501068_0000711 3300049584 Bacteria 17044
173 Ga0501068_0034493 3300049584 Bacteria 3017
174 Ga0501070_0081506 3300049586 Unclassified 2677
175 Ga0501070_0384910 3300049586 Bacteria 1136
176 Ga0501073_0050823 3300049589 Bacteria 2904
177 Ga0501077_0749572 3300049593 Bacteria 628
178 Ga0501079_0042954 3300049741 Bacteria 3490
179 Ga0501080_0130526 3300049742 Bacteria 2326
180 Ga0501282_005488 3300049778 Bacteria 1355
181 Ga0501035_0000462 3300049822 Bacteria 45527
182 Ga0501035_0001288 3300049822 Bacteria 25883
183 Ga0501035_0031094 3300049822 Bacteria 4862
184 Ga0501035_0032859 3300049822 Bacteria 4718
185 Ga0501035_0435115 3300049822 Bacteria 1087
186 Ga0501035_0531459 3300049822 Bacteria 965
187 Ga0501035_0939000 3300049822 Bacteria 683
188 Ga0501044_0001318 3300049823 Bacteria 29197
189 Ga0501044_0002690 3300049823 Bacteria 20211
190 Ga0501044_0057920 3300049823 Bacteria 3974
191 Ga0501044_0136903 3300049823 Bacteria 2440
192 Ga0501044_0309763 3300049823 Bacteria 1506
193 Ga0501044_0363777 3300049823 Bacteria 1364
194 Ga0501045_0001772 3300049824 Bacteria 14572
195 nmdc:mga05p37_1373705_c1 3300050507 Bacteria 714
196 nmdc:mga05p37_149_c1 3300050507 Bacteria 65984
197 nmdc:mga05p37_1558398_c1 3300050507 Bacteria 654
198 nmdc:mga05p37_172613_c1 3300050507 Bacteria 2636
199 nmdc:mga05p37_202099_c1 3300050507 Bacteria 2406
200 nmdc:mga05p37_756307_c1 3300050507 Bacteria 1070
201 nmdc:mga0qj67_400293_c1 3300050509 Bacteria 1108
202 nmdc:mga06r32_1206937_c1 3300050510 Bacteria 703
203 nmdc:mga06r32_323739_c1 3300050510 Bacteria 1527
204 nmdc:mga08y16_50843_c1 3300050511 Bacteria 4337
205 nmdc:mga08y16_57925_c1 3300050511 Bacteria 4048
206 nmdc:mga0n895_359967_c1 3300050512 Bacteria 1473
207 nmdc:mga0rr50_402195_c1 3300050513 Bacteria 1157
208 nmdc:mga08x19_29793_c1 3300050514 Bacteria 3425
209 nmdc:mga08x19_39_c1 3300050514 Bacteria 158844
210 Ga0500635_0000101 3300053080 Bacteria 51182
211 Ga0500599_047734 3300053736 Bacteria 673
212 Ga0501082_0109206 3300060353 Bacteria 2394

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049822 Ga0501035_0939000 Ga0501035_0939000_56_487 140
2 3300049823 Ga0501044_0136903 Ga0501044_0136903_1996_2427 140
3 iso_pu_bacteria 2740891818 2740992233 153
4 iso_pu_bacteria 2964375228 2964375257 153
5 iso_pu_bacteria 2857472729 2857479002 154
6 iso_pu_bacteria 8057473075 8057473413 154
7 3300005546 Ga0070696_100712674 Ga0070696_1007126742 155
8 3300025906 Ga0207699_10955689 Ga0207699_109556892 155
9 3300031665 Ga0316575_10075510 Ga0316575_100755102 155
10 3300031665 Ga0316575_10083001 Ga0316575_100830013 155
11 3300031691 Ga0316579_10019630 Ga0316579_100196303 155
12 3300031691 Ga0316579_10031428 Ga0316579_100314282 155
13 3300031727 Ga0316576_10593041 Ga0316576_105930412 155
14 3300031728 Ga0316578_10037573 Ga0316578_100375732 155
15 3300031733 Ga0316577_10366759 Ga0316577_103667591 155
16 3300032133 Ga0316583_10174917 Ga0316583_101749171 155
