F336376

General Info

Members Datasets Scaffolds Average Seq Length
224 172 448 246

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100397857|Ga0070671_1003978572
Length 284
Sequence MRSAFTTVIADRTPTRAFSISGIAPASRVKASLRWVVPALALAAPAIAWAQAAGPIPAQLSDVALFSSTPASGGGQNYSLPVQTLLLLTTLTFLPAVLLLMTGFTRIVIVLGLLRHALGTQSSPPNQVLIGLSLFLTLFVMGPVLDRVYDDAYLPYTQQKINFSQAVDRAQTPLKTFMLRQTREPDLALFIKLARQPAPKAKEDIPLRVLMPAFVTSELKTAFQIGFMVFIPFLIIDMVVASVLMSMGMMMLSPVLISLPFKLMLFVLVDGWNLLLGSLVASFG

Samples

Sample ID Description Type Environment
1 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
2 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
16 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
17 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
18 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
19 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
22 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
23 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
24 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
25 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
26 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
27 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
28 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
29 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
32 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
39 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
40 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
41 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
42 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
43 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
44 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
45 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
46 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
47 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
66 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
68 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
69 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
70 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
71 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
72 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
73 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
74 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
75 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
76 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
77 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
78 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
79 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
80 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
81 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
82 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
83 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
84 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
85 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
86 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
87 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
88 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
89 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
90 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
91 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
92 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
93 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
94 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
95 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
96 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
97 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
98 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
99 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
100 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
101 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
102 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
103 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
104 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
105 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
106 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
107 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
108 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
109 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
110 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
111 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
112 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
113 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
114 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
115 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
