F336233

General Info

Members Datasets Scaffolds Average Seq Length
224 150 448 100

Family's Representative Sequence

Representative Sequence 3300002741|JGI25157J39369_1008760|JGI25157J39369_10087602
Length 100
Sequence VTILIAGTVRVPPENLDAFRPHMDAMLTASRAEDGCLTYSYAVDVQDPGLIRVFEAWRDQAAIDAHLKAPHMATWRASWPPLGVSDRRLSLYEVASERPL

Samples

Sample ID Description Type Environment
1 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
57 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
58 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
95 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
96 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
97 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
98 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
99 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
100 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
101 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
102 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
103 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
104 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
105 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
106 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
108 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
109 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
110 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
111 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
112 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
113 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
114 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
115 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
116 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
117 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
118 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
119 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
120 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
121 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
122 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
123 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
124 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
125 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
126 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
127 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
128 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
129 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
130 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
131 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
132 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
133 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
134 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
135 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
136 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
137 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
144 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
145 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
146 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
147 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
148 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
149 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
150 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0
Isolates 0.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.04
Nodule 0
Rhizoplane 4.46
Rhizosphere 83.93
Stem 0
Stem Tuber 0
Unclassified 0.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25157J39369_1008760 3300002741 Bacteria 1391
2 JGI25153J46596_10036241 3300003215 Bacteria 1585