17 3300032137 Ga0316585_10101804 Ga0316585_101018041 155
18 3300032137 Ga0316585_10258759 Ga0316585_102587591 155
19 3300036647 Ga0316582_0016947 Ga0316582_0016947_3327_3794 155
20 3300036647 Ga0316582_0078141 Ga0316582_0078141_637_1104 155
21 3300036712 Ga0316584_0011242 Ga0316584_0011242_5114_5581 155
22 3300037588 Ga0316581_0154946 Ga0316581_0154946_84_551 155
23 3300049589 Ga0501073_0050823 Ga0501073_0050823_1129_1596 155
24 3300050512 nmdc:mga0n895_359967_c1 nmdc:mga0n895_359967_c1_803_1270 155
25 3300050514 nmdc:mga08x19_29793_c1 nmdc:mga08x19_29793_c1_1950_2417 155
26 iso_pu_bacteria 8002317523 8002324025 155
27 iso_pu_bacteria 8046991243 8046991348 155
28 3300028800 Ga0265338_10042652 Ga0265338_100426525 156
29 3300029957 Ga0265324_10000120 Ga0265324_1000012015 156
30 3300029957 Ga0265324_10005857 Ga0265324_100058572 156
31 3300031241 Ga0265325_10019397 Ga0265325_100193973 156
32 3300031711 Ga0265314_10000371 Ga0265314_1000037147 156
33 3300031711 Ga0265314_10156123 Ga0265314_101561231 156
34 3300036647 Ga0316582_0270157 Ga0316582_0270157_619_1089 156
35 3300049568 Ga0501031_0078757 Ga0501031_0078757_892_1362 156
36 3300049570 Ga0501033_0043447 Ga0501033_0043447_1028_1498 156
37 3300049573 Ga0501037_0018483 Ga0501037_0018483_4230_4700 156
38 3300049574 Ga0501038_0032588 Ga0501038_0032588_2206_2676 156
39 3300049580 Ga0501046_0009568 Ga0501046_0009568_3599_4069 156
40 3300049584 Ga0501068_0034493 Ga0501068_0034493_712_1182 156
41 3300049741 Ga0501079_0042954 Ga0501079_0042954_2760_3230 156
42 3300049822 Ga0501035_0032859 Ga0501035_0032859_764_1234 156
43 3300060353 Ga0501082_0109206 Ga0501082_0109206_1156_1626 156
44 3300031548 Ga0307408_100508253 Ga0307408_1005082532 157
45 3300031665 Ga0316575_10000147 Ga0316575_1000014716 157
46 3300031691 Ga0316579_10021055 Ga0316579_100210553 157
47 3300031728 Ga0316578_10007571 Ga0316578_100075714 157
48 3300032133 Ga0316583_10009777 Ga0316583_100097773 157
49 3300036647 Ga0316582_0004812 Ga0316582_0004812_2629_3102 157
50 3300036712 Ga0316584_0512357 Ga0316584_0512357_346_819 157
51 3300044712 Ga0453684_0000029 Ga0453684_0000029_427367_427840 157
52 3300044712 Ga0453684_0039523 Ga0453684_0039523_2735_3208 157
53 3300049580 Ga0501046_0869039 Ga0501046_0869039_127_600 157
54 3300049581 Ga0501047_0006522 Ga0501047_0006522_3509_3982 157
55 3300049586 Ga0501070_0384910 Ga0501070_0384910_216_689 157
56 3300049742 Ga0501080_0130526 Ga0501080_0130526_1817_2290 157
57 3300049822 Ga0501035_0435115 Ga0501035_0435115_306_779 157
58 3300053736 Ga0500599_047734 Ga0500599_047734_173_646 157
59 3300005981 Ga0081538_10001299 Ga0081538_100012991 158
60 3300031251 Ga0265327_10011644 Ga0265327_100116445 158
61 3300037312 Ga0395899_0022210 Ga0395899_0022210_1789_2265 158
62 3300037418 Ga0395900_0218634 Ga0395900_0218634_1378_1854 158
63 3300037466 Ga0395898_0122709 Ga0395898_0122709_1418_1894 158
64 3300038443 Ga0395901_0145660 Ga0395901_0145660_596_1072 158
65 3300038725 Ga0400484_23199 Ga0400484_23199_19909_20445 158
