F336482

General Info

Members Datasets Scaffolds Average Seq Length
224 153 203 459

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100000017|Ga0070665_100000017267
Length 526
Sequence MGYCKPIDLGNLKNPEIVLPLSPMASIKPSVPKGTRDFSPAEMAKRNYIFDTIKGVFRKYGYQQIETPAMENLSTLMGKYGDEGDKLIFKILNSGDIVSSLIEGFSKLQSEINKSETIQSIDVEDSKFPGEQGEKRAVSIVDSKAYEENPFKVGAEIENIADHRKNLNKDVIDRISEKALRYDLTVPFARYVVMHQNQPVWRADRPQRGRYREFYQCDADVVGSDSLLNEAEFVLIYDEALGKLGLKDFTIKINNRKILSGIAEIIDKSDNIIDLTVAIDKLDKIGLDGVTKELLERGFTQDDIEKIKPVILLQGTNEEKLASLRNTLSKSETGLKGCDEIQTVLDYIADFKLKTAKLELDITLARGLNYYTGAIFEVKTNEVAMGSIGGGGRYDDLTGVFGAKEKLTGVGISFGADRIYDVLDELNLFPAATSQGTQVLICCFDKEGERYALPLLQQLREQNIYAELYPAGAKIKKQMEYANNKQIPYTILIGSEEMQSGLLAFKDMESGLQEKLSGDQIINRLK