116 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
117 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
118 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
119 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
120 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
121 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
122 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
123 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
124 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
125 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
126 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
127 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
128 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
129 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
130 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
131 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
132 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
133 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
134 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
135 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
136 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
139 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
140 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
141 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
142 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
143 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
144 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
145 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
146 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
147 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
148 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
149 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
150 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
151 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
152 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
153 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
154 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
155 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
156 2643221645 Massilia sp. Root351 Isolate Unclassified
157 2643221664 Massilia sp. Root418 Isolate Unclassified
158 2738541280 Massilia sp. GV090 Isolate Unclassified
159 2738541300 Massilia sp. GV016 Isolate Unclassified
160 2738543018 Massilia sp. GV045 Isolate Unclassified
161 2738543030 Massilia sp. GV097 Isolate Unclassified
162 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
163 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
164 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
165 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
166 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
167 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
168 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
169 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
170 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
171 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
172 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.73
Metatranscriptomes 0
Isolates 10.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.16
Nodule 0
Rhizoplane 6.25
Rhizosphere 68.3
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070671_100397857 3300005355 Bacteria 1178
2 Ga0058692_1000127 3300003856 Bacteria 48125
3 Ga0058692_1028482 3300003856 Bacteria 1077
4 Ga0065714_10122114 3300005288 Bacteria 1301
5 Ga0065704_10121891 3300005289 Bacteria 1758
6 Ga0070680_100190525 3300005336 Bacteria 1728
7 Ga0070661_100024156 3300005344 Bacteria 4360
8 Ga0070661_100195458 3300005344 Bacteria 1544
9 Ga0070674_100518955 3300005356 Bacteria 995
10 Ga0070678_100092141 3300005456 Bacteria 2327
11 Ga0070681_10001383 3300005458 Bacteria 21258
12 Ga0070681_10244832 3300005458 Bacteria 1706
13 Ga0070679_100241396 3300005530 Bacteria 1764
14 Ga0070679_100332495 3300005530 Bacteria 1468
15 Ga0068853_100344717 3300005539 Bacteria 1385
16 Ga0068855_100250679 3300005563 Bacteria 1975
17 Ga0070664_100349847 3300005564 Bacteria 1344
18 Ga0068857_100060196 3300005577 Bacteria 3374
19 Ga0068864_100227652 3300005618 Bacteria 1723
20 Ga0068864_100242617 3300005618 Bacteria 1670
21 Ga0068858_100003704 3300005842 Bacteria 15140
22 Ga0068858_100334871 3300005842 Bacteria 1448
23 Ga0068858_100398233 3300005842 Bacteria 1322
24 Ga0068860_100040644 3300005843 Bacteria 4445
25 Ga0068862_100720810 3300005844 Bacteria 968
26 Ga0081539_10008244 3300005985 Bacteria 9155
27 Ga0075365_10043154 3300006038 Bacteria 2952
28 Ga0075365_10105026 3300006038 Bacteria 1937