66 3300038727 Ga0400491_27814 Ga0400491_27814_1673_2149 158
67 3300038735 Ga0400485_01789 Ga0400485_01789_19950_20426 158
68 3300038735 Ga0400485_09653 Ga0400485_09653_3570_4046 158
69 3300038742 Ga0400486_10230 Ga0400486_10230_3539_4015 158
70 3300038742 Ga0400486_30679 Ga0400486_30679_7443_7919 158
71 3300039062 Ga0400483_074111 Ga0400483_074111_400_936 158
72 3300039062 Ga0400483_087037 Ga0400483_087037_3461_3946 158
73 3300039093 Ga0400489_95091 Ga0400489_95091_3524_4000 158
74 3300039110 Ga0400487_23018 Ga0400487_23018_5670_6146 158
75 3300039110 Ga0400487_26362 Ga0400487_26362_801_1286 158
76 3300041456 Ga0451795_0309167 Ga0451795_0309167_204_680 158
77 3300041456 Ga0451795_0419890 Ga0451795_0419890_11_487 158
78 3300042876 Ga0451577_0262172 Ga0451577_0262172_321_803 158
79 3300044673 Ga0453683_0004158 Ga0453683_0004158_6178_6654 158
80 3300044712 Ga0453684_0361709 Ga0453684_0361709_1023_1502 158
81 3300045051 Ga0451576_0000013 Ga0451576_0000013_266157_266633 158
82 3300045051 Ga0451576_0123534 Ga0451576_0123534_1292_1768 158
83 3300006844 Ga0075428_100742764 Ga0075428_1007427642 159
84 3300031548 Ga0307408_100142328 Ga0307408_1001423282 159
85 3300031711 Ga0265314_10395040 Ga0265314_103950402 159
86 3300031911 Ga0307412_11569205 Ga0307412_115692052 159
87 3300034957 Ga0373938_0194139 Ga0373938_0194139_29_508 159
88 3300035112 Ga0373932_0111437 Ga0373932_0111437_328_807 159
89 3300035121 Ga0373960_0111522 Ga0373960_0111522_380_859 159
90 3300035691 Ga0373931_0251163 Ga0373931_0251163_329_808 159
91 3300042007 Ga0439449_0025175 Ga0439449_0025175_1426_1905 159
92 3300042012 Ga0439455_0050583 Ga0439455_0050583_12_491 159
93 3300042015 Ga0439462_0039548 Ga0439462_0039548_615_1094 159
94 3300042127 Ga0450890_039651 Ga0450890_039651_164_643 159
95 3300042156 Ga0439446_0087823 Ga0439446_0087823_223_702 159
96 3300042876 Ga0451577_0000175 Ga0451577_0000175_47767_48246 159
97 3300044712 Ga0453684_0000004 Ga0453684_0000004_529119_529598 159
98 3300050507 nmdc:mga05p37_1373705_c1 nmdc:mga05p37_1373705_c1_183_662 159
99 3300005530 Ga0070679_100017800 Ga0070679_1000178006 160
100 3300025921 Ga0207652_10597133 Ga0207652_105971332 160
101 3300031548 Ga0307408_100273297 Ga0307408_1002732972 160
102 3300038443 Ga0395901_1201843 Ga0395901_1201843_199_684 160
103 3300041458 Ga0451798_0110857 Ga0451798_0110857_57_554 160
104 3300048915 Ga0496112_0553880 Ga0496112_0553880_36_533 160
105 3300053080 Ga0500635_0000101 Ga0500635_0000101_27911_28405 160
106 iso_pu_bacteria 2551306416 2553003705 160
107 iso_pu_bacteria 2808606386 2808981655 160
108 iso_pu_bacteria 2808606415 2809131285 160
109 iso_pu_bacteria 2808606419 2809150907 160
110 iso_pu_bacteria 2852618963 2852622815 160
111 iso_pu_bacteria 2923510766 2923512559 160
112 3300005366 Ga0070659_100014506 Ga0070659_1000145066 161
113 3300005435 Ga0070714_100001996 Ga0070714_1000019964 161
114 3300005457 Ga0070662_100874533 Ga0070662_1008745332 161