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
3 2738541283 Pedobacter sp. OK701 Isolate Unclassified
4 2739367651 Pedobacter sp. OK291 Isolate Unclassified
5 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
6 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
7 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
8 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
9 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
10 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
11 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
12 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
13 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
14 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
15 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
16 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
17 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
18 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
19 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
20 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
21 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
22 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
23 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
24 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
25 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
26 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
27 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
28 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
29 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
30 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
31 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
67 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
70 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
71 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
72 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
73 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
74 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
98 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
99 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
100 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
101 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
102 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
105 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
106 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
107 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
111 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
112 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
113 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
114 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
115 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
116 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
117 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
118 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
119 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
120 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
121 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
122 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
123 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
124 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
125 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
126 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
127 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
128 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
129 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
130 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
131 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
132 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
133 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
134 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
135 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
136 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
137 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
138 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
139 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
140 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
141 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
142 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
143 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
144 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
145 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
146 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
147 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
148 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
149 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
150 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
151 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
152 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
153 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.62
Metatranscriptomes 0
Isolates 9.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.59
Nodule 0
Rhizoplane 0.89
Rhizosphere 81.7
Stem 0
Stem Tuber 0
Unclassified 9.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10017682 3300001979 Bacteria 2543
2 JGI24739J22299_10002649 3300001989 Bacteria 6890
3 JGI24737J22298_10000048 3300001990 Bacteria 34497
4 JGI24735J21928_10000017 3300002067 Bacteria 114440
5 JGI25162J39368_1000008 3300002737 Bacteria 397212
6 JGI25162J39368_1000097 3300002737 Bacteria 96520
7 JGI25157J39369_1003497 3300002741 Bacteria 3180
8 rootH2_10122791 3300003320 Bacteria 2471
9 rootH1_10090389 3300003323 Bacteria 8106
10 Ga0055536_1000006 3300003781 Bacteria 347733
11 Ga0055530_10007065 3300003791 Bacteria 4822
12 Ga0065704_10086654 3300005289 Bacteria 3095
13 Ga0070658_10000113 3300005327 Bacteria 72221
14 Ga0070676_10024019 3300005328 Bacteria 3430
15 Ga0070671_100004370 3300005355 Bacteria 11179
16 Ga0070659_100021173 3300005366 Bacteria 4947
17 Ga0070659_100022234 3300005366 Bacteria 4839
18 Ga0070659_100091598 3300005366 Bacteria 2437
19 Ga0070663_100036238 3300005455 Bacteria 3427
20 Ga0070662_100003641 3300005457 Bacteria 9620
21 Ga0068853_100055666 3300005539 Bacteria 3409
22 Ga0068853_100076814 3300005539 Bacteria 2917
23 Ga0070665_100000017 3300005548 Bacteria 448013
24 Ga0068855_100020279 3300005563 Bacteria 7978
25 Ga0068855_100315137 3300005563 Bacteria 1730
26 Ga0068854_100037620 3300005578 Bacteria 3398
27 Ga0068856_100073564 3300005614 Bacteria 3384
28 Ga0068852_100256145 3300005616 Bacteria 1678
29 Ga0068851_10000137 3300005834 Bacteria 39295
30 Ga0070716_100102430 3300006173 Bacteria 1758
31 Ga0075366_10002164 3300006195 Bacteria 10020
32 Ga0068871_100000353 3300006358 Bacteria 31920
33 Ga0068865_100005388 3300006881 Bacteria 7752
34 Ga0105240_10001259 3300009093 Bacteria 43960
35 Ga0105240_10003566 3300009093 Bacteria 24139
36 Ga0105240_10052542 3300009093 Bacteria 5121
37 Ga0105240_10052656 3300009093 Bacteria 5114
38 Ga0105240_10058628 3300009093 Bacteria 4806
39 Ga0105240_10165421 3300009093 Bacteria 2624
40 Ga0105243_10000009 3300009148 Bacteria 354419
41 Ga0105241_10005156 3300009174 Bacteria 9639
42 Ga0105237_10000481 3300009545 Bacteria 56729
43 Ga0105237_10001805 3300009545 Bacteria 27621
44 Ga0105237_10002128 3300009545 Bacteria 24938
45 Ga0105237_10016924 3300009545 Bacteria 7564
46 Ga0105237_10017810 3300009545 Bacteria 7365
47 Ga0105237_10018481 3300009545 Bacteria 7214
48 Ga0105237_10025921 3300009545 Bacteria 5994
49 Ga0105239_10000008 3300010375 Bacteria 376925
50 Ga0105239_10004003 3300010375 Bacteria 17850
51 Ga0105239_10006318 3300010375 Bacteria 13785
52 Ga0105239_10121037 3300010375 Bacteria 2907
53 Ga0105239_10202982 3300010375 Bacteria 2221
54 Ga0157373_10000063 3300013100 Bacteria 95201
55 Ga0157373_10000442 3300013100 Bacteria 32910
56 Ga0157371_10002211 3300013102 Bacteria 18838
57 Ga0157371_10002389 3300013102 Bacteria 17964
58 Ga0157370_10002109 3300013104 Bacteria 24294
59 Ga0157370_10003667 3300013104 Bacteria 17938
60 Ga0157370_10025141 3300013104 Bacteria 5895
61 Ga0157370_10037923 3300013104 Bacteria 4665
62 Ga0157370_10170472 3300013104 Bacteria 2023
63 Ga0157369_10000301 3300013105 Bacteria 66010
64 Ga0157374_10000180 3300013296 Bacteria 58547
65 Ga0157374_10001936 3300013296 Bacteria 17362
66 Ga0157378_10009539 3300013297 Bacteria 8453
67 Ga0163162_10000051 3300013306 Bacteria 117695
68 Ga0163162_10000065 3300013306 Bacteria 102191
69 Ga0163162_10011373 3300013306 Bacteria 8677
70 Ga0163162_10046291 3300013306 Bacteria 4359
71 Ga0157372_10000037 3300013307 Bacteria 172444
72 Ga0157372_10002115 3300013307 Bacteria 21598
73 Ga0157372_10002434 3300013307 Bacteria 20158
74 Ga0157372_10002641 3300013307 Bacteria 19411
75 Ga0157372_10040956 3300013307 Bacteria 5120
76 Ga0157372_10145234 3300013307 Bacteria 2736
77 Ga0157375_10027970 3300013308 Bacteria 5278
78 Ga0157380_10122678 3300014326 Bacteria 2203
79 Ga0182008_10000002 3300014497 Bacteria 480216
80 Ga0182008_10000507 3300014497 Bacteria 29307
81 Ga0157379_10215486 3300014968 Bacteria 1739
82 Ga0182006_1000324 3300015261 Bacteria 41463
83 Ga0182006_1004498 3300015261 Bacteria 6864
84 Ga0182007_10018388 3300015262 Bacteria 2532
85 Ga0163161_10000135 3300017792 Bacteria 69859
86 Ga0163161_10000158 3300017792 Bacteria 62560
87 Ga0163161_10002544 3300017792 Bacteria 13019
88 Ga0213872_10003415 3300021361 Bacteria 8831
89 Ga0209437_100030 3300025233 Bacteria 532466
90 Ga0209026_1000377 3300025250 Bacteria 40941
91 Ga0209026_1006040 3300025250 Bacteria 3080
92 Ga0209026_1008956 3300025250 Bacteria 2024
93 Ga0209129_1011761 3300025258 Bacteria 2065
94 Ga0209233_1001683 3300025261 Bacteria 8587
95 Ga0209455_1012897 3300025272 Bacteria 1973
96 Ga0209676_1000039 3300025292 Bacteria 443158
97 Ga0209050_1000033 3300025298 Bacteria 442615
98 Ga0207656_10000062 3300025321 Bacteria 42595
99 Ga0207647_10000061 3300025904 Bacteria 83985