29 Ga0075368_10005526 3300006042 Bacteria 4353
30 Ga0075363_100003079 3300006048 Bacteria 6993
31 Ga0075364_10004846 3300006051 Bacteria 7794
32 Ga0075364_10030625 3300006051 Bacteria 3454
33 Ga0075367_10029205 3300006178 Bacteria 3152
34 Ga0075369_10058838 3300006186 Bacteria 1673
35 Ga0075366_10004802 3300006195 Bacteria 7289
36 Ga0075370_10079509 3300006353 Bacteria 1883
37 Ga0105250_10061926 3300009092 Bacteria 1505
38 Ga0105237_10293306 3300009545 Bacteria 1629
39 Ga0105238_10393190 3300009551 Bacteria 1379
40 Ga0157373_10008472 3300013100 Bacteria 7635
41 Ga0157371_10010372 3300013102 Bacteria 7265
42 Ga0157370_10029414 3300013104 Bacteria 5391
43 Ga0157369_10000819 3300013105 Bacteria 39761
44 Ga0157374_10074924 3300013296 Bacteria 3197
45 Ga0163162_10158135 3300013306 Bacteria 2387
46 Ga0157372_10000888 3300013307 Bacteria 32455
47 Ga0182008_10000671 3300014497 Bacteria 24825
48 Ga0157379_10018100 3300014968 Bacteria 6208
49 Ga0182006_1000075 3300015261 Bacteria 130239
50 Ga0182007_10000135 3300015262 Bacteria 51737
51 Ga0182005_1000106 3300015265 Bacteria 63464
52 Ga0163161_10249168 3300017792 Bacteria 1384
53 Ga0213872_10000166 3300021361 Bacteria 59987
54 Ga0213872_10000215 3300021361 Bacteria 51118
55 Ga0207425_1007585 3300025245 Bacteria 2849
56 Ga0209129_1000103 3300025258 Bacteria 161305
57 Ga0209051_1002180 3300025303 Bacteria 14504
58 Ga0207645_10244007 3300025907 Bacteria 1187
59 Ga0207705_10173400 3300025909 Bacteria 1625
60 Ga0207707_10009958 3300025912 Bacteria 8243
61 Ga0207671_10231660 3300025914 Bacteria 1449
62 Ga0207649_10231728 3300025920 Bacteria 1321
63 Ga0207652_10020194 3300025921 Bacteria 5485
64 Ga0207652_10144392 3300025921 Bacteria 2129
65 Ga0207652_10197585 3300025921 Bacteria 1810
66 Ga0207644_10206730 3300025931 Bacteria 1551
67 Ga0207644_10360190 3300025931 Bacteria 1183
68 Ga0207669_10576655 3300025937 Bacteria 911
69 Ga0207691_10092590 3300025940 Bacteria 2707
70 Ga0207667_10277725 3300025949 Bacteria 1712
71 Ga0207658_10146925 3300025986 Bacteria 1916
72 Ga0207639_10010177 3300026041 Bacteria 6507
73 Ga0207678_10341781 3300026067 Bacteria 1290
74 Ga0207676_10056478 3300026095 Bacteria 3087
75 Ga0207676_10137214 3300026095 Bacteria 2089
76 Ga0207674_10063554 3300026116 Bacteria 3726
77 Ga0207674_10337206 3300026116 Bacteria 1458
78 Ga0207683_10058177 3300026121 Bacteria 3394
79 Ga0209371_1000020 3300027312 Bacteria 556282
80 Ga0209371_1000321 3300027312 Bacteria 52619
81 Ga0209371_1000960 3300027312 Bacteria 22432
82 Ga0209813_10005799 3300027866 Bacteria 3019
83 Ga0268264_10169837 3300028381 Bacteria 1971
84 Ga0268256_1000114 3300030500 Bacteria 117092
85 Ga0268256_1000595 3300030500 Bacteria 28720
86 Ga0268256_1000808 3300030500 Bacteria 22432
87 Ga0307511_10000267 3300030521 Bacteria 54164
88 Ga0265328_10001981 3300031239 Bacteria 9294
89 Ga0265331_10019217 3300031250 Bacteria 3530
90 Ga0265327_10010769 3300031251 Bacteria 6379
91 Ga0265327_10065547 3300031251 Bacteria 1836
92 Ga0307509_10186744 3300031507 Bacteria 1930
93 Ga0307508_10326125 3300031616 Bacteria 1127
94 Ga0307514_10037480 3300031649 Bacteria 3844
95 Ga0307507_10038502 3300033179 Bacteria 4845
96 Ga0307510_10016370 3300033180 Bacteria 8751
97 Ga0373952_0002684 3300035092 Bacteria 3210
98 Ga0373960_0006818 3300035121 Bacteria 2690
99 Ga0373942_0031813 3300035207 Bacteria 1398
100 Ga0395900_0017837 3300037418 Bacteria 7244
101 Ga0395898_0008225 3300037466 Bacteria 11030
102 Ga0395898_0202453 3300037466 Bacteria 1895
103 Ga0395905_0000469 3300037471 Bacteria 55742
104 Ga0395905_0059395 3300037471 Bacteria 3575
105 Ga0395901_0009836 3300038443 Bacteria 9696
106 Ga0395901_0032242 3300038443 Bacteria 5407
107 Ga0436365_1877509 3300039437 Bacteria 1478
108 Ga0436361_0489030 3300039447 Bacteria 8200
109 Ga0436361_0657731 3300039447 Bacteria 46245
110 Ga0436361_0739768 3300039447 Bacteria 83506
111 Ga0451577_0081858 3300042876 Bacteria 2880
112 Ga0451577_0450187 3300042876 Bacteria 1169
113 Ga0453684_0000917 3300044712 Bacteria 97990
114 Ga0453684_0001320 3300044712 Bacteria 73258
115 Ga0451576_0000184 3300045051 Bacteria 157166
116 Ga0451576_0187987 3300045051 Bacteria 2157
117 Ga0451576_0312262 3300045051 Bacteria 1645
118 Ga0495617_039280 3300046452 Bacteria 1582
119 Ga0495605_0018599 3300046474 Bacteria 3721
120 Ga0495584_0000405 3300046491 Bacteria 29778
121 Ga0495584_0015090 3300046491 Bacteria 3937
122 Ga0495584_0021863 3300046491 Bacteria 3248
123 Ga0495607_0147642 3300046501 Bacteria 1206
124 Ga0495583_0000164 3300046506 Bacteria 112062
125 Ga0495583_0000413 3300046506 Bacteria 64881
126 Ga0495616_0002022 3300046513 Bacteria 13642
127 Ga0495616_0055210 3300046513 Bacteria 1967
