F336406

General Info

Members Datasets Scaffolds Average Seq Length
224 173 218 250

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100070966|Ga0070713_1000709661
Length 287
Sequence MSDRGIRVGRAGANGASIYGAAATVVSGPVTRRASLVLAPNASPMTLDGTNTWVLAEPGARRAVVVDPGPLDEGHLAAIIARADELGARVATVLLTHGHPDHAESTRRFAELTGAPVRALDPALRLGSEGLGDGDVVEVDGLEIRVVGTPGHTGDSLSFVLPADRAVLTGDAVLGRGTTVVMHPEGSLRDYLDSLGKLRRLVDQVPIEQVLPGHGPVRDDPGAVLDFYLAHRAARLAQVEDAVTAGDRTAAQIVRRVYADVDPALWPAAEMSVQAQLDYLKQVRPRD

Samples

Sample ID Description Type Environment
1 2643221561 Nocardioides sp. Root151 Isolate Unclassified
2 2643221696 Nocardioides sp. Root140 Isolate Unclassified
3 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
4 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
48 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
50 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
73 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
75 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
76 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
77 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
78 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
79 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
80 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
81 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
82 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
87 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
88 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
89 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
90 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
91 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
92 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
93 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
94 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
95 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
96 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
97 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
98 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
99 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
100 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
101 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
102 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
103 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
104 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
105 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
106 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
107 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
108 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
109 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
110 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
111 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
112 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
113 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
114 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
115 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
116 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
117 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
118 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
119 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
120 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
121 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
122 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
123 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
124 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
125 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
126 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
127 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
128 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
143 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
144 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
145 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
146 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
147 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
148 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
149 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
150 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
151 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
152 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
153 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
155 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
156 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
157 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
158 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
159 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
160 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
161 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
162 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
163 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
164 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
165 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
166 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
167 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
168 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
169 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
170 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
171 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
172 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
173 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.98
Metatranscriptomes 1.34
Isolates 2.68

