F336512

General Info

Members Datasets Scaffolds Average Seq Length
224 177 448 247

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10000395|Ga0081455_1000039528
Length 275
Sequence MMTMMTRETIDFIYEGNKAILDPMPTLKFALQDEGIALVTLANPPMNVMDARLLEELAALFEGLAVDPAVRAAVIAAEGPAFSAGLDLKTVPDLDRLGQRRLVDAMNESFGTLYAWPKPLVAAVNGHAIAGGLVLALCTDWRVAADVPMQVSLAEVRVGVTYPVAALEVARSELAPAAARRLVLLGETLDAATAHAEAIFDERVPLTELRQRAIAQAVRHATLPPKAFATIKRELRSSQLGRIAAARAGCDEPRRSAWLGEEMRRASAAVLRGAA

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300013875 Rhizosphere microbial communities from switchgrass unharvested rhizosphere in Austin, TX, USA - RS_233 Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
64 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
90 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
91 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
92 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
93 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
94 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
95 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
96 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
97 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
98 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
99 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
100 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
101 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
102 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
103 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
111 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
112 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
113 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
114 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
115 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
116 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
117 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
118 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
119 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
120 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
121 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
122 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
123 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
124 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
125 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
126 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
127 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
128 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
129 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
130 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
131 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
132 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
133 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
134 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
135 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
136 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
137 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
138 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
139 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
140 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
141 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
142 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
143 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
144 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
145 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
153 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
154 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
155 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
161 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
162 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
163 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
164 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
165 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
166 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
167 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