128 Ga0495644_0004026 3300046523 Bacteria 5782
129 Ga0495648_0000918 3300046524 Bacteria 30641
130 Ga0495654_0025919 3300046530 Bacteria 3018
131 Ga0495654_0191248 3300046530 Bacteria 881
132 Ga0495609_0002037 3300046538 Bacteria 12740
133 Ga0495597_0007143 3300046542 Bacteria 5709
134 Ga0495633_0000681 3300046558 Bacteria 31325
135 Ga0495633_0003958 3300046558 Bacteria 9627
136 Ga0495633_0052442 3300046558 Bacteria 1921
137 Ga0495656_0007452 3300046615 Bacteria 3865
138 Ga0495668_0118303 3300046616 Bacteria 1449
139 Ga0495611_0006036 3300046648 Bacteria 5167
140 Ga0495611_0029306 3300046648 Bacteria 2413
141 Ga0495625_0034314 3300046660 Bacteria 3745
142 Ga0495625_0057747 3300046660 Bacteria 2758
143 Ga0495659_0000031 3300046664 Bacteria 65868
144 Ga0495659_0004330 3300046664 Bacteria 4468
145 Ga0495661_0051576 3300046665 Bacteria 2483
146 Ga0495623_0177543 3300046679 Bacteria 1240
147 Ga0495670_0015400 3300046691 Bacteria 3757
148 Ga0495670_0046255 3300046691 Bacteria 2173
149 Ga0495671_0000345 3300046692 Bacteria 38587
150 Ga0495671_0057559 3300046692 Bacteria 1923
151 Ga0495649_0000731 3300046694 Bacteria 26728
152 Ga0495589_0030356 3300046794 Bacteria 2722
153 Ga0495636_0001035 3300047318 Bacteria 10426
154 Ga0495672_0000697 3300047320 Bacteria 37194
155 Ga0495672_0068847 3300047320 Bacteria 2011
156 Ga0495687_000235 3300047443 Bacteria 76976
157 Ga0495677_0009287 3300047445 Bacteria 3633
158 Ga0495685_000279 3300047447 Bacteria 17084
159 Ga0495685_027900 3300047447 Bacteria 1942
160 Ga0495673_0003706 3300047469 Bacteria 9936
161 Ga0496102_0098181 3300048905 Bacteria 2717
162 Ga0496105_0151773 3300048908 Bacteria 1904
163 Ga0496105_0382327 3300048908 Bacteria 1120
164 Ga0496105_0397371 3300048908 Bacteria 1095
165 Ga0496110_0009400 3300048913 Bacteria 7915
166 Ga0496111_0057258 3300048914 Bacteria 2822
167 Ga0496112_0005993 3300048915 Bacteria 10606
168 Ga0496114_0022464 3300048917 Bacteria 5143
169 Ga0496116_0001754 3300048919 Bacteria 23633
170 Ga0496116_0020560 3300048919 Bacteria 5010
171 Ga0496117_0000001 3300048920 Bacteria 2526244
172 Ga0496117_0070590 3300048920 Bacteria 2345
173 Ga0496118_0000008 3300048921 Bacteria 644537
174 Ga0496118_0008897 3300048921 Bacteria 10261
175 Ga0496119_0000156 3300048922 Bacteria 94640
176 Ga0496121_0006919 3300048924 Bacteria 13825
177 Ga0496121_0015240 3300048924 Bacteria 8077
178 Ga0496122_0001150 3300048925 Bacteria 45372
179 Ga0496123_0001208 3300048926 Bacteria 37717
180 Ga0496123_0017871 3300048926 Bacteria 5679
181 Ga0496124_0000180 3300048927 Bacteria 125291
182 Ga0496124_0060670 3300048927 Bacteria 3172
183 Ga0496124_0418901 3300048927 Bacteria 923
184 Ga0496125_0045112 3300048928 Bacteria 3715
185 Ga0495678_026223 3300049459 Bacteria 2491
186 Ga0495682_0021837 3300049460 Bacteria 2396
187 Ga0501290_006889 3300049513 Bacteria 1424
188 Ga0501032_0184341 3300049569 Bacteria 1366
189 Ga0501038_0011292 3300049574 Bacteria 8153
190 Ga0501083_0152440 3300049744 Bacteria 1513
191 nmdc:mga03683_47780_c1 3300050489 Bacteria 1777
192 nmdc:mga03n38_8817_c1 3300050490 Bacteria 3638
193 nmdc:mga00v17_11240_c1 3300050491 Bacteria 4917
194 nmdc:mga07m45_29689_c1 3300050496 Bacteria 3026
195 Ga0500646_0006983 3300053090 Bacteria 2877
196 Ga0500651_0075728 3300053093 Bacteria 2090
197 Ga0500655_003190 3300053133 Bacteria 2974
198 Ga0500559_0000236 3300053136 Bacteria 43881
199 Ga0500568_0050219 3300053139 Bacteria 1645
200 Ga0500604_0002912 3300053151 Bacteria 4630
201 Ga0500637_0075361 3300053178 Bacteria 1944
202 2601533277 2600255256 Bacteria 5597742
203 2601538641 2600255257 Bacteria 5597196
204 2601670879 2600255292 Bacteria 6300551
205 2601756990 2600255310 Bacteria 5600903
206 2601761555 2600255311 Bacteria 5598766
207 2603641174 2602042046 Bacteria 5483348
208 2644253949 2643221645 Bacteria 7207331
209 2644356720 2643221664 Bacteria 7272945
210 2738742091 2738541280 Bacteria 6630198
211 2738844544 2738541300 Bacteria 6675882
212 2739276054 2738543018 Bacteria 6718814
213 2739345422 2738543030 Bacteria 6719714
214 2813727481 2811995292 Bacteria 5303342
215 2814695012 2814123068 Bacteria 5687681
216 2857547652 2857547612 Bacteria 6179999
217 2885082861 2885080285 Bacteria 6355622
218 2932412263 2932410948 Bacteria 6312192
219 2932419778 2932416698 Bacteria 6315112
220 2935629137 2935625433 Bacteria 5042964
221 2939621824 2939617950 Bacteria 4820956
222 2974439730 2974435778 Bacteria 4876478
223 2998347795 2998344455 Bacteria 4222996
224 8019508859 8019504834 Bacteria 4819156
225 Ga0070671_100397857
226 Ga0058692_1000127
227 Ga0058692_1028482
228 Ga0065714_10122114
229 Ga0065704_10121891
230 Ga0070680_100190525
231 Ga0070661_100024156
232 Ga0070661_100195458