100 Ga0207647_10000291 3300025904 Bacteria 41262
101 Ga0207647_10004540 3300025904 Bacteria 10291
102 Ga0207705_10000160 3300025909 Bacteria 72235
103 Ga0207695_10009174 3300025913 Bacteria 12270
104 Ga0207695_10019146 3300025913 Bacteria 7888
105 Ga0207671_10000477 3300025914 Bacteria 54330
106 Ga0207671_10003040 3300025914 Bacteria 17175
107 Ga0207671_10004476 3300025914 Bacteria 13330
108 Ga0207671_10006938 3300025914 Bacteria 9973
109 Ga0207671_10010870 3300025914 Bacteria 7467
110 Ga0207671_10013208 3300025914 Bacteria 6589
111 Ga0207657_10028228 3300025919 Bacteria 5122
112 Ga0207644_10000472 3300025931 Bacteria 25931
113 Ga0207690_10016230 3300025932 Bacteria 4527
114 Ga0207690_10068858 3300025932 Bacteria 2433
115 Ga0207706_10003806 3300025933 Bacteria 14379
116 Ga0207709_10000026 3300025935 Bacteria 354467
117 Ga0207704_10000972 3300025938 Bacteria 12695
118 Ga0207667_10013819 3300025949 Bacteria 9223
119 Ga0207667_10041826 3300025949 Bacteria 4873
120 Ga0207640_10036185 3300025981 Bacteria 3097
121 Ga0207677_10069278 3300026023 Bacteria 2480
122 Ga0207639_10006123 3300026041 Bacteria 8165
123 Ga0207678_10050501 3300026067 Bacteria 3593
124 Ga0207702_10094775 3300026078 Bacteria 2621
125 Ga0207702_10234757 3300026078 Bacteria 1715
126 Ga0207648_10026794 3300026089 Bacteria 5120
127 Ga0207674_10040633 3300026116 Bacteria 4817
128 Ga0207674_10191627 3300026116 Bacteria 1994
129 Ga0268266_10000037 3300028379 Bacteria 342368
130 Ga0307517_10000212 3300028786 Bacteria 99215
131 Ga0307515_10001800 3300028794 Bacteria 47827
132 Ga0307515_10061382 3300028794 Bacteria 5334
133 Ga0316176_1147782 3300030732 Bacteria 12391
134 Ga0316181_1127864 3300030744 Bacteria 7445
135 Ga0265331_10040708 3300031250 Bacteria 2260
136 Ga0265327_10001298 3300031251 Bacteria 32727
137 Ga0265327_10003361 3300031251 Bacteria 15410
138 Ga0307412_10131913 3300031911 Bacteria 1816
139 Ga0307414_10006516 3300032004 Bacteria 6511
140 Ga0307414_10031034 3300032004 Bacteria 3499
141 Ga0307507_10003393 3300033179 Bacteria 31087
142 Ga0307510_10000231 3300033180 Bacteria 50152
143 Ga0395899_0000280 3300037312 Bacteria 66580
144 Ga0395900_0000204 3300037418 Bacteria 92834
145 Ga0395900_0016320 3300037418 Bacteria 7569
146 Ga0395900_0112194 3300037418 Bacteria 2800
147 Ga0395901_0104176 3300038443 Bacteria 2977
148 Ga0436361_1011184 3300039447 Bacteria 16427
149 Ga0451577_0001423 3300042876 Bacteria 31912
150 Ga0451577_0027089 3300042876 Bacteria 5189
151 Ga0466966_0011376 3300044684 Bacteria 5902
152 Ga0466959_0055104 3300045049 Bacteria 2904
153 Ga0451576_0000012 3300045051 Bacteria 674684
154 Ga0495650_0000268 3300046471 Bacteria 99891
155 Ga0495605_0060955 3300046474 Bacteria 1807
156 Ga0495585_0000034 3300046492 Bacteria 143120
157 Ga0495585_0000868 3300046492 Bacteria 25803
158 Ga0495596_0019634 3300046500 Bacteria 2774
159 Ga0495583_0012507 3300046506 Bacteria 4795
160 Ga0495606_0000450 3300046507 Bacteria 67219
161 Ga0495606_0017232 3300046507 Bacteria 5471
162 Ga0495606_0115297 3300046507 Bacteria 1615
163 Ga0495610_0002842 3300046512 Bacteria 14087
164 Ga0495616_0000848 3300046513 Bacteria 22319
165 Ga0495616_0013599 3300046513 Bacteria 4586
166 Ga0495631_0005855 3300046518 Bacteria 6407
167 Ga0495637_0022523 3300046520 Bacteria 2872
168 Ga0495648_0013767 3300046524 Bacteria 5961
169 Ga0495654_0021620 3300046530 Bacteria 3346
170 Ga0495609_0011542 3300046538 Bacteria 4204
171 Ga0495622_0074907 3300046557 Bacteria 1560
172 Ga0495633_0000620 3300046558 Bacteria 33596
173 Ga0495633_0006448 3300046558 Bacteria 6955
174 Ga0495668_0000667 3300046616 Bacteria 41283
175 Ga0495625_0000007 3300046660 Bacteria 565749
176 Ga0495625_0000742 3300046660 Bacteria 45511
177 Ga0495625_0001618 3300046660 Bacteria 26556
178 Ga0495625_0084414 3300046660 Bacteria 2206
179 Ga0495661_0002357 3300046665 Bacteria 14578
180 Ga0495661_0003468 3300046665 Bacteria 11639
181 Ga0495658_0018249 3300046683 Bacteria 3644
182 Ga0495671_0097723 3300046692 Bacteria 1436
183 Ga0495649_0000007 3300046694 Bacteria 518037
184 Ga0495660_0005748 3300046810 Bacteria 7407
185 Ga0495687_001497 3300047443 Bacteria 21340
186 Ga0495687_004653 3300047443 Bacteria 9159
187 Ga0495673_0030209 3300047469 Bacteria 2548
188 Ga0495686_0003222 3300047472 Bacteria 14353
189 Ga0495686_0030329 3300047472 Bacteria 3512
190 Ga0496115_0033348 3300048918 Bacteria 4065
191 Ga0496116_0003901 3300048919 Bacteria 14534
192 Ga0496117_0001994 3300048920 Bacteria 27102
193 Ga0496118_0031755 3300048921 Bacteria 4370
194 Ga0496122_0000836 3300048925 Bacteria 58266
195 Ga0496123_0001720 3300048926 Bacteria 29131
196 Ga0495678_003332 3300049459 Bacteria 10009
197 Ga0501223_000325 3300049663 Bacteria 11849
198 nmdc:mga0k408_190_c1 3300050493 Bacteria 31887
199 Ga0500635_0005600 3300053080 Bacteria 3306
200 Ga0500651_0000146 3300053093 Bacteria 44767
201 Ga0500608_009611 3300053122 Bacteria 4116
202 Ga0500608_010225 3300053122 Bacteria 4021
203 Ga0500618_000062 3300053125 Bacteria 95871