Biome Distribution

Category Percentage (%)
Aerial Root 0.89
Bulb 0
Endosphere 5.36
Nodule 0
Rhizoplane 1.79
Rhizosphere 85.27
Stem 0
Stem Tuber 0
Unclassified 6.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10094948 3300003320 Bacteria 1582
2 rootH1_10051513 3300003323 Bacteria 2410
3 Ga0070683_100127290 3300005329 Bacteria 2408
4 Ga0070683_100376950 3300005329 Bacteria 1352
5 Ga0068869_100211012 3300005334 Bacteria 1535
6 Ga0070680_100537376 3300005336 Bacteria 1001
7 Ga0068868_100004095 3300005338 Bacteria 10182
8 Ga0068868_100335276 3300005338 Bacteria 1292
9 Ga0070660_100006162 3300005339 Bacteria 8299
10 Ga0070660_100016254 3300005339 Bacteria 5398
11 Ga0070660_100261730 3300005339 Bacteria 1412
12 Ga0070687_100123508 3300005343 Bacteria 1485
13 Ga0070692_10025003 3300005345 Bacteria 2941
14 Ga0070669_100237423 3300005353 Bacteria 1447
15 Ga0070675_100016166 3300005354 Bacteria 5916
16 Ga0070659_100010384 3300005366 Bacteria 6849
17 Ga0070659_100277842 3300005366 Bacteria 1393
18 Ga0070714_100000011 3300005435 Bacteria 231268
19 Ga0070714_100016050 3300005435 Bacteria 6038
20 Ga0070713_100070966 3300005436 Bacteria 2942
21 Ga0070700_100001140 3300005441 Bacteria 13136
22 Ga0070663_100188362 3300005455 Bacteria 1605
23 Ga0070681_10018176 3300005458 Bacteria 7029
24 Ga0070679_100280143 3300005530 Bacteria 1620
25 Ga0070684_100205731 3300005535 Bacteria 1794
26 Ga0070696_100003585 3300005546 Bacteria 10337
27 Ga0068855_100157289 3300005563 Bacteria 2582
28 Ga0068855_100522039 3300005563 Bacteria 1288
29 Ga0070664_100013907 3300005564 Bacteria 6561
30 Ga0070664_100034104 3300005564 Bacteria 4269
31 Ga0068857_100805688 3300005577 Bacteria 897
32 Ga0068852_100015196 3300005616 Bacteria 5959
33 Ga0068852_100198681 3300005616 Bacteria 1897
34 Ga0068861_100071929 3300005719 Bacteria 2682
35 Ga0068862_100124578 3300005844 Bacteria 2274
36 Ga0075365_10212490 3300006038 Bacteria 1356
37 Ga0075367_10108508 3300006178 Bacteria 1702
38 Ga0075428_100214869 3300006844 Bacteria 2078
39 Ga0075430_100189055 3300006846 Bacteria 1712
40 Ga0075429_100232339 3300006880 Bacteria 1615
41 Ga0068865_100226960 3300006881 Bacteria 1463
42 Ga0105251_10188406 3300009011 Bacteria 929
43 Ga0111539_10029500 3300009094 Bacteria 6680
44 Ga0105245_10018008 3300009098 Bacteria 6169
45 Ga0105245_10485013 3300009098 Bacteria 1250
46 Ga0105245_10889792 3300009098 Bacteria 932
47 Ga0114129_10624554 3300009147 Bacteria 1393
48 Ga0105248_10094130 3300009177 Bacteria 3374
49 Ga0105237_10075896 3300009545 Bacteria 3352
50 Ga0105239_11111716 3300010375 Bacteria 910
51 Ga0163162_10247231 3300013306 Bacteria 1915
52 Ga0157372_10642744 3300013307 Bacteria 1236
53 Ga0163163_10164256 3300014325 Bacteria 2266
54 Ga0157377_10011054 3300014745 Bacteria 4491
55 Ga0206353_11225032 3300020082 Bacteria 2209
56 Ga0206353_12059677 3300020082 Bacteria 4753
57 Ga0213875_10000715 3300021388 Bacteria 25429
58 Ga0224712_10027872 3300022467 Bacteria 2014
59 Ga0207688_10227786 3300025901 Bacteria 1124
60 Ga0207707_10053921 3300025912 Bacteria 3500
61 Ga0207671_10311814 3300025914 Bacteria 1244
62 Ga0207660_10026202 3300025917 Bacteria 3969
63 Ga0207662_10129000 3300025918 Bacteria 1592
64 Ga0207657_10008625 3300025919 Bacteria 10319
65 Ga0207657_10024214 3300025919 Bacteria 5632
66 Ga0207652_10084510 3300025921 Bacteria 2781
67 Ga0207659_10007707 3300025926 Bacteria 6644
68 Ga0207687_10011357 3300025927 Bacteria 5821
69 Ga0207700_10228414 3300025928 Bacteria 1581
70 Ga0207664_10000001 3300025929 Bacteria 724213