3 Ga0055530_10004019 3300003791 Bacteria 7909
4 Ga0055531_10017869 3300003794 Bacteria 2964
5 Ga0055531_10025535 3300003794 Bacteria 2141
6 Ga0055543_1045327 3300004625 Bacteria 732
7 Ga0065165_1001146 3300005262 Bacteria 30997
8 Ga0070658_10128766 3300005327 Bacteria 2108
9 Ga0070658_10462612 3300005327 Bacteria 1094
10 Ga0068869_100647536 3300005334 Bacteria 897
11 Ga0070666_10519057 3300005335 Bacteria 865
12 Ga0070680_100022104 3300005336 Bacteria 5060
13 Ga0070660_100292799 3300005339 Bacteria 1333
14 Ga0070661_100479526 3300005344 Bacteria 993
15 Ga0070668_101251010 3300005347 Bacteria 674
16 Ga0070668_101367099 3300005347 Bacteria 645
17 Ga0070671_100011783 3300005355 Bacteria 7033
18 Ga0070671_100106975 3300005355 Bacteria 2348
19 Ga0070659_100061851 3300005366 Bacteria 2959
20 Ga0070711_101484731 3300005439 Unclassified 591
21 Ga0070678_100101532 3300005456 Bacteria 2230
22 Ga0070662_100156189 3300005457 Bacteria 1781
23 Ga0070681_10116667 3300005458 Bacteria 2606
24 Ga0070679_100055528 3300005530 Bacteria 3943
25 Ga0070679_101407331 3300005530 Bacteria 644
26 Ga0070684_102169745 3300005535 Bacteria 524
27 Ga0068853_100399947 3300005539 Bacteria 1285
28 Ga0068853_100774539 3300005539 Bacteria 918
29 Ga0068853_102215640 3300005539 Bacteria 533
30 Ga0070672_100325518 3300005543 Bacteria 1307
31 Ga0070665_100082101 3300005548 Bacteria 3228
32 Ga0068855_100106517 3300005563 Bacteria 3222
33 Ga0068855_100221263 3300005563 Bacteria 2122
34 Ga0068855_100311174 3300005563 Bacteria 1742
35 Ga0068855_100947668 3300005563 Bacteria 907
36 Ga0070664_100285215 3300005564 Bacteria 1490
37 Ga0068857_100927899 3300005577 Bacteria 836
38 Ga0068856_100459739 3300005614 Bacteria 1294
39 Ga0068856_100763155 3300005614 Bacteria 987
40 Ga0068856_102012893 3300005614 Bacteria 588
41 Ga0068852_100547126 3300005616 Bacteria 1158
42 Ga0068864_100066821 3300005618 Bacteria 3121
43 Ga0068864_100121979 3300005618 Bacteria 2331
44 Ga0068864_102242569 3300005618 Bacteria 552
45 Ga0068864_102544560 3300005618 Bacteria 518
46 Ga0068863_100137684 3300005841 Bacteria 2332
47 Ga0068863_100574919 3300005841 Bacteria 1114
48 Ga0068863_101109407 3300005841 Bacteria 796
49 Ga0068862_100461066 3300005844 Bacteria 1200
50 Ga0070717_10135778 3300006028 Bacteria 2118
51 Ga0070717_10849548 3300006028 Bacteria 831
52 Ga0075367_10685818 3300006178 Bacteria 652
53 Ga0097621_100219915 3300006237 Bacteria 1655
54 Ga0068865_100008574 3300006881 Bacteria 6320
55 Ga0105250_10481511 3300009092 Bacteria 561
56 Ga0105240_10013263 3300009093 Bacteria 11334
57 Ga0105240_11019065 3300009093 Bacteria 884
58 Ga0105245_11879428 3300009098 Bacteria 652
59 Ga0105243_10744752 3300009148 Bacteria 960
60 Ga0105241_10342747 3300009174 Bacteria 1295
61 Ga0105248_10090901 3300009177 Bacteria 3438
62 Ga0105248_10163588 3300009177 Bacteria 2509
63 Ga0105248_11087042 3300009177 Bacteria 904
64 Ga0105237_10263385 3300009545 Bacteria 1727
65 Ga0105237_11179378 3300009545 Bacteria 772
66 Ga0105238_10078642 3300009551 Bacteria 3288
67 Ga0105238_10132040 3300009551 Bacteria 2475
68 Ga0105238_10302975 3300009551 Bacteria 1582
69 Ga0105238_12141423 3300009551 Bacteria 594
70 Ga0105238_12228858 3300009551 Bacteria 583
71 Ga0105249_12149688 3300009553 Bacteria 631
72 Ga0105249_12177306 3300009553 Bacteria 627
73 Ga0105239_10250040 3300010375 Bacteria 1991
74 Ga0157369_10611275 3300013105 Bacteria 1125
75 Ga0157374_10372784 3300013296 Bacteria 1421
76 Ga0163162_10381080 3300013306 Bacteria 1543
77 Ga0163162_11868218 3300013306 Bacteria 687
78 Ga0157375_11322240 3300013308 Bacteria 848
79 Ga0157375_12312127 3300013308 Bacteria 641
80 Ga0163163_10040480 3300014325 Bacteria 4550