168 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
169 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
170 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
171 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
172 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
173 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
174 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
175 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
176 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
177 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.59
Nodule 0
Rhizoplane 14.73
Rhizosphere 76.79
Stem 0
Stem Tuber 0
Unclassified 5.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10000395 3300005937 Bacteria 57467
2 JGI25404J52841_10005945 3300003659 Bacteria 2534
3 Ga0065715_10141249 3300005293 Unclassified 1847
4 Ga0070683_100009806 3300005329 Bacteria 8205
5 Ga0070670_100297891 3300005331 Bacteria 1410
6 Ga0070682_100010220 3300005337 Bacteria 5322
7 Ga0068868_100012758 3300005338 Bacteria 6146
8 Ga0068868_100377703 3300005338 Bacteria 1219
9 Ga0070689_100282978 3300005340 Bacteria 1376
10 Ga0070691_10007866 3300005341 Bacteria 4877
11 Ga0070671_100225239 3300005355 Bacteria 1591
12 Ga0070659_100322730 3300005366 Bacteria 1291
13 Ga0070703_10000118 3300005406 Bacteria 41088
14 Ga0070709_10003708 3300005434 Bacteria 8210
15 Ga0070709_10625672 3300005434 Bacteria 831
16 Ga0070713_100005384 3300005436 Bacteria 8742
17 Ga0070711_100022768 3300005439 Bacteria 4065
18 Ga0070705_100000004 3300005440 Bacteria 127804
19 Ga0070700_100000570 3300005441 Bacteria 18447
20 Ga0070708_100011062 3300005445 Bacteria 7331
21 Ga0070708_100011567 3300005445 Bacteria 7185
22 Ga0070678_100190233 3300005456 Bacteria 1687
23 Ga0070681_10356944 3300005458 Bacteria 1372
24 Ga0070685_10010957 3300005466 Bacteria 4729
25 Ga0070685_10320853 3300005466 Bacteria 1050
26 Ga0070706_100000191 3300005467 Bacteria 76922
27 Ga0070699_100000954 3300005518 Bacteria 26955
28 Ga0070684_100000730 3300005535 Bacteria 22758
29 Ga0068853_100205489 3300005539 Bacteria 1794
30 Ga0070695_100089020 3300005545 Bacteria 2057
31 Ga0070695_100173476 3300005545 Bacteria 1523
32 Ga0070696_100000041 3300005546 Bacteria 57944
33 Ga0070696_100076492 3300005546 Unclassified 2363
34 Ga0070693_100281236 3300005547 Bacteria 1114
35 Ga0070704_100090525 3300005549 Bacteria 2279
36 Ga0070664_100110424 3300005564 Bacteria 2399
37 Ga0068854_100043062 3300005578 Bacteria 3198
38 Ga0068856_100004642 3300005614 Bacteria 13645
39 Ga0068859_100109861 3300005617 Bacteria 2819
40 Ga0068864_100104605 3300005618 Bacteria 2515
41 Ga0068858_100432095 3300005842 Bacteria 1267
42 Ga0068860_101019438 3300005843 Bacteria 846
43 Ga0081455_10011948 3300005937 Bacteria 8690
44 Ga0081455_10038461 3300005937 Bacteria 4237
45 Ga0081538_10011999 3300005981 Bacteria 6979
46 Ga0081538_10055061 3300005981 Bacteria 2345
47 Ga0081540_1031004 3300005983 Bacteria 2950
48 Ga0081540_1109942 3300005983 Bacteria 1168
49 Ga0075365_10083661 3300006038 Bacteria 2164
50 Ga0075365_10116978 3300006038 Bacteria 1836
51 Ga0075365_10189397 3300006038 Bacteria 1439
52 Ga0075365_10521616 3300006038 Unclassified 840
53 Ga0075363_100303143 3300006048 Bacteria 927
54 Ga0070712_100030430 3300006175 Bacteria 3627
55 Ga0075362_10023158 3300006177 Bacteria 2624
56 Ga0075367_10020883 3300006178 Bacteria 3653
57 Ga0075369_10000753 3300006186 Bacteria 10531
58 Ga0075430_100197143 3300006846 Bacteria 1673
59 Ga0075430_100419120 3300006846 Bacteria 1105
60 Ga0075433_10337151 3300006852 Unclassified 1333
61 Ga0075434_100121497 3300006871 Bacteria 2627
62 Ga0097620_100109860 3300006931 Bacteria 2819
63 Ga0075435_100380182 3300007076 Bacteria 1213
64 Ga0075435_100491811 3300007076 Bacteria 1060
65 Ga0105245_10009861 3300009098 Bacteria 8319
66 Ga0105245_10066619 3300009098 Bacteria 3260
67 Ga0105245_10290980 3300009098 Bacteria 1600
68 Ga0114129_10164646 3300009147 Bacteria 3027
69 Ga0105242_10135938 3300009176 Bacteria 2127
70 Ga0105242_10821271 3300009176 Unclassified 922
71 Ga0105237_10041537 3300009545 Bacteria 4638