71 Ga0207664_10041511 3300025929 Bacteria 3584
72 Ga0207690_10125281 3300025932 Bacteria 1872
73 Ga0207690_10126413 3300025932 Bacteria 1865
74 Ga0207690_10186076 3300025932 Bacteria 1567
75 Ga0207690_10303768 3300025932 Bacteria 1249
76 Ga0207704_10187996 3300025938 Bacteria 1500
77 Ga0207711_10070840 3300025941 Bacteria 3024
78 Ga0207689_10028872 3300025942 Bacteria 4638
79 Ga0207661_10047104 3300025944 Bacteria 3421
80 Ga0207679_10012724 3300025945 Bacteria 5495
81 Ga0207667_10665195 3300025949 Bacteria 1046
82 Ga0207678_10017168 3300026067 Bacteria 6353
83 Ga0207675_100098175 3300026118 Bacteria 2758
84 Ga0207698_10008182 3300026142 Bacteria 6594
85 Ga0207698_10100687 3300026142 Bacteria 2394
86 Ga0207698_10219618 3300026142 Bacteria 1716
87 Ga0207428_10054777 3300027907 Bacteria 3175
88 Ga0268265_10094747 3300028380 Bacteria 2395
89 Ga0307515_10000083 3300028794 Bacteria 222889
90 Ga0307512_10028661 3300030522 Bacteria 4877
91 Ga0307513_10004280 3300031456 Bacteria 19095
92 Ga0307408_100082526 3300031548 Bacteria 2406
93 Ga0307508_10021531 3300031616 Bacteria 5863
94 Ga0307516_10003663 3300031730 Bacteria 19528
95 Ga0307405_10063200 3300031731 Bacteria 2347
96 Ga0307405_10364042 3300031731 Bacteria 1120
97 Ga0307410_10270540 3300031852 Bacteria 1329
98 Ga0307406_10465285 3300031901 Bacteria 1018
99 Ga0307412_10029359 3300031911 Bacteria 3451
100 Ga0307409_100037352 3300031995 Bacteria 3581
101 Ga0307409_100053506 3300031995 Bacteria 3102
102 Ga0307416_100071110 3300032002 Bacteria 2889
103 Ga0307415_100017516 3300032126 Bacteria 4299
104 Ga0307415_100020821 3300032126 Bacteria 4015
105 Ga0307415_100326415 3300032126 Bacteria 1282
106 Ga0373951_0000013 3300035091 Bacteria 71164
107 Ga0395900_0043472 3300037418 Bacteria 4631
108 Ga0395898_0020600 3300037466 Bacteria 6698
109 Ga0395898_0223733 3300037466 Bacteria 1795
110 Ga0436364_0480718 3300037853 Bacteria 6731
111 Ga0436364_1003090 3300037853 Bacteria 5640
112 Ga0436364_1059010 3300037853 Bacteria 60327
113 Ga0439438_019388 3300041405 Bacteria 1922
114 Ga0451843_0369796 3300041509 Bacteria 862
115 Ga0451853_1864993 3300041512 Bacteria 5801
116 Ga0439433_0045885 3300041999 Bacteria 1023
117 Ga0439442_004413 3300042002 Bacteria 2795
118 Ga0439445_0022347 3300042004 Bacteria 1595
119 Ga0439448_0117760 3300042005 Bacteria 910
120 Ga0439449_0001056 3300042007 Bacteria 10862
121 Ga0439434_0020935 3300042435 Bacteria 1965
122 Ga0439464_0049060 3300042439 Bacteria 1217
123 Ga0466969_0090683 3300044656 Bacteria 1449
124 Ga0466972_0016791 3300044658 Bacteria 3660
125 Ga0466965_0133252 3300044683 Bacteria 1290
126 Ga0466966_0024573 3300044684 Bacteria 3940
127 Ga0466966_0034503 3300044684 Bacteria 3270
128 Ga0466961_0004439 3300044693 Bacteria 8785
129 Ga0466961_0052055 3300044693 Bacteria 2613
130 Ga0466961_0052528 3300044693 Bacteria 2601
131 Ga0466961_0063088 3300044693 Bacteria 2354
132 Ga0466963_0006354 3300044694 Bacteria 6988
133 Ga0466963_0018626 3300044694 Bacteria 4344
134 Ga0466963_0117796 3300044694 Bacteria 1826
135 Ga0466971_0005214 3300044719 Bacteria 5627
136 Ga0466971_0024086 3300044719 Bacteria 2715
137 Ga0466971_0037606 3300044719 Bacteria 2170
138 Ga0466970_0011558 3300044765 Bacteria 4501
139 Ga0466970_0108382 3300044765 Bacteria 1516
140 Ga0466957_0032550 3300044842 Bacteria 3122
141 Ga0466957_0357731 3300044842 Bacteria 992
142 Ga0466960_0014922 3300044901 Bacteria 3339
143 Ga0466959_0021392 3300045049 Bacteria 4770
144 Ga0466959_0195715 3300045049 Bacteria 1409