81 Ga0163163_10708937 3300014325 Bacteria 1070
82 Ga0157379_10374077 3300014968 Bacteria 1307
83 Ga0157376_11870014 3300014969 Bacteria 637
84 Ga0182007_10147761 3300015262 Bacteria 798
85 Ga0163161_10561301 3300017792 Bacteria 937
86 Ga0209026_1007564 3300025250 Bacteria 2421
87 Ga0209758_1001113 3300025297 Bacteria 34600
88 Ga0209050_1000053 3300025298 Bacteria 349521
89 Ga0209257_1000289 3300025304 Bacteria 110882
90 Ga0209257_1001380 3300025304 Bacteria 29130
91 Ga0209257_1002095 3300025304 Bacteria 20972
92 Ga0207705_10035781 3300025909 Bacteria 3552
93 Ga0207684_10792612 3300025910 Bacteria 801
94 Ga0207654_10105588 3300025911 Bacteria 1743
95 Ga0207707_10140325 3300025912 Bacteria 2113
96 Ga0207695_10188252 3300025913 Bacteria 1982
97 Ga0207695_10341816 3300025913 Bacteria 1384
98 Ga0207671_10880077 3300025914 Bacteria 708
99 Ga0207660_10015587 3300025917 Bacteria 5018
100 Ga0207657_10021595 3300025919 Bacteria 6053
101 Ga0207652_10100222 3300025921 Bacteria 2557
102 Ga0207652_10946472 3300025921 Bacteria 759
103 Ga0207681_10555765 3300025923 Bacteria 945
104 Ga0207694_10093486 3300025924 Bacteria 2375
105 Ga0207694_10466305 3300025924 Bacteria 1055
106 Ga0207644_10020336 3300025931 Bacteria 4513
107 Ga0207644_10384934 3300025931 Bacteria 1144
108 Ga0207644_10541094 3300025931 Bacteria 963
109 Ga0207690_10038838 3300025932 Bacteria 3101
110 Ga0207706_10178430 3300025933 Bacteria 1865
111 Ga0207709_10392048 3300025935 Bacteria 1059
112 Ga0207704_10002161 3300025938 Bacteria 8809
113 Ga0207691_11601532 3300025940 Bacteria 530
114 Ga0207711_10053881 3300025941 Bacteria 3450
115 Ga0207711_10119990 3300025941 Bacteria 2347
116 Ga0207711_10887135 3300025941 Bacteria 829
117 Ga0207689_10908184 3300025942 Bacteria 743
118 Ga0207661_10402235 3300025944 Bacteria 1242
119 Ga0207667_10189380 3300025949 Bacteria 2111
120 Ga0207667_10203085 3300025949 Bacteria 2033
121 Ga0207667_10220953 3300025949 Bacteria 1941
122 Ga0207667_11087312 3300025949 Bacteria 783
123 Ga0207712_11033623 3300025961 Bacteria 730
124 Ga0207668_11419830 3300025972 Bacteria 626
125 Ga0207658_10329480 3300025986 Bacteria 1324
126 Ga0207639_10044573 3300026041 Bacteria 3336
127 Ga0207639_10879390 3300026041 Bacteria 837
128 Ga0207641_10340540 3300026088 Bacteria 1427
129 Ga0207641_10405177 3300026088 Bacteria 1310
130 Ga0207641_11741275 3300026088 Bacteria 625
131 Ga0207641_11877411 3300026088 Bacteria 601
132 Ga0207676_10014370 3300026095 Bacteria 5694
133 Ga0207676_10258403 3300026095 Bacteria 1571
134 Ga0207676_11073986 3300026095 Bacteria 795
135 Ga0207676_11462588 3300026095 Bacteria 680
136 Ga0207676_11770306 3300026095 Bacteria 616
137 Ga0207674_10565421 3300026116 Bacteria 1098
138 Ga0207675_101321860 3300026118 Bacteria 741
139 Ga0207683_10070840 3300026121 Bacteria 3081
140 Ga0207698_10415319 3300026142 Bacteria 1290
141 Ga0207698_12719357 3300026142 Bacteria 503
142 Ga0268266_10883459 3300028379 Bacteria 864
143 Ga0268265_10923156 3300028380 Bacteria 858
144 Ga0268264_11956665 3300028381 Bacteria 596
145 Ga0307517_10003229 3300028786 Bacteria 25559
146 Ga0265327_10008064 3300031251 Bacteria 7939
147 Ga0307513_10003498 3300031456 Bacteria 21262
148 Ga0307513_10018717 3300031456 Bacteria 8270
149 Ga0307408_102469455 3300031548 Bacteria 505
150 Ga0307405_10818366 3300031731 Bacteria 782
151 Ga0307410_10781517 3300031852 Bacteria 811
152 Ga0307412_11041702 3300031911 Bacteria 725
153 Ga0307414_10126350 3300032004 Bacteria 1976
154 Ga0307414_11853219 3300032004 Bacteria 563
155 Ga0307411_11104865 3300032005 Bacteria 715
156 Ga0307510_10260739 3300033180 Bacteria 1215
157 Ga0307510_10422645 3300033180 Bacteria 775