72 Ga0105237_10109280 3300009545 Bacteria 2757
73 Ga0105238_10002339 3300009551 Bacteria 19061
74 Ga0105035_101466 3300009988 Bacteria 1641
75 Ga0105239_10022669 3300010375 Bacteria 6922
76 Ga0105239_10491468 3300010375 Bacteria 1395
77 Ga0163162_10462311 3300013306 Bacteria 1400
78 Ga0157372_10033710 3300013307 Bacteria 5627
79 Ga0157372_10947822 3300013307 Bacteria 998
80 Ga0157375_10389778 3300013308 Bacteria 1560
81 Ga0157515_113996 3300013875 Bacteria 1641
82 Ga0157377_10003342 3300014745 Bacteria 7253
83 Ga0157379_10497427 3300014968 Bacteria 1130
84 Ga0213871_10004874 3300021441 Bacteria 2724
85 Ga0207697_10148591 3300025315 Unclassified 1019
86 Ga0207653_10000022 3300025885 Bacteria 126662
87 Ga0207688_10000365 3300025901 Bacteria 21053
88 Ga0207699_10023570 3300025906 Bacteria 3351
89 Ga0207699_10260892 3300025906 Bacteria 1198
90 Ga0207684_10000049 3300025910 Bacteria 240008
91 Ga0207671_10130687 3300025914 Bacteria 1927
92 Ga0207693_10008803 3300025915 Bacteria 8248
93 Ga0207693_10031270 3300025915 Bacteria 4205
94 Ga0207657_10027776 3300025919 Bacteria 5176
95 Ga0207681_10228524 3300025923 Bacteria 1443
96 Ga0207694_10013146 3300025924 Bacteria 6233
97 Ga0207650_10334313 3300025925 Unclassified 1243
98 Ga0207687_10007328 3300025927 Bacteria 7273
99 Ga0207700_10026603 3300025928 Bacteria 4037
100 Ga0207690_10214452 3300025932 Bacteria 1469
101 Ga0207706_10069079 3300025933 Bacteria 3107
102 Ga0207709_10254932 3300025935 Unclassified 1283
103 Ga0207670_10046394 3300025936 Bacteria 2887
104 Ga0207670_10080784 3300025936 Bacteria 2274
105 Ga0207669_10101078 3300025937 Bacteria 1907
106 Ga0207665_10307704 3300025939 Bacteria 1186
107 Ga0207679_10249329 3300025945 Bacteria 1508
108 Ga0207678_10010825 3300026067 Bacteria 8014
109 Ga0207708_10000398 3300026075 Bacteria 34302
110 Ga0207702_10030353 3300026078 Bacteria 4504
111 Ga0207683_10108108 3300026121 Bacteria 2489
112 Ga0207683_10110383 3300026121 Bacteria 2462
113 Ga0268266_10141930 3300028379 Bacteria 2156
114 Ga0307408_100685986 3300031548 Bacteria 919
115 Ga0307508_10017338 3300031616 Bacteria 6546
116 Ga0307406_10005308 3300031901 Bacteria 7049
117 Ga0307406_10037814 3300031901 Bacteria 2984
118 Ga0307407_10094034 3300031903 Bacteria 1844
119 Ga0307412_10181157 3300031911 Bacteria 1585
120 Ga0307416_100704604 3300032002 Bacteria 1099
121 Ga0307414_10043174 3300032004 Bacteria 3069
122 Ga0307510_10045259 3300033180 Bacteria 4754
123 Ga0373926_0076774 3300035083 Bacteria 1232
124 Ga0373946_0062322 3300035171 Bacteria 1590
125 Ga0373924_0052903 3300035410 Bacteria 1686
126 Ga0373935_0001026 3300035692 Bacteria 15187
127 Ga0373927_0002601 3300035695 Bacteria 13156
128 Ga0373947_0165661 3300035725 Bacteria 1431
129 Ga0373937_0052648 3300036401 Bacteria 3733
130 Ga0373925_0171806 3300037068 Bacteria 1711
131 Ga0395899_0060027 3300037312 Unclassified 2802
132 Ga0395900_0017327 3300037418 Bacteria 7354
133 Ga0395898_0005812 3300037466 Bacteria 13273
134 Ga0395905_0070470 3300037471 Bacteria 3276
135 Ga0395901_0034922 3300038443 Bacteria 5194
136 Ga0395901_0048366 3300038443 Bacteria 4416
137 Ga0395901_0440321 3300038443 Bacteria 1334
138 Ga0436360_0375729 3300039438 Bacteria 2865
139 Ga0495592_0012975 3300046454 Bacteria 6336
140 Ga0495603_0001156 3300046455 Bacteria 15378
141 Ga0495629_0007329 3300046459 Bacteria 8129
142 Ga0495641_0007362 3300046461 Bacteria 6884
143 Ga0495651_0276962 3300046462 Bacteria 1135
144 Ga0495653_0236695 3300046463 Bacteria 1219
145 Ga0495580_0015720 3300046472 Bacteria 5703
146 Ga0495582_0003642 3300046473 Bacteria 8675
147 Ga0495639_0001339 3300046475 Bacteria 11056
148 Ga0495662_0002101 3300046476 Bacteria 9986
149 Ga0495664_0013299 3300046477 Bacteria 4668
150 Ga0495594_0015954 3300046499 Bacteria 3952
151 Ga0495632_0094947 3300046519 Bacteria 1410
152 Ga0495652_0164547 3300046529 Bacteria 1718
153 Ga0495622_0007181 3300046557 Bacteria 5176
154 Ga0495634_0010428 3300046642 Bacteria 6808
155 Ga0495635_0129806 3300046663 Bacteria 1718
156 Ga0495588_0108808 3300046674 Bacteria 1459
157 Ga0495657_0222268 3300046675 Bacteria 1144
158 Ga0495623_0156204 3300046679 Bacteria 1344