145 Ga0466958_0055497 3300045836 Bacteria 2404
146 Ga0466958_0057641 3300045836 Bacteria 2361
147 Ga0466958_0107497 3300045836 Bacteria 1740
148 Ga0466967_0044728 3300045976 Bacteria 3842
149 Ga0466967_0508793 3300045976 Bacteria 1182
150 Ga0495592_0017145 3300046454 Bacteria 5500
151 Ga0495651_0003035 3300046462 Bacteria 12947
152 Ga0495651_0038673 3300046462 Bacteria 3716
153 Ga0495585_0049328 3300046492 Bacteria 2338
154 Ga0495628_0021655 3300046516 Bacteria 5284
155 Ga0495652_0001869 3300046529 Bacteria 22391
156 Ga0495587_0034672 3300046536 Bacteria 3042
157 Ga0495587_0125974 3300046536 Bacteria 1465
158 Ga0495588_0001717 3300046674 Bacteria 9330
159 Ga0495588_0018080 3300046674 Bacteria 3433
160 Ga0495675_0355685 3300047444 Bacteria 860
161 Ga0495679_029660 3300047446 Bacteria 1783
162 Ga0495685_080455 3300047447 Bacteria 1085
163 Ga0496104_0162537 3300048907 Bacteria 2142
164 Ga0496110_0051533 3300048913 Bacteria 3617
165 Ga0496111_0019735 3300048914 Bacteria 4687
166 Ga0496113_0104273 3300048916 Bacteria 2200
167 Ga0501031_0001184 3300049568 Bacteria 15874
168 Ga0501032_0114226 3300049569 Bacteria 1786
169 Ga0501033_0040853 3300049570 Bacteria 3462
170 Ga0501036_0003151 3300049572 Bacteria 13156
171 Ga0501037_0153776 3300049573 Bacteria 1643
172 Ga0501038_0006359 3300049574 Bacteria 10933
173 Ga0501038_0232064 3300049574 Bacteria 1468
174 Ga0501039_0060759 3300049575 Bacteria 2926
175 Ga0501040_0001769 3300049576 Bacteria 13881
176 Ga0501041_0131923 3300049577 Bacteria 1556
177 Ga0501042_0002229 3300049578 Bacteria 11834
178 Ga0501043_0259642 3300049579 Bacteria 1336
179 Ga0501046_0008898 3300049580 Bacteria 8715
180 Ga0501046_0021434 3300049580 Bacteria 5332
181 Ga0501047_0045189 3300049581 Bacteria 4258
182 Ga0501048_0002457 3300049582 Bacteria 14135
183 Ga0501068_0017893 3300049584 Bacteria 4103
184 Ga0501069_0069242 3300049585 Bacteria 1976
185 Ga0501069_0100100 3300049585 Bacteria 1645
186 Ga0501070_0081759 3300049586 Bacteria 2673
187 Ga0501071_0000242 3300049587 Bacteria 25216
188 Ga0501073_0132318 3300049589 Bacteria 1729
189 Ga0501074_0006376 3300049590 Bacteria 8517
190 Ga0501075_0001324 3300049591 Bacteria 16072
191 Ga0501076_0003324 3300049592 Bacteria 11279
192 Ga0501079_0001427 3300049741 Bacteria 16880
193 Ga0501080_0012152 3300049742 Bacteria 7890
194 Ga0501081_0313290 3300049743 Bacteria 1152
195 Ga0501035_0023685 3300049822 Bacteria 5634
196 Ga0501045_0058321 3300049824 Bacteria 2826
197 Ga0501045_0164556 3300049824 Bacteria 1652
198 nmdc:mga06z11_326944_c1 3300050494 Bacteria 915
199 nmdc:mga04h51_4149_c1 3300050495 Bacteria 3577
200 nmdc:mga09592_79020_c1 3300050508 Bacteria 2800
201 nmdc:mga08y16_53511_c1 3300050511 Bacteria 4221
202 Ga0495595_0043604 3300053084 Bacteria 2058
203 Ga0495619_0359093 3300053085 Bacteria 1007
204 Ga0495619_0544706 3300053085 Bacteria 796
205 Ga0500644_0055841 3300053088 Bacteria 1372
206 Ga0500644_0059138 3300053088 Bacteria 1344
207 Ga0500651_0160008 3300053093 Bacteria 1347
208 Ga0500569_011233 3300053109 Bacteria 2133
209 Ga0500594_0003927 3300053118 Bacteria 3277
210 Ga0500614_107984 3300053123 Bacteria 809
211 Ga0500573_0105402 3300053140 Bacteria 1583
212 Ga0500633_0104260 3300053160 Bacteria 1046
213 Ga0501084_0008293 3300054114 Bacteria 8572
214 Ga0501082_0008844 3300060353 Bacteria 8686
215 Ga0466962_0013800 3300061719 Bacteria 3889
216 Ga0466962_0024932 3300061719 Bacteria 2871
217 Ga0466962_0051508 3300061719 Bacteria 1968
218 Ga0530510_0001746 3300061734 Bacteria 14819