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053093 Ga0500651_0000146 Ga0500651_0000146_36313_37731 407
2 3300005366 Ga0070659_100022234 Ga0070659_1000222342 408
3 3300005616 Ga0068852_100256145 Ga0068852_1002561452 408
4 3300015261 Ga0182006_1004498 Ga0182006_10044985 408
5 3300025904 Ga0207647_10000061 Ga0207647_1000006128 408
6 3300014497 Ga0182008_10000002 Ga0182008_1000000271 412
7 3300017792 Ga0163161_10002544 Ga0163161_100025443 415
8 3300025919 Ga0207657_10028228 Ga0207657_100282285 419
9 3300013100 Ga0157373_10000442 Ga0157373_1000044226 422
10 3300046471 Ga0495650_0000268 Ga0495650_0000268_29113_30507 422
11 3300013104 Ga0157370_10002109 Ga0157370_1000210917 423
12 3300013306 Ga0163162_10000065 Ga0163162_1000006529 423
13 3300048925 Ga0496122_0000836 Ga0496122_0000836_43807_45132 423
14 3300048926 Ga0496123_0001720 Ga0496123_0001720_26847_28172 423
15 3300046507 Ga0495606_0017232 Ga0495606_0017232_691_2070 424
16 3300015261 Ga0182006_1000324 Ga0182006_10003248 426
17 3300017792 Ga0163161_10000135 Ga0163161_1000013532 426
18 3300003781 Ga0055536_1000006 Ga0055536_1000006325 427
19 3300003791 Ga0055530_10007065 Ga0055530_100070653 427
20 3300025292 Ga0209676_1000039 Ga0209676_1000039419 427
21 3300025298 Ga0209050_1000033 Ga0209050_100003330 427
22 3300046513 Ga0495616_0013599 Ga0495616_0013599_190_1566 428
23 3300049459 Ga0495678_003332 Ga0495678_003332_1891_3267 428
24 3300003323 rootH1_10090389 rootH1_100903897 432
25 3300010375 Ga0105239_10121037 Ga0105239_101210372 432
26 3300005834 Ga0068851_10000137 Ga0068851_1000013710 433
27 3300014326 Ga0157380_10122678 Ga0157380_101226782 433
28 3300025321 Ga0207656_10000062 Ga0207656_100000624 433
29 3300042876 Ga0451577_0027089 Ga0451577_0027089_3701_5041 433
30 3300048918 Ga0496115_0033348 Ga0496115_0033348_1920_3302 436
31 3300053122 Ga0500608_009611 Ga0500608_009611_2789_4105 436
32 3300006173 Ga0070716_100102430 Ga0070716_1001024302 437
33 3300014497 Ga0182008_10000507 Ga0182008_100005076 437
34 3300015262 Ga0182007_10018388 Ga0182007_100183882 437
35 3300045051 Ga0451576_0000012 Ga0451576_0000012_46501_47892 437
36 3300001989 JGI24739J22299_10002649 JGI24739J22299_100026493 439
37 3300001990 JGI24737J22298_10000048 JGI24737J22298_1000004834 439
38 3300002067 JGI24735J21928_10000017 JGI24735J21928_10000017108 439
39 3300013307 Ga0157372_10002641 Ga0157372_1000264111 439
40 3300031251 Ga0265327_10001298 Ga0265327_100012988 440
41 3300033179 Ga0307507_10003393 Ga0307507_1000339329 440
42 3300005614 Ga0068856_100073564 Ga0068856_1000735641 442
43 3300009545 Ga0105237_10025921 Ga0105237_100259214 442
44 3300013104 Ga0157370_10003667 Ga0157370_100036674 442
45 3300014968 Ga0157379_10215486 Ga0157379_102154861 442
46 3300025272 Ga0209455_1012897 Ga0209455_10128971 442
47 3300026078 Ga0207702_10234757 Ga0207702_102347571 442
48 3300002737 JGI25162J39368_1000008 JGI25162J39368_1000008362 443
49 3300002737 JGI25162J39368_1000097 JGI25162J39368_100009717 443
50 3300005578 Ga0068854_100037620 Ga0068854_1000376202 443
51 3300009093 Ga0105240_10052542 Ga0105240_100525424 443
52 3300009545 Ga0105237_10002128 Ga0105237_100021289 443
53 3300009545 Ga0105237_10016924 Ga0105237_100169246 443
54 3300009545 Ga0105237_10017810 Ga0105237_100178106 443
55 3300010375 Ga0105239_10004003 Ga0105239_1000400313 443
56 3300010375 Ga0105239_10006318 Ga0105239_1000631810 443
57 3300010375 Ga0105239_10202982 Ga0105239_102029822 443
58 3300025233 Ga0209437_100030 Ga0209437_10003083 443
59 3300025258 Ga0209129_1011761 Ga0209129_10117611 443
60 3300025914 Ga0207671_10003040 Ga0207671_1000304010 443
61 3300025914 Ga0207671_10004476 Ga0207671_1000447613 443
62 3300025914 Ga0207671_10010870 Ga0207671_100108706 443
63 3300025981 Ga0207640_10036185 Ga0207640_100361852 443
64 3300046507 Ga0495606_0115297 Ga0495606_0115297_232_1602 443
65 3300048919 Ga0496116_0003901 Ga0496116_0003901_6236_7618 443
66 3300048920 Ga0496117_0001994 Ga0496117_0001994_13520_14902 443
67 3300048921 Ga0496118_0031755 Ga0496118_0031755_1761_3143 443
68 3300053125 Ga0500618_000062 Ga0500618_000062_1491_2864 443
69 3300005563 Ga0068855_100315137 Ga0068855_1003151371 444
70 3300009093 Ga0105240_10052656 Ga0105240_100526562 444
71 3300009093 Ga0105240_10165421 Ga0105240_101654212 444
72 3300010375 Ga0105239_10000008 Ga0105239_10000008121 444
73 3300013306 Ga0163162_10011373 Ga0163162_100113734 444
74 3300021361 Ga0213872_10003415 Ga0213872_100034151 444