159 Ga0495646_0077094 3300046680 Bacteria 1950
160 Ga0495658_0001842 3300046683 Bacteria 10839
161 Ga0495613_0015005 3300046689 Bacteria 5750
162 Ga0495624_0005387 3300046690 Bacteria 9229
163 Ga0495581_0004974 3300047315 Bacteria 7692
164 Ga0495604_0187371 3300047317 Bacteria 1444
165 Ga0495674_0015066 3300047319 Bacteria 7236
166 Ga0495676_0188830 3300047321 Bacteria 1438
167 Ga0495593_0004447 3300047673 Bacteria 8326
168 Ga0496101_0005098 3300048904 Bacteria 8352
169 Ga0496102_0005925 3300048905 Bacteria 10406
170 Ga0496103_0295565 3300048906 Bacteria 1042
171 Ga0496104_0025908 3300048907 Bacteria 5408
172 Ga0496104_0039801 3300048907 Bacteria 4403
173 Ga0496104_0133525 3300048907 Bacteria 2384
174 Ga0496104_0740052 3300048907 Bacteria 890
175 Ga0496105_0006829 3300048908 Bacteria 8776
176 Ga0496105_0360627 3300048908 Bacteria 1159
177 Ga0496106_0008813 3300048909 Bacteria 7455
178 Ga0496107_0026852 3300048910 Bacteria 4086
179 Ga0496107_0388551 3300048910 Bacteria 1038
180 Ga0496108_0065078 3300048911 Bacteria 3072
181 Ga0496108_0551419 3300048911 Unclassified 1006
182 Ga0496109_0001331 3300048912 Bacteria 20386
183 Ga0496109_0007596 3300048912 Bacteria 9191
184 Ga0496109_0225361 3300048912 Bacteria 1763
185 Ga0496109_0496217 3300048912 Bacteria 1152
186 Ga0496110_0019415 3300048913 Bacteria 5718
187 Ga0496110_0053936 3300048913 Bacteria 3536
188 Ga0496110_0544232 3300048913 Bacteria 1055
189 Ga0496111_0049142 3300048914 Bacteria 3041
190 Ga0496111_0548199 3300048914 Bacteria 849
191 Ga0496112_0007129 3300048915 Bacteria 9891
192 Ga0496112_0017492 3300048915 Bacteria 6736
193 Ga0496112_0050610 3300048915 Bacteria 4074
194 Ga0496113_0219805 3300048916 Unclassified 1514
195 Ga0496113_0275413 3300048916 Bacteria 1345
196 Ga0496113_0300158 3300048916 Bacteria 1286
197 Ga0496113_0460894 3300048916 Bacteria 1021
198 Ga0496114_0007829 3300048917 Bacteria 8453
199 Ga0496114_0573637 3300048917 Bacteria 996
200 Ga0496115_0103456 3300048918 Bacteria 2336
201 Ga0501031_0073009 3300049568 Bacteria 2234
202 Ga0501036_0084733 3300049572 Bacteria 2679
203 Ga0501036_0795410 3300049572 Bacteria 779
204 Ga0501040_0266442 3300049576 Bacteria 1223
205 Ga0501041_0132746 3300049577 Bacteria 1551
206 Ga0501042_0039335 3300049578 Bacteria 3360
207 Ga0501071_0019698 3300049587 Bacteria 4684
208 Ga0501072_0059591 3300049588 Bacteria 3010
209 Ga0501075_0099907 3300049591 Bacteria 2204
210 nmdc:mga03683_102507_c1 3300050489 Bacteria 1259
211 nmdc:mga06z11_18543_c1 3300050494 Bacteria 3180
212 nmdc:mga0qj67_446184_c1 3300050509 Bacteria 1042
213 nmdc:mga06r32_22907_c1 3300050510 Bacteria 5777
214 nmdc:mga08y16_510639_c1 3300050511 Bacteria 1220
215 nmdc:mga0n895_159332_c1 3300050512 Bacteria 2288
216 nmdc:mga0a205_106792_c1 3300050515 Bacteria 2697
217 nmdc:mga0sz30_148_c1 3300050516 Bacteria 26288
218 Ga0500635_0005739 3300053080 Bacteria 3279
219 Ga0500642_0082563 3300053130 Unclassified 1478
220 Ga0500603_001454 3300053150 Bacteria 5401
221 Ga0500616_0007530 3300053153 Bacteria 6894
222 Ga0500636_0059469 3300053177 Bacteria 2233
223 Ga0500552_000359 3300053733 Bacteria 4216
224 Ga0530510_0593715 3300061734 Unclassified 842
225 Ga0081455_10000395
226 JGI25404J52841_10005945
227 Ga0065715_10141249
228 Ga0070683_100009806
229 Ga0070670_100297891
230 Ga0070682_100010220
231 Ga0068868_100012758
232 Ga0068868_100377703
233 Ga0070689_100282978
234 Ga0070691_10007866
235 Ga0070671_100225239
236 Ga0070659_100322730
237 Ga0070703_10000118
238 Ga0070709_10003708
239 Ga0070709_10625672
240 Ga0070713_100005384
241 Ga0070711_100022768
242 Ga0070705_100000004
243 Ga0070700_100000570
244 Ga0070708_100011062
245 Ga0070708_100011567
246 Ga0070678_100190233
247 Ga0070681_10356944
248 Ga0070685_10010957
249 Ga0070685_10320853
250 Ga0070706_100000191
251 Ga0070699_100000954
252 Ga0070684_100000730
253 Ga0068853_100205489
254 Ga0070695_100089020
255 Ga0070695_100173476
256 Ga0070696_100000041
257 Ga0070696_100076492
258 Ga0070693_100281236
259 Ga0070704_100090525
260 Ga0070664_100110424
261 Ga0068854_100043062
262 Ga0068856_100004642
263 Ga0068859_100109861
264 Ga0068864_100104605
265 Ga0068858_100432095
266 Ga0068860_101019438