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026142 Ga0207698_10219618 Ga0207698_102196182 212
2 3300049577 Ga0501041_0131923 Ga0501041_0131923_54_776 213
3 3300006846 Ga0075430_100189055 Ga0075430_1001890552 215
4 3300013306 Ga0163162_10247231 Ga0163162_102472312 215
5 3300050508 nmdc:mga09592_79020_c1 nmdc:mga09592_79020_c1_1394_2059 215
6 3300005329 Ga0070683_100127290 Ga0070683_1001272902 217
7 3300005334 Ga0068869_100211012 Ga0068869_1002110122 217
8 3300005338 Ga0068868_100004095 Ga0068868_1000040953 217
9 3300005343 Ga0070687_100123508 Ga0070687_1001235082 217
10 3300005345 Ga0070692_10025003 Ga0070692_100250032 217
11 3300005353 Ga0070669_100237423 Ga0070669_1002374232 217
12 3300005354 Ga0070675_100016166 Ga0070675_1000161663 217
13 3300005366 Ga0070659_100010384 Ga0070659_1000103847 217
14 3300005441 Ga0070700_100001140 Ga0070700_10000114011 217
15 3300005455 Ga0070663_100188362 Ga0070663_1001883622 217
16 3300005535 Ga0070684_100205731 Ga0070684_1002057312 217
17 3300005564 Ga0070664_100013907 Ga0070664_1000139073 217
18 3300005616 Ga0068852_100015196 Ga0068852_1000151962 217
19 3300005719 Ga0068861_100071929 Ga0068861_1000719292 217
20 3300005844 Ga0068862_100124578 Ga0068862_1001245782 217
21 3300006881 Ga0068865_100226960 Ga0068865_1002269602 217
22 3300009094 Ga0111539_10029500 Ga0111539_100295003 217
23 3300009098 Ga0105245_10018008 Ga0105245_100180083 217
24 3300010375 Ga0105239_11111716 Ga0105239_111117162 217
25 3300014745 Ga0157377_10011054 Ga0157377_100110542 217
26 3300025918 Ga0207662_10129000 Ga0207662_101290002 217
27 3300025926 Ga0207659_10007707 Ga0207659_100077073 217
28 3300025927 Ga0207687_10011357 Ga0207687_100113573 217
29 3300025932 Ga0207690_10186076 Ga0207690_101860762 217
30 3300025938 Ga0207704_10187996 Ga0207704_101879962 217
31 3300025942 Ga0207689_10028872 Ga0207689_100288722 217
32 3300025944 Ga0207661_10047104 Ga0207661_100471042 217
33 3300025945 Ga0207679_10012724 Ga0207679_100127241 217
34 3300026067 Ga0207678_10017168 Ga0207678_100171683 217
35 3300026118 Ga0207675_100098175 Ga0207675_1000981753 217
36 3300026142 Ga0207698_10008182 Ga0207698_100081823 217
37 3300028380 Ga0268265_10094747 Ga0268265_100947472 217
38 3300050511 nmdc:mga08y16_53511_c1 nmdc:mga08y16_53511_c1_2374_3126 217
39 3300005435 Ga0070714_100000011 Ga0070714_100000011162 218
40 3300025929 Ga0207664_10000001 Ga0207664_10000001349 218
41 3300048914 Ga0496111_0019735 Ga0496111_0019735_2615_3343 218
42 3300044765 Ga0466970_0108382 Ga0466970_0108382_107_826 220
43 3300049568 Ga0501031_0001184 Ga0501031_0001184_6542_7264 223
44 3300049569 Ga0501032_0114226 Ga0501032_0114226_917_1639 223
45 3300049570 Ga0501033_0040853 Ga0501033_0040853_534_1256 223
46 3300049572 Ga0501036_0003151 Ga0501036_0003151_7978_8700 223
47 3300049573 Ga0501037_0153776 Ga0501037_0153776_554_1276 223
48 3300049574 Ga0501038_0006359 Ga0501038_0006359_908_1630 223
49 3300049575 Ga0501039_0060759 Ga0501039_0060759_1031_1753 223
50 3300049576 Ga0501040_0001769 Ga0501040_0001769_6350_7072 223
51 3300049578 Ga0501042_0002229 Ga0501042_0002229_7978_8700 223
52 3300049579 Ga0501043_0259642 Ga0501043_0259642_360_1082 223
53 3300049580 Ga0501046_0008898 Ga0501046_0008898_7159_7881 223
54 3300049582 Ga0501048_0002457 Ga0501048_0002457_7505_8227 223
55 3300049584 Ga0501068_0017893 Ga0501068_0017893_2410_3132 223
56 3300049585 Ga0501069_0069242 Ga0501069_0069242_403_1125 223
57 3300049587 Ga0501071_0000242 Ga0501071_0000242_6717_7439 223
58 3300049589 Ga0501073_0132318 Ga0501073_0132318_567_1289 223
59 3300049590 Ga0501074_0006376 Ga0501074_0006376_957_1679 223
60 3300049591 Ga0501075_0001324 Ga0501075_0001324_9704_10426 223
61 3300049592 Ga0501076_0003324 Ga0501076_0003324_2548_3270 223
62 3300049741 Ga0501079_0001427 Ga0501079_0001427_4418_5140 223
63 3300049742 Ga0501080_0012152 Ga0501080_0012152_707_1429 223
64 3300049743 Ga0501081_0313290 Ga0501081_0313290_341_1063 223
65 3300049824 Ga0501045_0058321 Ga0501045_0058321_1977_2699 223
66 3300054114 Ga0501084_0008293 Ga0501084_0008293_4575_5297 223
67 3300060353 Ga0501082_0008844 Ga0501082_0008844_7248_7970 223
68 3300061734 Ga0530510_0001746 Ga0530510_0001746_2159_2881 223
69 3300046492 Ga0495585_0049328 Ga0495585_0049328_1171_2004 225
70 3300041405 Ga0439438_019388 Ga0439438_019388_355_1059 229
71 3300041999 Ga0439433_0045885 Ga0439433_0045885_69_773 229
72 3300042007 Ga0439449_0001056 Ga0439449_0001056_225_929 229
73 3300042435 Ga0439434_0020935 Ga0439434_0020935_900_1604 229
74 3300005577 Ga0068857_100805688 Ga0068857_1008056881 231