75 3300025949 Ga0207667_10041826 Ga0207667_100418262 444
76 3300026116 Ga0207674_10040633 Ga0207674_100406331 444
77 3300031911 Ga0307412_10131913 Ga0307412_101319132 444
78 3300039447 Ga0436361_1011184 Ga0436361_1011184_84_1454 444
79 3300046474 Ga0495605_0060955 Ga0495605_0060955_209_1627 444
80 3300046506 Ga0495583_0012507 Ga0495583_0012507_3058_4692 444
81 3300046507 Ga0495606_0000450 Ga0495606_0000450_882_2255 444
82 3300046512 Ga0495610_0002842 Ga0495610_0002842_4321_5715 444
83 3300046513 Ga0495616_0000848 Ga0495616_0000848_6923_8296 444
84 3300046558 Ga0495633_0006448 Ga0495633_0006448_5479_6873 444
85 3300046660 Ga0495625_0000007 Ga0495625_0000007_358839_360212 444
86 3300046665 Ga0495661_0002357 Ga0495661_0002357_12022_13416 444
87 3300046665 Ga0495661_0003468 Ga0495661_0003468_1575_2951 444
88 3300046692 Ga0495671_0097723 Ga0495671_0097723_43_1416 444
89 3300046694 Ga0495649_0000007 Ga0495649_0000007_77301_78674 444
90 3300046810 Ga0495660_0005748 Ga0495660_0005748_96_1583 444
91 3300047443 Ga0495687_001497 Ga0495687_001497_204_1577 444
92 3300047469 Ga0495673_0030209 Ga0495673_0030209_73_1467 444
93 3300047472 Ga0495686_0030329 Ga0495686_0030329_40_1413 444
94 3300053080 Ga0500635_0005600 Ga0500635_0005600_111_1742 444
95 iso_pu_bacteria 2881955468 2881956510 444
96 3300002741 JGI25157J39369_1003497 JGI25157J39369_10034972 445
97 3300003320 rootH2_10122791 rootH2_101227911 445
98 3300005289 Ga0065704_10086654 Ga0065704_100866542 445
99 3300005327 Ga0070658_10000113 Ga0070658_1000011354 445
100 3300005366 Ga0070659_100021173 Ga0070659_1000211734 445
101 3300005548 Ga0070665_100000017 Ga0070665_100000017267 445
102 3300013100 Ga0157373_10000063 Ga0157373_1000006331 445
103 3300013102 Ga0157371_10002389 Ga0157371_100023892 445
104 3300013104 Ga0157370_10037923 Ga0157370_100379236 445
105 3300013296 Ga0157374_10001936 Ga0157374_100019364 445
106 3300013297 Ga0157378_10009539 Ga0157378_1000953910 445
107 3300013307 Ga0157372_10002115 Ga0157372_100021152 445
108 3300013307 Ga0157372_10002434 Ga0157372_100024348 445
109 3300025250 Ga0209026_1000377 Ga0209026_100037713 445
110 3300025250 Ga0209026_1006040 Ga0209026_10060402 445
111 3300025261 Ga0209233_1001683 Ga0209233_10016833 445
112 3300025904 Ga0207647_10000291 Ga0207647_1000029133 445
113 3300025909 Ga0207705_10000160 Ga0207705_1000016022 445
114 3300025932 Ga0207690_10016230 Ga0207690_100162303 445
115 3300026116 Ga0207674_10191627 Ga0207674_101916271 445
116 3300028379 Ga0268266_10000037 Ga0268266_1000003750 445
117 3300032004 Ga0307414_10031034 Ga0307414_100310343 445
118 3300037418 Ga0395900_0112194 Ga0395900_0112194_660_2105 445
119 3300046660 Ga0495625_0084414 Ga0495625_0084414_16_1392 446
120 iso_pu_bacteria 8055588893 8055591367 447
121 3300031251 Ga0265327_10003361 Ga0265327_1000336117 448
122 3300046492 Ga0495585_0000034 Ga0495585_0000034_100384_101820 449
123 3300046520 Ga0495637_0022523 Ga0495637_0022523_1411_2847 449
124 3300013104 Ga0157370_10025141 Ga0157370_100251413 450
125 iso_pu_bacteria 2721755487 2722726145 450
126 iso_pu_bacteria 2852623160 2852626273 450
127 iso_pu_bacteria 2890737413 2890737716 450
128 iso_pu_bacteria 2896317667 2896320855 450
129 iso_pu_bacteria 2896344016 2896345904 450
130 iso_pu_bacteria 2898713307 2898716165 450
131 iso_pu_bacteria 2904780799 2904782755 450
132 iso_pu_bacteria 2919177583 2919180365 450
133 iso_pu_bacteria 3003233435 3003236835 450
134 3300031250 Ga0265331_10040708 Ga0265331_100407082 451
135 3300042876 Ga0451577_0001423 Ga0451577_0001423_22218_23582 452
136 iso_pu_bacteria 2599185184 2599480748 452
137 iso_pu_bacteria 2739367651 2739586876 452
138 iso_pu_bacteria 2842903701 2842905082 452
139 iso_pu_bacteria 2884933994 2884934724 452
140 iso_pu_bacteria 2902048731 2902051299 452
141 iso_pu_bacteria 2919437846 2919439724 452
142 iso_pu_bacteria 2928078545 2928081640 452
143 iso_pu_bacteria 2928147474 2928150331 452
144 iso_pu_bacteria 2932082852 2932085154 452
145 3300009148 Ga0105243_10000009 Ga0105243_10000009175 454
146 3300025935 Ga0207709_10000026 Ga0207709_10000026175 454
147 3300026078 Ga0207702_10094775 Ga0207702_100947752 454
148 3300006195 Ga0075366_10002164 Ga0075366_100021649 455
149 3300028794 Ga0307515_10001800 Ga0307515_1000180013 455
150 3300046492 Ga0495585_0000868 Ga0495585_0000868_14517_15890 455
151 3300046524 Ga0495648_0013767 Ga0495648_0013767_3052_4425 455