267 Ga0081455_10011948
268 Ga0081455_10038461
269 Ga0081538_10011999
270 Ga0081538_10055061
271 Ga0081540_1031004
272 Ga0081540_1109942
273 Ga0075365_10083661
274 Ga0075365_10116978
275 Ga0075365_10189397
276 Ga0075365_10521616
277 Ga0075363_100303143
278 Ga0070712_100030430
279 Ga0075362_10023158
280 Ga0075367_10020883
281 Ga0075369_10000753
282 Ga0075430_100197143
283 Ga0075430_100419120
284 Ga0075433_10337151
285 Ga0075434_100121497
286 Ga0097620_100109860
287 Ga0075435_100380182
288 Ga0075435_100491811
289 Ga0105245_10009861
290 Ga0105245_10066619
291 Ga0105245_10290980
292 Ga0114129_10164646
293 Ga0105242_10135938
294 Ga0105242_10821271
295 Ga0105237_10041537
296 Ga0105237_10109280
297 Ga0105238_10002339
298 Ga0105035_101466
299 Ga0105239_10022669
300 Ga0105239_10491468
301 Ga0163162_10462311
302 Ga0157372_10033710
303 Ga0157372_10947822
304 Ga0157375_10389778
305 Ga0157515_113996
306 Ga0157377_10003342
307 Ga0157379_10497427
308 Ga0213871_10004874
309 Ga0207697_10148591
310 Ga0207653_10000022
311 Ga0207688_10000365
312 Ga0207699_10023570
313 Ga0207699_10260892
314 Ga0207684_10000049
315 Ga0207671_10130687
316 Ga0207693_10008803
317 Ga0207693_10031270
318 Ga0207657_10027776
319 Ga0207681_10228524
320 Ga0207694_10013146
321 Ga0207650_10334313
322 Ga0207687_10007328
323 Ga0207700_10026603
324 Ga0207690_10214452
325 Ga0207706_10069079
326 Ga0207709_10254932
327 Ga0207670_10046394
328 Ga0207670_10080784
329 Ga0207669_10101078
330 Ga0207665_10307704
331 Ga0207679_10249329
332 Ga0207678_10010825
333 Ga0207708_10000398
334 Ga0207702_10030353
335 Ga0207683_10108108
336 Ga0207683_10110383
337 Ga0268266_10141930
338 Ga0307408_100685986
339 Ga0307508_10017338
340 Ga0307406_10005308
341 Ga0307406_10037814
342 Ga0307407_10094034
343 Ga0307412_10181157
344 Ga0307416_100704604
345 Ga0307414_10043174
346 Ga0307510_10045259
347 Ga0373926_0076774
348 Ga0373946_0062322
349 Ga0373924_0052903
350 Ga0373935_0001026
351 Ga0373927_0002601
352 Ga0373947_0165661
353 Ga0373937_0052648
354 Ga0373925_0171806
355 Ga0395899_0060027
356 Ga0395900_0017327
357 Ga0395898_0005812
358 Ga0395905_0070470
359 Ga0395901_0034922
360 Ga0395901_0048366
361 Ga0395901_0440321
362 Ga0436360_0375729
363 Ga0495592_0012975
364 Ga0495603_0001156
365 Ga0495629_0007329
366 Ga0495641_0007362
367 Ga0495651_0276962
368 Ga0495653_0236695
369 Ga0495580_0015720
370 Ga0495582_0003642
371 Ga0495639_0001339
372 Ga0495662_0002101
373 Ga0495664_0013299
374 Ga0495594_0015954
375 Ga0495632_0094947
376 Ga0495652_0164547
377 Ga0495622_0007181
378 Ga0495634_0010428
379 Ga0495635_0129806
380 Ga0495588_0108808
381 Ga0495657_0222268
382 Ga0495623_0156204
383 Ga0495646_0077094
384 Ga0495658_0001842
385 Ga0495613_0015005
386 Ga0495624_0005387
387 Ga0495581_0004974
388 Ga0495604_0187371
389 Ga0495674_0015066
390 Ga0495676_0188830
391 Ga0495593_0004447
392 Ga0496101_0005098
393 Ga0496102_0005925
394 Ga0496103_0295565
395 Ga0496104_0025908
396 Ga0496104_0039801
397 Ga0496104_0133525
398 Ga0496104_0740052
399 Ga0496105_0006829
400 Ga0496105_0360627
401 Ga0496106_0008813
402 Ga0496107_0026852
403 Ga0496107_0388551
404 Ga0496108_0065078
405 Ga0496108_0551419
406 Ga0496109_0001331
407 Ga0496109_0007596
408 Ga0496109_0225361
409 Ga0496109_0496217
410 Ga0496110_0019415
411 Ga0496110_0053936
412 Ga0496110_0544232
413 Ga0496111_0049142
414 Ga0496111_0548199
415 Ga0496112_0007129
416 Ga0496112_0017492
417 Ga0496112_0050610
418 Ga0496113_0219805
419 Ga0496113_0275413
420 Ga0496113_0300158
421 Ga0496113_0460894
422 Ga0496114_0007829
423 Ga0496114_0573637
424 Ga0496115_0103456
425 Ga0501031_0073009
426 Ga0501036_0084733
427 Ga0501036_0795410
428 Ga0501040_0266442
429 Ga0501041_0132746
430 Ga0501042_0039335
431 Ga0501071_0019698
432 Ga0501072_0059591
433 Ga0501075_0099907
434 nmdc:mga03683_102507_c1
435 nmdc:mga06z11_18543_c1
436 nmdc:mga0qj67_446184_c1
437 nmdc:mga06r32_22907_c1
438 nmdc:mga08y16_510639_c1
439 nmdc:mga0n895_159332_c1
440 nmdc:mga0a205_106792_c1
441 nmdc:mga0sz30_148_c1
442 Ga0500635_0005739
443 Ga0500642_0082563
444 Ga0500603_001454
445 Ga0500616_0007530
446 Ga0500636_0059469
447 Ga0500552_000359
448 Ga0530510_0593715