75 3300006844 Ga0075428_100214869 Ga0075428_1002148694 231
76 3300006880 Ga0075429_100232339 Ga0075429_1002323392 231
77 3300009147 Ga0114129_10624554 Ga0114129_106245541 231
78 3300005339 Ga0070660_100261730 Ga0070660_1002617302 232
79 3300027907 Ga0207428_10054777 Ga0207428_100547772 232
80 3300031731 Ga0307405_10364042 Ga0307405_103640422 232
81 3300031995 Ga0307409_100037352 Ga0307409_1000373525 232
82 3300032126 Ga0307415_100017516 Ga0307415_1000175162 232
83 3300041509 Ga0451843_0369796 Ga0451843_0369796_15_749 232
84 3300053118 Ga0500594_0003927 Ga0500594_0003927_2508_3242 232
85 3300044683 Ga0466965_0133252 Ga0466965_0133252_427_1236 233
86 3300045049 Ga0466959_0195715 Ga0466959_0195715_355_1173 233
87 3300045836 Ga0466958_0057641 Ga0466958_0057641_17_835 233
88 3300026142 Ga0207698_10100687 Ga0207698_101006872 234
89 3300044684 Ga0466966_0034503 Ga0466966_0034503_1487_2305 234
90 3300044693 Ga0466961_0063088 Ga0466961_0063088_401_1219 234
91 3300044694 Ga0466963_0117796 Ga0466963_0117796_921_1739 234
92 3300042005 Ga0439448_0117760 Ga0439448_0117760_20_730 235
93 3300044693 Ga0466961_0052528 Ga0466961_0052528_856_1686 235
94 3300044694 Ga0466963_0018626 Ga0466963_0018626_857_1687 235
95 3300044719 Ga0466971_0024086 Ga0466971_0024086_101_931 235
96 3300044842 Ga0466957_0032550 Ga0466957_0032550_1144_1974 235
97 3300045976 Ga0466967_0044728 Ga0466967_0044728_1871_2701 235
98 3300048907 Ga0496104_0162537 Ga0496104_0162537_922_1650 235
99 3300048916 Ga0496113_0104273 Ga0496113_0104273_1355_2083 235
100 3300061719 Ga0466962_0051508 Ga0466962_0051508_461_1291 235
101 3300031911 Ga0307412_10029359 Ga0307412_100293592 236
102 3300044658 Ga0466972_0016791 Ga0466972_0016791_1600_2343 236
103 3300044901 Ga0466960_0014922 Ga0466960_0014922_1210_1953 236
104 3300009098 Ga0105245_10889792 Ga0105245_108897921 237
105 3300009177 Ga0105248_10094130 Ga0105248_100941302 237
106 3300025941 Ga0207711_10070840 Ga0207711_100708405 237
107 3300048913 Ga0496110_0051533 Ga0496110_0051533_1272_1991 237
108 3300049822 Ga0501035_0023685 Ga0501035_0023685_267_989 237
109 3300050494 nmdc:mga06z11_326944_c1 nmdc:mga06z11_326944_c1_114_860 237
110 3300009011 Ga0105251_10188406 Ga0105251_101884061 239
111 3300047447 Ga0495685_080455 Ga0495685_080455_86_814 239
112 3300053085 Ga0495619_0359093 Ga0495619_0359093_64_792 239
113 3300031730 Ga0307516_10003663 Ga0307516_100036635 240
114 3300045836 Ga0466958_0107497 Ga0466958_0107497_1005_1727 240
115 3300053088 Ga0500644_0059138 Ga0500644_0059138_336_1139 240
116 3300005435 Ga0070714_100016050 Ga0070714_1000160505 242
117 3300020082 Ga0206353_11225032 Ga0206353_112250322 242
118 3300025929 Ga0207664_10041511 Ga0207664_100415114 242
119 3300037466 Ga0395898_0020600 Ga0395898_0020600_1718_2446 242
120 3300037853 Ga0436364_0480718 Ga0436364_0480718_4722_5450 242
121 3300037853 Ga0436364_1003090 Ga0436364_1003090_1675_2436 242
122 3300042002 Ga0439442_004413 Ga0439442_004413_658_1386 242
123 3300046536 Ga0495587_0034672 Ga0495587_0034672_56_784 242
124 3300046536 Ga0495587_0125974 Ga0495587_0125974_640_1368 242
125 3300046674 Ga0495588_0001717 Ga0495588_0001717_79_807 242
126 3300047444 Ga0495675_0355685 Ga0495675_0355685_46_774 242
127 3300047446 Ga0495679_029660 Ga0495679_029660_1010_1738 242
128 3300049574 Ga0501038_0232064 Ga0501038_0232064_49_792 242
129 3300049580 Ga0501046_0021434 Ga0501046_0021434_3684_4421 242
130 3300049581 Ga0501047_0045189 Ga0501047_0045189_501_1238 242
131 3300050495 nmdc:mga04h51_4149_c1 nmdc:mga04h51_4149_c1_2118_2846 242
132 3300053085 Ga0495619_0544706 Ga0495619_0544706_20_748 242
133 3300053123 Ga0500614_107984 Ga0500614_107984_44_772 242
134 3300053140 Ga0500573_0105402 Ga0500573_0105402_66_794 242
135 3300053160 Ga0500633_0104260 Ga0500633_0104260_93_821 242
136 3300035091 Ga0373951_0000013 Ga0373951_0000013_44620_45387 243
137 3300049585 Ga0501069_0100100 Ga0501069_0100100_119_913 246
138 3300005339 Ga0070660_100006162 Ga0070660_1000061628 247
139 3300005366 Ga0070659_100277842 Ga0070659_1002778421 247
140 3300005563 Ga0068855_100157289 Ga0068855_1001572892 247
141 3300005564 Ga0070664_100034104 Ga0070664_1000341046 247
142 3300009545 Ga0105237_10075896 Ga0105237_100758965 247
143 3300013307 Ga0157372_10642744 Ga0157372_106427442 247
144 3300025914 Ga0207671_10311814 Ga0207671_103118141 247
145 3300025919 Ga0207657_10008625 Ga0207657_100086257 247
146 3300025932 Ga0207690_10125281 Ga0207690_101252811 247
147 3300025932 Ga0207690_10303768 Ga0207690_103037681 247
148 3300031852 Ga0307410_10270540 Ga0307410_102705401 247