158 Ga0373941_0097386 3300035115 Bacteria 1019
159 Ga0373931_0095501 3300035691 Bacteria 1664
160 Ga0373925_0822748 3300037068 Bacteria 765
161 Ga0395905_0110790 3300037471 Bacteria 2578
162 Ga0395905_0826012 3300037471 Bacteria 830
163 Ga0395905_0894416 3300037471 Bacteria 791
164 Ga0466961_0736338 3300044693 Bacteria 590
165 Ga0453684_0289678 3300044712 Bacteria 1865
166 Ga0495584_0422273 3300046491 Bacteria 678
167 Ga0495583_0083815 3300046506 Bacteria 1382
168 Ga0495583_0137904 3300046506 Bacteria 1017
169 Ga0495583_0415724 3300046506 Bacteria 528
170 Ga0495606_0108703 3300046507 Bacteria 1676
171 Ga0495663_0071789 3300046525 Bacteria 1103
172 Ga0495642_0001388 3300046528 Bacteria 10837
173 Ga0495642_0033692 3300046528 Bacteria 2060
174 Ga0495621_0106254 3300046539 Bacteria 1073
175 Ga0495597_0178461 3300046542 Bacteria 859
176 Ga0495597_0380923 3300046542 Archaea 538
177 Ga0495645_0221039 3300046543 Bacteria 1274
178 Ga0495668_0056136 3300046616 Bacteria 2174
179 Ga0495668_0110838 3300046616 Bacteria 1501
180 Ga0495668_0211121 3300046616 Bacteria 1063
181 Ga0495668_0364610 3300046616 Bacteria 793
182 Ga0495668_0585223 3300046616 Bacteria 616
183 Ga0495611_0006648 3300046648 Bacteria 4922
184 Ga0495625_0151785 3300046660 Bacteria 1557
185 Ga0495625_0356381 3300046660 Bacteria 923
186 Ga0495625_0558377 3300046660 Bacteria 692
187 Ga0495658_0772233 3300046683 Bacteria 615
188 Ga0495669_0035672 3300046684 Bacteria 2196
189 Ga0495669_0325128 3300046684 Bacteria 742
190 Ga0495669_0330665 3300046684 Bacteria 736
191 Ga0495636_0402691 3300047318 Bacteria 652
192 Ga0495672_0021838 3300047320 Bacteria 4169
193 Ga0495677_0135228 3300047445 Bacteria 945
194 Ga0495681_0201833 3300047470 Bacteria 806
195 Ga0495686_0004746 3300047472 Bacteria 10998
196 Ga0495686_0291783 3300047472 Bacteria 903
197 Ga0496100_0244703 3300048903 Bacteria 1325
198 Ga0496101_0063927 3300048904 Bacteria 2680
199 Ga0496104_0517517 3300048907 Bacteria 1104
200 Ga0496106_0241048 3300048909 Bacteria 1445
201 Ga0496107_0182197 3300048910 Bacteria 1560
202 Ga0496108_0602570 3300048911 Bacteria 957
203 Ga0496109_0208594 3300048912 Bacteria 1837
204 Ga0496112_0094507 3300048915 Bacteria 2960
205 Ga0496112_0634888 3300048915 Bacteria 998
206 Ga0496113_1149447 3300048916 Bacteria 608
207 Ga0501033_0239490 3300049570 Bacteria 1287
208 Ga0501033_0744952 3300049570 Bacteria 665
209 Ga0501033_0877882 3300049570 Bacteria 604
210 Ga0501036_0885264 3300049572 Unclassified 733
211 Ga0501038_0429889 3300049574 Bacteria 1018
212 Ga0501043_0612778 3300049579 Bacteria 803
213 Ga0501047_0235151 3300049581 Bacteria 1684
214 Ga0501047_0675296 3300049581 Bacteria 851
215 Ga0501035_0068425 3300049822 Bacteria 3149
216 Ga0501044_0005108 3300049823 Bacteria 14635
217 Ga0501044_0703330 3300049823 Bacteria 896
218 nmdc:mga06z11_774872_c1 3300050494 Bacteria 584
219 Ga0500610_0388541 3300053079 Bacteria 573
220 Ga0500555_103357 3300053103 Bacteria 722
221 Ga0500595_059546 3300053119 Bacteria 1158
222 Ga0500608_065231 3300053122 Bacteria 1737
223 Ga0500645_006959 3300053730 Bacteria 3983
224 2644001005 2643221598 Bacteria 4578346
225 JGI25157J39369_1008760
226 JGI25153J46596_10036241
227 Ga0055530_10004019
228 Ga0055531_10017869
229 Ga0055531_10025535
230 Ga0055543_1045327
231 Ga0065165_1001146
232 Ga0070658_10128766
233 Ga0070658_10462612
234 Ga0068869_100647536
235 Ga0070666_10519057
236 Ga0070680_100022104
237 Ga0070660_100292799
238 Ga0070661_100479526
239 Ga0070668_101251010
240 Ga0070668_101367099
241 Ga0070671_100011783
242 Ga0070671_100106975
243 Ga0070659_100061851
244 Ga0070711_101484731
245 Ga0070678_100101532
246 Ga0070662_100156189
247 Ga0070681_10116667