233 Ga0070674_100518955
234 Ga0070678_100092141
235 Ga0070681_10001383
236 Ga0070681_10244832
237 Ga0070679_100241396
238 Ga0070679_100332495
239 Ga0068853_100344717
240 Ga0068855_100250679
241 Ga0070664_100349847
242 Ga0068857_100060196
243 Ga0068864_100227652
244 Ga0068864_100242617
245 Ga0068858_100003704
246 Ga0068858_100334871
247 Ga0068858_100398233
248 Ga0068860_100040644
249 Ga0068862_100720810
250 Ga0081539_10008244
251 Ga0075365_10043154
252 Ga0075365_10105026
253 Ga0075368_10005526
254 Ga0075363_100003079
255 Ga0075364_10004846
256 Ga0075364_10030625
257 Ga0075367_10029205
258 Ga0075369_10058838
259 Ga0075366_10004802
260 Ga0075370_10079509
261 Ga0105250_10061926
262 Ga0105237_10293306
263 Ga0105238_10393190
264 Ga0157373_10008472
265 Ga0157371_10010372
266 Ga0157370_10029414
267 Ga0157369_10000819
268 Ga0157374_10074924
269 Ga0163162_10158135
270 Ga0157372_10000888
271 Ga0182008_10000671
272 Ga0157379_10018100
273 Ga0182006_1000075
274 Ga0182007_10000135
275 Ga0182005_1000106
276 Ga0163161_10249168
277 Ga0213872_10000166
278 Ga0213872_10000215
279 Ga0207425_1007585
280 Ga0209129_1000103
281 Ga0209051_1002180
282 Ga0207645_10244007
283 Ga0207705_10173400
284 Ga0207707_10009958
285 Ga0207671_10231660
286 Ga0207649_10231728
287 Ga0207652_10020194
288 Ga0207652_10144392
289 Ga0207652_10197585
290 Ga0207644_10206730
291 Ga0207644_10360190
292 Ga0207669_10576655
293 Ga0207691_10092590
294 Ga0207667_10277725
295 Ga0207658_10146925
296 Ga0207639_10010177
297 Ga0207678_10341781
298 Ga0207676_10056478
299 Ga0207676_10137214
300 Ga0207674_10063554
301 Ga0207674_10337206
302 Ga0207683_10058177
303 Ga0209371_1000020
304 Ga0209371_1000321
305 Ga0209371_1000960
306 Ga0209813_10005799
307 Ga0268264_10169837
308 Ga0268256_1000114
309 Ga0268256_1000595
310 Ga0268256_1000808
311 Ga0307511_10000267
312 Ga0265328_10001981
313 Ga0265331_10019217
314 Ga0265327_10010769
315 Ga0265327_10065547
316 Ga0307509_10186744
317 Ga0307508_10326125
318 Ga0307514_10037480
319 Ga0307507_10038502
320 Ga0307510_10016370
321 Ga0373952_0002684
322 Ga0373960_0006818
323 Ga0373942_0031813
324 Ga0395900_0017837
325 Ga0395898_0008225
326 Ga0395898_0202453
327 Ga0395905_0000469
328 Ga0395905_0059395
329 Ga0395901_0009836
330 Ga0395901_0032242
331 Ga0436365_1877509
332 Ga0436361_0489030
333 Ga0436361_0657731
334 Ga0436361_0739768
335 Ga0451577_0081858
336 Ga0451577_0450187
337 Ga0453684_0000917
338 Ga0453684_0001320
339 Ga0451576_0000184
340 Ga0451576_0187987
341 Ga0451576_0312262
342 Ga0495617_039280
343 Ga0495605_0018599
344 Ga0495584_0000405
345 Ga0495584_0015090
346 Ga0495584_0021863
347 Ga0495607_0147642
348 Ga0495583_0000164
349 Ga0495583_0000413
350 Ga0495616_0002022
351 Ga0495616_0055210
352 Ga0495644_0004026
353 Ga0495648_0000918
354 Ga0495654_0025919
355 Ga0495654_0191248
356 Ga0495609_0002037
357 Ga0495597_0007143
358 Ga0495633_0000681
359 Ga0495633_0003958
360 Ga0495633_0052442
361 Ga0495656_0007452
362 Ga0495668_0118303
363 Ga0495611_0006036
364 Ga0495611_0029306
365 Ga0495625_0034314
366 Ga0495625_0057747
367 Ga0495659_0000031
368 Ga0495659_0004330
369 Ga0495661_0051576
370 Ga0495623_0177543
371 Ga0495670_0015400
372 Ga0495670_0046255
373 Ga0495671_0000345
374 Ga0495671_0057559
375 Ga0495649_0000731
376 Ga0495589_0030356
377 Ga0495636_0001035
378 Ga0495672_0000697
379 Ga0495672_0068847
380 Ga0495687_000235
381 Ga0495677_0009287
382 Ga0495685_000279
383 Ga0495685_027900
384 Ga0495673_0003706
385 Ga0496102_0098181
386 Ga0496105_0151773
387 Ga0496105_0382327
388 Ga0496105_0397371
389 Ga0496110_0009400
390 Ga0496111_0057258
391 Ga0496112_0005993
392 Ga0496114_0022464
393 Ga0496116_0001754
394 Ga0496116_0020560
395 Ga0496117_0000001
396 Ga0496117_0070590
397 Ga0496118_0000008
398 Ga0496118_0008897
399 Ga0496119_0000156
400 Ga0496121_0006919
401 Ga0496121_0015240
402 Ga0496122_0001150
403 Ga0496123_0001208
404 Ga0496123_0017871
405 Ga0496124_0000180
406 Ga0496124_0060670
407 Ga0496124_0418901
408 Ga0496125_0045112
409 Ga0495678_026223
410 Ga0495682_0021837
411 Ga0501290_006889
412 Ga0501032_0184341
413 Ga0501038_0011292
414 Ga0501083_0152440
415 nmdc:mga03683_47780_c1
416 nmdc:mga03n38_8817_c1
417 nmdc:mga00v17_11240_c1
418 nmdc:mga07m45_29689_c1
419 Ga0500646_0006983
420 Ga0500651_0075728
421 Ga0500655_003190
422 Ga0500559_0000236
423 Ga0500568_0050219
424 Ga0500604_0002912
425 Ga0500637_0075361
426 2601533277
427 2601538641
428 2601670879
429 2601756990
430 2601761555
431 2603641174
432 2644253949
433 2644356720
434 2738742091
435 2738844544
436 2739276054
437 2739345422
438 2813727481
439 2814695012
440 2857547652
441 2885082861
442 2932412263
443 2932419778
444 2935629137
445 2939621824
446 2974439730
447 2998347795
448 8019508859