115 3300005536 Ga0070697_100336997 Ga0070697_1003369972 161
116 3300005539 Ga0068853_100892114 Ga0068853_1008921142 161
117 3300005578 Ga0068854_101482730 Ga0068854_1014827301 161
118 3300005614 Ga0068856_100353839 Ga0068856_1003538392 161
119 3300005718 Ga0068866_10605936 Ga0068866_106059361 161
120 3300006844 Ga0075428_100736143 Ga0075428_1007361431 161
121 3300006846 Ga0075430_100266446 Ga0075430_1002664462 161
122 3300009094 Ga0111539_10007683 Ga0111539_100076837 161
123 3300009094 Ga0111539_10140563 Ga0111539_101405633 161
124 3300009147 Ga0114129_10010508 Ga0114129_100105085 161
125 3300009147 Ga0114129_11481326 Ga0114129_114813261 161
126 3300009174 Ga0105241_10533789 Ga0105241_105337892 161
127 3300009176 Ga0105242_10976148 Ga0105242_109761482 161
128 3300009545 Ga0105237_10227000 Ga0105237_102270001 161
129 3300009553 Ga0105249_12868336 Ga0105249_128683361 161
130 3300013100 Ga0157373_10312707 Ga0157373_103127072 161
131 3300013104 Ga0157370_10003438 Ga0157370_1000343817 161
132 3300013308 Ga0157375_11180767 Ga0157375_111807672 161
133 3300025929 Ga0207664_10003403 Ga0207664_100034032 161
134 3300025932 Ga0207690_11243178 Ga0207690_112431781 161
135 3300025933 Ga0207706_10174558 Ga0207706_101745583 161
136 3300027907 Ga0207428_10161728 Ga0207428_101617283 161
137 3300037312 Ga0395899_0207589 Ga0395899_0207589_345_866 161
138 3300037418 Ga0395900_0231430 Ga0395900_0231430_527_1048 161
139 3300037418 Ga0395900_0402198 Ga0395900_0402198_782_1312 161
140 3300037418 Ga0395900_1306617 Ga0395900_1306617_103_591 161
141 3300037466 Ga0395898_1146575 Ga0395898_1146575_113_601 161
142 3300038443 Ga0395901_0711817 Ga0395901_0711817_430_918 161
143 3300042128 Ga0450897_031965 Ga0450897_031965_59_550 161
144 3300042185 Ga0450909_013702 Ga0450909_013702_589_1080 161
145 3300046539 Ga0495621_0016917 Ga0495621_0016917_848_1333 161
146 3300048904 Ga0496101_0278530 Ga0496101_0278530_753_1241 161
147 3300048909 Ga0496106_0383078 Ga0496106_0383078_34_531 161
148 3300048911 Ga0496108_0096421 Ga0496108_0096421_141_638 161
149 3300048912 Ga0496109_0319926 Ga0496109_0319926_533_1030 161
150 3300048913 Ga0496110_0425846 Ga0496110_0425846_19_516 161
151 3300048917 Ga0496114_0005402 Ga0496114_0005402_6246_6734 161
152 3300048917 Ga0496114_0194887 Ga0496114_0194887_843_1340 161
153 3300048917 Ga0496114_1404977 Ga0496114_1404977_70_558 161
154 3300049568 Ga0501031_0001054 Ga0501031_0001054_1405_1890 161
155 3300049568 Ga0501031_0012290 Ga0501031_0012290_2100_2585 161
156 3300049568 Ga0501031_0272602 Ga0501031_0272602_566_1057 161
157 3300049569 Ga0501032_0000306 Ga0501032_0000306_18839_19324 161
158 3300049569 Ga0501032_0004826 Ga0501032_0004826_4101_4586 161
159 3300049570 Ga0501033_0007242 Ga0501033_0007242_5502_5987 161
160 3300049570 Ga0501033_0018593 Ga0501033_0018593_605_1090 161
161 3300049570 Ga0501033_0088665 Ga0501033_0088665_559_1050 161
162 3300049571 Ga0501034_0001385 Ga0501034_0001385_18836_19321 161