152 3300046530 Ga0495654_0021620 Ga0495654_0021620_78_1451 455
153 3300046538 Ga0495609_0011542 Ga0495609_0011542_2069_3442 455
154 3300046557 Ga0495622_0074907 Ga0495622_0074907_77_1450 455
155 3300046558 Ga0495633_0000620 Ga0495633_0000620_28389_29762 455
156 3300046660 Ga0495625_0000742 Ga0495625_0000742_3178_4551 455
157 3300046660 Ga0495625_0001618 Ga0495625_0001618_20987_22531 455
158 3300046683 Ga0495658_0018249 Ga0495658_0018249_1127_2500 455
159 3300047472 Ga0495686_0003222 Ga0495686_0003222_453_1820 455
160 3300050493 nmdc:mga0k408_190_c1 nmdc:mga0k408_190_c1_2062_3435 455
161 3300001979 JGI24740J21852_10017682 JGI24740J21852_100176821 456
162 3300005328 Ga0070676_10024019 Ga0070676_100240195 456
163 3300005355 Ga0070671_100004370 Ga0070671_1000043702 456
164 3300005366 Ga0070659_100091598 Ga0070659_1000915983 456
165 3300005455 Ga0070663_100036238 Ga0070663_1000362384 456
166 3300005457 Ga0070662_100003641 Ga0070662_10000364114 456
167 3300005539 Ga0068853_100055666 Ga0068853_1000556662 456
168 3300005539 Ga0068853_100076814 Ga0068853_1000768145 456
169 3300005563 Ga0068855_100020279 Ga0068855_1000202796 456
170 3300006358 Ga0068871_100000353 Ga0068871_1000003538 456
171 3300006881 Ga0068865_100005388 Ga0068865_1000053888 456
172 3300009093 Ga0105240_10001259 Ga0105240_1000125933 456
173 3300009093 Ga0105240_10003566 Ga0105240_1000356612 456
174 3300009093 Ga0105240_10058628 Ga0105240_100586282 456
175 3300009174 Ga0105241_10005156 Ga0105241_100051562 456
176 3300009545 Ga0105237_10000481 Ga0105237_1000048124 456
177 3300009545 Ga0105237_10001805 Ga0105237_1000180515 456
178 3300009545 Ga0105237_10018481 Ga0105237_100184818 456
179 3300013102 Ga0157371_10002211 Ga0157371_100022118 456
180 3300013104 Ga0157370_10170472 Ga0157370_101704722 456
181 3300013105 Ga0157369_10000301 Ga0157369_1000030110 456
182 3300013296 Ga0157374_10000180 Ga0157374_100001808 456
183 3300013306 Ga0163162_10000051 Ga0163162_1000005125 456
184 3300013306 Ga0163162_10046291 Ga0163162_100462911 456
185 3300013307 Ga0157372_10000037 Ga0157372_10000037138 456
186 3300013307 Ga0157372_10040956 Ga0157372_100409562 456
187 3300013307 Ga0157372_10145234 Ga0157372_101452342 456
188 3300013308 Ga0157375_10027970 Ga0157375_100279703 456
189 3300017792 Ga0163161_10000158 Ga0163161_1000015838 456
190 3300025250 Ga0209026_1008956 Ga0209026_10089562 456
191 3300025904 Ga0207647_10004540 Ga0207647_100045402 456
192 3300025913 Ga0207695_10009174 Ga0207695_100091745 456
193 3300025913 Ga0207695_10019146 Ga0207695_100191467 456
194 3300025914 Ga0207671_10000477 Ga0207671_1000047713 456
195 3300025914 Ga0207671_10006938 Ga0207671_100069388 456
196 3300025914 Ga0207671_10013208 Ga0207671_100132088 456
197 3300025931 Ga0207644_10000472 Ga0207644_100004723 456
198 3300025932 Ga0207690_10068858 Ga0207690_100688583 456
199 3300025933 Ga0207706_10003806 Ga0207706_1000380619 456
200 3300025938 Ga0207704_10000972 Ga0207704_100009729 456
201 3300025949 Ga0207667_10013819 Ga0207667_100138196 456
202 3300026023 Ga0207677_10069278 Ga0207677_100692782 456
203 3300026041 Ga0207639_10006123 Ga0207639_100061234 456
204 3300026067 Ga0207678_10050501 Ga0207678_100505013 456
205 3300026089 Ga0207648_10026794 Ga0207648_100267943 456
206 3300028786 Ga0307517_10000212 Ga0307517_1000021275 456
207 3300028794 Ga0307515_10061382 Ga0307515_100613826 456
208 3300030732 Ga0316176_1147782 Ga0316176_11477823 456
209 3300030744 Ga0316181_1127864 Ga0316181_11278646 456
210 3300032004 Ga0307414_10006516 Ga0307414_100065165 456
211 3300033180 Ga0307510_10000231 Ga0307510_100002312 456
212 3300037312 Ga0395899_0000280 Ga0395899_0000280_53753_55123 456
213 3300037418 Ga0395900_0000204 Ga0395900_0000204_14962_16332 456
214 3300037418 Ga0395900_0016320 Ga0395900_0016320_4644_6017 456
215 3300038443 Ga0395901_0104176 Ga0395901_0104176_1531_2904 456
216 3300044684 Ga0466966_0011376 Ga0466966_0011376_1946_3319 456
217 3300045049 Ga0466959_0055104 Ga0466959_0055104_1352_2725 456
218 3300046500 Ga0495596_0019634 Ga0495596_0019634_613_1986 456
219 3300046518 Ga0495631_0005855 Ga0495631_0005855_4256_5698 456
220 3300046616 Ga0495668_0000667 Ga0495668_0000667_3665_5215 456
221 3300047443 Ga0495687_004653 Ga0495687_004653_5039_6412 456
222 3300049663 Ga0501223_000325 Ga0501223_000325_3184_4578 456
223 3300053122 Ga0500608_010225 Ga0500608_010225_2199_3572 456
224 iso_pu_bacteria 2738541283 2738759141 456