149 3300031901 Ga0307406_10465285 Ga0307406_104652852 247
150 3300032002 Ga0307416_100071110 Ga0307416_1000711105 247
151 3300042004 Ga0439445_0022347 Ga0439445_0022347_710_1516 247
152 3300042439 Ga0439464_0049060 Ga0439464_0049060_352_1188 247
153 3300045976 Ga0466967_0508793 Ga0466967_0508793_27_821 247
154 iso_pu_bacteria 2643221561 2643824865 247
155 iso_pu_bacteria 2643221696 2644532584 247
156 3300005338 Ga0068868_100335276 Ga0068868_1003352762 248
157 3300006038 Ga0075365_10212490 Ga0075365_102124902 248
158 3300006178 Ga0075367_10108508 Ga0075367_101085082 248
159 3300009098 Ga0105245_10485013 Ga0105245_104850132 248
160 3300025901 Ga0207688_10227786 Ga0207688_102277861 248
161 3300025932 Ga0207690_10126413 Ga0207690_101264132 248
162 3300028794 Ga0307515_10000083 Ga0307515_10000083149 248
163 3300030522 Ga0307512_10028661 Ga0307512_100286612 248
164 3300031456 Ga0307513_10004280 Ga0307513_1000428012 248
165 3300031616 Ga0307508_10021531 Ga0307508_100215312 248
166 3300031731 Ga0307405_10063200 Ga0307405_100632002 248
167 3300031995 Ga0307409_100053506 Ga0307409_1000535065 248
168 3300032126 Ga0307415_100020821 Ga0307415_1000208212 248
169 3300032126 Ga0307415_100326415 Ga0307415_1003264152 248
170 3300041512 Ga0451853_1864993 Ga0451853_1864993_2070_2888 248
171 3300046462 Ga0495651_0038673 Ga0495651_0038673_1522_2301 248
172 3300053084 Ga0495595_0043604 Ga0495595_0043604_126_905 248
173 3300053088 Ga0500644_0055841 Ga0500644_0055841_125_940 248
174 3300053093 Ga0500651_0160008 Ga0500651_0160008_439_1254 248
175 3300053109 Ga0500569_011233 Ga0500569_011233_709_1524 248
176 3300031548 Ga0307408_100082526 Ga0307408_1000825262 249
177 3300049586 Ga0501070_0081759 Ga0501070_0081759_1675_2493 249
178 3300049824 Ga0501045_0164556 Ga0501045_0164556_306_1115 249
179 iso_pu_bacteria 2984576629 2984577736 249
180 iso_pu_bacteria 2990256926 2990260565 249
181 3300044693 Ga0466961_0004439 Ga0466961_0004439_7024_7848 250
182 3300044694 Ga0466963_0006354 Ga0466963_0006354_3691_4515 250
183 3300044719 Ga0466971_0037606 Ga0466971_0037606_659_1483 250
184 3300044842 Ga0466957_0357731 Ga0466957_0357731_50_874 250
185 3300061719 Ga0466962_0024932 Ga0466962_0024932_1111_1935 250
186 3300005329 Ga0070683_100376950 Ga0070683_1003769502 251
187 3300005336 Ga0070680_100537376 Ga0070680_1005373761 251
188 3300005339 Ga0070660_100016254 Ga0070660_1000162543 251
189 3300005458 Ga0070681_10018176 Ga0070681_100181763 251
190 3300005530 Ga0070679_100280143 Ga0070679_1002801432 251
191 3300005563 Ga0068855_100522039 Ga0068855_1005220392 251
192 3300005616 Ga0068852_100198681 Ga0068852_1001986812 251
193 3300014325 Ga0163163_10164256 Ga0163163_101642562 251
194 3300020082 Ga0206353_12059677 Ga0206353_120596772 251
195 3300025912 Ga0207707_10053921 Ga0207707_100539212 251
196 3300025917 Ga0207660_10026202 Ga0207660_100262026 251
197 3300025919 Ga0207657_10024214 Ga0207657_100242142 251
198 3300025921 Ga0207652_10084510 Ga0207652_100845102 251
199 3300025949 Ga0207667_10665195 Ga0207667_106651951 251
200 3300037418 Ga0395900_0043472 Ga0395900_0043472_2675_3448 251
201 3300037466 Ga0395898_0223733 Ga0395898_0223733_743_1516 251
202 iso_pu_bacteria 8004021418 8004022860 252
203 iso_pu_bacteria 8004025490 8004028901 253
204 3300005546 Ga0070696_100003585 Ga0070696_1000035854 254
205 3300046674 Ga0495588_0018080 Ga0495588_0018080_292_1113 254
206 3300003323 rootH1_10051513 rootH1_100515132 256
207 3300044765 Ga0466970_0011558 Ga0466970_0011558_237_1043 256
208 3300046454 Ga0495592_0017145 Ga0495592_0017145_3731_4546 256
209 3300046462 Ga0495651_0003035 Ga0495651_0003035_9890_10705 256
210 3300046516 Ga0495628_0021655 Ga0495628_0021655_2245_3060 256
211 3300046529 Ga0495652_0001869 Ga0495652_0001869_11737_12552 256
212 3300021388 Ga0213875_10000715 Ga0213875_1000071515 257
213 3300037853 Ga0436364_1059010 Ga0436364_1059010_4658_5488 257
214 3300044684 Ga0466966_0024573 Ga0466966_0024573_3046_3828 257
215 3300044693 Ga0466961_0052055 Ga0466961_0052055_279_1061 257
216 3300044719 Ga0466971_0005214 Ga0466971_0005214_3386_4168 257
217 3300045049 Ga0466959_0021392 Ga0466959_0021392_3832_4614 257
218 3300045836 Ga0466958_0055497 Ga0466958_0055497_368_1150 257
219 3300061719 Ga0466962_0013800 Ga0466962_0013800_2958_3740 257
220 3300003320 rootH2_10094948 rootH2_100949481 258
221 3300005436 Ga0070713_100070966 Ga0070713_1000709661 258
222 3300022467 Ga0224712_10027872 Ga0224712_100278722 258
223 3300025928 Ga0207700_10228414 Ga0207700_102284143 258
224 3300044656 Ga0466969_0090683 Ga0466969_0090683_495_1316 258