163 3300049571 Ga0501034_0278279 Ga0501034_0278279_54_578 161
164 3300049572 Ga0501036_0000487 Ga0501036_0000487_10380_10865 161
165 3300049572 Ga0501036_0003738 Ga0501036_0003738_6017_6502 161
166 3300049572 Ga0501036_0007541 Ga0501036_0007541_6188_6673 161
167 3300049573 Ga0501037_0000868 Ga0501037_0000868_2810_3295 161
168 3300049573 Ga0501037_0109318 Ga0501037_0109318_1005_1529 161
169 3300049574 Ga0501038_0004594 Ga0501038_0004594_6697_7182 161
170 3300049574 Ga0501038_0005103 Ga0501038_0005103_2290_2775 161
171 3300049574 Ga0501038_0030854 Ga0501038_0030854_1293_1781 161
172 3300049574 Ga0501038_0063137 Ga0501038_0063137_1177_1662 161
173 3300049574 Ga0501038_0097239 Ga0501038_0097239_1381_1866 161
174 3300049575 Ga0501039_0008271 Ga0501039_0008271_3401_3886 161
175 3300049575 Ga0501039_0012954 Ga0501039_0012954_2019_2504 161
176 3300049575 Ga0501039_0977144 Ga0501039_0977144_138_629 161
177 3300049576 Ga0501040_0000121 Ga0501040_0000121_18835_19320 161
178 3300049578 Ga0501042_0000089 Ga0501042_0000089_25858_26343 161
179 3300049579 Ga0501043_0000665 Ga0501043_0000665_11043_11528 161
180 3300049579 Ga0501043_0510057 Ga0501043_0510057_256_741 161
181 3300049580 Ga0501046_0001686 Ga0501046_0001686_2760_3245 161
182 3300049580 Ga0501046_0003715 Ga0501046_0003715_2244_2729 161
183 3300049581 Ga0501047_0007839 Ga0501047_0007839_2511_2996 161
184 3300049582 Ga0501048_0002466 Ga0501048_0002466_6012_6497 161
185 3300049584 Ga0501068_0000711 Ga0501068_0000711_7153_7638 161
186 3300049586 Ga0501070_0081506 Ga0501070_0081506_82_567 161
187 3300049593 Ga0501077_0749572 Ga0501077_0749572_115_615 161
188 3300049822 Ga0501035_0000462 Ga0501035_0000462_26406_26891 161
189 3300049822 Ga0501035_0001288 Ga0501035_0001288_16623_17108 161
190 3300049822 Ga0501035_0031094 Ga0501035_0031094_3888_4373 161
191 3300049822 Ga0501035_0531459 Ga0501035_0531459_312_803 161
192 3300049823 Ga0501044_0001318 Ga0501044_0001318_18840_19325 161
193 3300049823 Ga0501044_0002690 Ga0501044_0002690_15187_15672 161
194 3300049823 Ga0501044_0057920 Ga0501044_0057920_2053_2538 161
195 3300049823 Ga0501044_0309763 Ga0501044_0309763_176_667 161
196 3300049823 Ga0501044_0363777 Ga0501044_0363777_117_641 161
197 3300049824 Ga0501045_0001772 Ga0501045_0001772_11408_11893 161
198 3300050507 nmdc:mga05p37_149_c1 nmdc:mga05p37_149_c1_10174_10659 161
199 3300050507 nmdc:mga05p37_1558398_c1 nmdc:mga05p37_1558398_c1_91_576 161
200 3300050507 nmdc:mga05p37_202099_c1 nmdc:mga05p37_202099_c1_977_1474 161
201 3300050507 nmdc:mga05p37_756307_c1 nmdc:mga05p37_756307_c1_523_1008 161
202 3300050509 nmdc:mga0qj67_400293_c1 nmdc:mga0qj67_400293_c1_240_734 161
203 3300050510 nmdc:mga06r32_1206937_c1 nmdc:mga06r32_1206937_c1_180_677 161
204 3300050510 nmdc:mga06r32_323739_c1 nmdc:mga06r32_323739_c1_521_1018 161
205 3300050511 nmdc:mga08y16_50843_c1 nmdc:mga08y16_50843_c1_196_693 161
206 3300050511 nmdc:mga08y16_57925_c1 nmdc:mga08y16_57925_c1_1672_2169 161