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00813

FliP

FliP family

87

279

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6s3l-assembly1.cif.gz_C structure of the core of the flagellar export apparatus from vibrio mimicus, the flipqr-flhb complex. 0.8161 58 248
6s3s-assembly1.cif.gz_D structure of the flipqr complex from the flagellar type 3 secretion system of vibrio mimicus. 0.8008 59 248
6s3r-assembly1.cif.gz_A structure of the flipqr complex from the flagellar type 3 secretion system of pseudomonas savastanoi. 0.7998 60 248
7bin-assembly1.cif.gz_A salmonella export gate and rod refined in focussed c1 map 0.7982 43 250
7bin-assembly1.cif.gz_A salmonella export gate and rod refined in focussed c1 map 0.7915 43 250
ID Description Score Start End Superfamily
af_A0A0U1RNF5_1_210_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3553 53 193 1.20.1070.10
af_P0AEX7_11_292_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.3469 63 188 1.10.3470.10
4u4wA02 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3366 48 249 1.20.1250.20
af_Q9P7R5_292_577_1.20.120.1900 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Gamma-tubulin complex, C-terminal domain 0.335 64 185 1.20.120.1900
1fewA00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.3132 104 247 1.20.58.70
ID Description Score Start End GO Terms
AF-A0A455V362-F1-model_v4 deleted 0.8989 63 197
AF-A0A379CZP5-F1-model_v4 deleted 0.8954 66 219
AF-A0A455V362-F1-model_v4 deleted 0.8808 63 197
AF-A0A349MHA8-F1-model_v4 Flagellar biosynthetic protein FliP 0.8777 54 205 GO:0005886
GO:0009306
AF-A0A349MHA8-F1-model_v4 Flagellar biosynthetic protein FliP 0.8672 54 205 GO:0005886
GO:0009306

Map