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03129

HGTP_anticodon

Anticodon binding domain

438

526

0.97

PF13393

tRNA-synt_His

Histidyl-tRNA synthetase

34

99

0.92

PF13393

tRNA-synt_His

Histidyl-tRNA synthetase

172

419

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1v95-assembly1.cif.gz_A solution structure of anticodon binding domain from nuclear receptor coactivator 5 (human kiaa1637 protein) 0.8771 365 453
6nhi-assembly1.cif.gz_A-2 crystal structure of histidine--trna ligase from elizabethkingia sp. ccug 26117 0.8679 4 450
6nhi-assembly1.cif.gz_A-2 crystal structure of histidine--trna ligase from elizabethkingia sp. ccug 26117 0.8626 4 450
3net-assembly1.cif.gz_A crystal structure of histidyl-trna synthetase from nostoc sp. pcc 7120 0.8448 7 453
3od1-assembly1.cif.gz_B the crystal structure of an atp phosphoribosyltransferase regulatory subunit/histidyl-trna synthetase from bacillus halodurans c 0.8406 4 412
ID Description Score Start End Superfamily
af_Q58597_494_604_3.40.50.800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.9397 364 453 3.40.50.800
af_F4IFC5_546_649_3.40.50.800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.9384 363 453 3.40.50.800
1adjA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.9376 363 453 3.40.50.800
af_Q58406_325_416_3.40.50.800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.9373 363 451 3.40.50.800
af_Q8IIA4_894_1011_3.40.50.800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.9354 363 453 3.40.50.800
ID Description Score Start End GO Terms
AF-A0A7W1ZWP5-F1-model_v4 Histidine--tRNA ligase 0.9764 372 453 GO:0004812
GO:0006418
AF-A0A2D7SZV1-F1-model_v4 Histidine--tRNA ligase 0.976 367 453 GO:0004812
GO:0006418
AF-A0A3D4ER88-F1-model_v4 Histidine--tRNA ligase 0.9671 369 454 GO:0004812
GO:0006418
AF-X1UAI8-F1-model_v4 Anticodon-binding domain-containing protein 0.9655 366 454
AF-A0A2R6AJ03-F1-model_v4 Anticodon-binding domain-containing protein 0.959 365 453

Feature Viewer

pLDDT pTM Quality
84.1 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map