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17778

BLACT_WH

Beta-lactamase associated winged helix domain

249

283

0.94

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

45

214

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ao1-assembly2.cif.gz_B crystal structure of a beta-lactamase from burkholderia phymatum 0.8528 1 255
6ao1-assembly3.cif.gz_C crystal structure of a beta-lactamase from burkholderia phymatum 0.8425 1 255
6ao1-assembly2.cif.gz_B crystal structure of a beta-lactamase from burkholderia phymatum 0.8405 1 255
5u8o-assembly1.cif.gz_A crystal structure of beta-lactamase domain protein, from burkholderia multivorans 0.839 1 255
5i0p-assembly4.cif.gz_D crystal structure of a beta-lactamase domain protein from burkholderia ambifaria 0.8359 2 252
ID Description Score Start End Superfamily
af_I6XHY3_12_197_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9631 1 190 3.60.15.10
af_I6XHY3_12_197_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9277 1 190 3.60.15.10
af_A0A0R0HZQ1_3_96_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9019 98 191 3.60.15.10
af_A0A0R0HZQ1_3_96_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8661 98 191 3.60.15.10
af_A4HZ66_7_206_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8641 1 190 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A454VYW4-F1-model_v4 MBL fold metallo-hydrolase 0.9906 3 177 GO:0016787
GO:0046872
AF-A0A7K3B5E1-F1-model_v4 MBL fold metallo-hydrolase 0.988 3 255 GO:0016787
GO:0046872
AF-A0A2S3Y5Q9-F1-model_v4 MBL fold metallo-hydrolase 0.9874 3 255 GO:0016787
GO:0046872
AF-A0A3N6IA40-F1-model_v4 Hydroxyacylglutathione hydrolase 0.9874 3 255 GO:0016787
GO:0046872
AF-A0A086GNC0-F1-model_v4 deleted 0.9873 3 255

Feature Viewer

pLDDT pTM Quality
96.49 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map