207 3300050514 nmdc:mga08x19_39_c1 nmdc:mga08x19_39_c1_135592_136077 161
208 3300005295 Ga0065707_10147085 Ga0065707_101470852 162
209 3300005334 Ga0068869_100091358 Ga0068869_1000913583 162
210 3300007076 Ga0075435_100052376 Ga0075435_1000523764 162
211 3300009094 Ga0111539_10159102 Ga0111539_101591021 162
212 3300009147 Ga0114129_10634879 Ga0114129_106348793 162
213 3300014325 Ga0163163_10427932 Ga0163163_104279322 162
214 3300025942 Ga0207689_10256444 Ga0207689_102564442 162
215 3300031240 Ga0265320_10195118 Ga0265320_101951181 162
216 3300032133 Ga0316583_10032223 Ga0316583_100322233 162
217 3300038725 Ga0400484_09670 Ga0400484_09670_1488_1976 162
218 3300038741 Ga0400488_53790 Ga0400488_53790_4211_4705 162
219 3300042876 Ga0451577_0027225 Ga0451577_0027225_142_630 162
220 3300044712 Ga0453684_0001586 Ga0453684_0001586_39327_39815 162
221 3300044712 Ga0453684_0471871 Ga0453684_0471871_724_1212 162
222 3300049778 Ga0501282_005488 Ga0501282_005488_495_1019 162
223 3300050507 nmdc:mga05p37_172613_c1 nmdc:mga05p37_172613_c1_1547_2035 162
224 3300050513 nmdc:mga0rr50_402195_c1 nmdc:mga0rr50_402195_c1_508_1002 162

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02542

YgbB

YgbB family

1

155

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ke1-assembly1.cif.gz_B crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei in complex with a fragment-nucleoside fusion d000161829 0.9952 5 159
3jvh-assembly1.cif.gz_B crystal structure of 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase from burkholderia pseudomallei with fol fragment 8395 0.9951 5 159
3f0e-assembly1.cif.gz_B crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei 0.9924 5 159
3p10-assembly1.cif.gz_C crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with cytidine and fol694, 2-(thiophen-2-yl)phenyl methanol 0.9908 5 159
3f0f-assembly1.cif.gz_C co-crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with hydrolyzed cdp 0.99 5 159
ID Description Score Start End Superfamily
af_B6TL41_66_225_3.30.1330.50 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9877 4 160 3.30.1330.50
5b8fC00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9776 1 160 3.30.1330.50
3t80F00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.975 4 159 3.30.1330.50
1iv1B00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9699 6 158 3.30.1330.50
2uzhA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9699 4 160 3.30.1330.50
ID Description Score Start End GO Terms
AF-A0A1L8ZRR6-F1-model_v4 deleted 1.001 90 160
AF-A0A520G642-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9978 85 158 GO:0008685
GO:0016114
AF-A0A179BNT9-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (EC 4.6.1.12) 0.9973 26 161 GO:0008685
GO:0016114
GO:0019288
GO:0046872
AF-A0A3D0WNJ9-F1-model_v4 deleted 0.9969 3 160
AF-A0A6A5LF17-F1-model_v4 deleted 0.9968 4 159

Feature Viewer

pLDDT pTM Quality
94.22 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map