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

32

249

0.97

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

36

248

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3r6h-assembly1.cif.gz_A crystal structure of an enoyl-coa hydratase (echa3) from mycobacterium marinum 0.9296 4 227
4hc8-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9288 5 227
3ot6-assembly1.cif.gz_A crystal structure of an enoyl-coa hydratase/isomerase family protein from psudomonas syringae 0.9285 5 236
6c7c-assembly1.cif.gz_B crystal structure of enoyl-coa hydratase, echa3, from mycobacterium ulcerans agy99 0.9281 4 227
4fn7-assembly1.cif.gz_B apo structure of the mtb enoyol coa isomerase (rv0632c) 0.9222 2 227
ID Description Score Start End Superfamily
af_Q4CTQ3_133_338_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9427 5 201 3.90.226.10
af_O50402_25_213_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.933 5 173 3.90.226.10
4di1B01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9293 1 201 3.90.226.10
3hrxF01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.928 5 199 3.90.226.10
6c7cA00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.927 2 227 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A7W1LRT5-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.9788 5 248 GO:0006635
GO:0016836
GO:0016853
AF-A0A192IGM4-F1-model_v4 deleted 0.9771 1 250
AF-A0A419F4C8-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.974 1 249 GO:0006635
GO:0016836
GO:0016853
AF-A0A7W1LRT5-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.9669 5 248 GO:0006635
GO:0016836
GO:0016853
AF-A0A192IGM4-F1-model_v4 deleted 0.9619 1 250

Map