248 Ga0070679_100055528
249 Ga0070679_101407331
250 Ga0070684_102169745
251 Ga0068853_100399947
252 Ga0068853_100774539
253 Ga0068853_102215640
254 Ga0070672_100325518
255 Ga0070665_100082101
256 Ga0068855_100106517
257 Ga0068855_100221263
258 Ga0068855_100311174
259 Ga0068855_100947668
260 Ga0070664_100285215
261 Ga0068857_100927899
262 Ga0068856_100459739
263 Ga0068856_100763155
264 Ga0068856_102012893
265 Ga0068852_100547126
266 Ga0068864_100066821
267 Ga0068864_100121979
268 Ga0068864_102242569
269 Ga0068864_102544560
270 Ga0068863_100137684
271 Ga0068863_100574919
272 Ga0068863_101109407
273 Ga0068862_100461066
274 Ga0070717_10135778
275 Ga0070717_10849548
276 Ga0075367_10685818
277 Ga0097621_100219915
278 Ga0068865_100008574
279 Ga0105250_10481511
280 Ga0105240_10013263
281 Ga0105240_11019065
282 Ga0105245_11879428
283 Ga0105243_10744752
284 Ga0105241_10342747
285 Ga0105248_10090901
286 Ga0105248_10163588
287 Ga0105248_11087042
288 Ga0105237_10263385
289 Ga0105237_11179378
290 Ga0105238_10078642
291 Ga0105238_10132040
292 Ga0105238_10302975
293 Ga0105238_12141423
294 Ga0105238_12228858
295 Ga0105249_12149688
296 Ga0105249_12177306
297 Ga0105239_10250040
298 Ga0157369_10611275
299 Ga0157374_10372784
300 Ga0163162_10381080
301 Ga0163162_11868218
302 Ga0157375_11322240
303 Ga0157375_12312127
304 Ga0163163_10040480
305 Ga0163163_10708937
306 Ga0157379_10374077
307 Ga0157376_11870014
308 Ga0182007_10147761
309 Ga0163161_10561301
310 Ga0209026_1007564
311 Ga0209758_1001113
312 Ga0209050_1000053
313 Ga0209257_1000289
314 Ga0209257_1001380
315 Ga0209257_1002095
316 Ga0207705_10035781
317 Ga0207684_10792612
318 Ga0207654_10105588
319 Ga0207707_10140325
320 Ga0207695_10188252
321 Ga0207695_10341816
322 Ga0207671_10880077
323 Ga0207660_10015587
324 Ga0207657_10021595
325 Ga0207652_10100222
326 Ga0207652_10946472
327 Ga0207681_10555765
328 Ga0207694_10093486
329 Ga0207694_10466305
330 Ga0207644_10020336
331 Ga0207644_10384934
332 Ga0207644_10541094
333 Ga0207690_10038838
334 Ga0207706_10178430
335 Ga0207709_10392048
336 Ga0207704_10002161
337 Ga0207691_11601532
338 Ga0207711_10053881
339 Ga0207711_10119990
340 Ga0207711_10887135
341 Ga0207689_10908184
342 Ga0207661_10402235
343 Ga0207667_10189380
344 Ga0207667_10203085
345 Ga0207667_10220953
346 Ga0207667_11087312
347 Ga0207712_11033623
348 Ga0207668_11419830
349 Ga0207658_10329480
350 Ga0207639_10044573
351 Ga0207639_10879390
352 Ga0207641_10340540
353 Ga0207641_10405177
354 Ga0207641_11741275
355 Ga0207641_11877411
356 Ga0207676_10014370
357 Ga0207676_10258403
358 Ga0207676_11073986
359 Ga0207676_11462588
360 Ga0207676_11770306
361 Ga0207674_10565421
362 Ga0207675_101321860
363 Ga0207683_10070840
364 Ga0207698_10415319
365 Ga0207698_12719357
366 Ga0268266_10883459
367 Ga0268265_10923156
368 Ga0268264_11956665
369 Ga0307517_10003229
370 Ga0265327_10008064
371 Ga0307513_10003498
372 Ga0307513_10018717
373 Ga0307408_102469455
374 Ga0307405_10818366
375 Ga0307410_10781517
376 Ga0307412_11041702
377 Ga0307414_10126350
378 Ga0307414_11853219
379 Ga0307411_11104865
380 Ga0307510_10260739
381 Ga0307510_10422645
382 Ga0373941_0097386
383 Ga0373931_0095501
384 Ga0373925_0822748
385 Ga0395905_0110790
386 Ga0395905_0826012
387 Ga0395905_0894416
388 Ga0466961_0736338
389 Ga0453684_0289678
390 Ga0495584_0422273
391 Ga0495583_0083815
392 Ga0495583_0137904
393 Ga0495583_0415724
394 Ga0495606_0108703
395 Ga0495663_0071789
396 Ga0495642_0001388
397 Ga0495642_0033692
398 Ga0495621_0106254
399 Ga0495597_0178461
400 Ga0495597_0380923
401 Ga0495645_0221039
402 Ga0495668_0056136
403 Ga0495668_0110838
404 Ga0495668_0211121
405 Ga0495668_0364610
406 Ga0495668_0585223
407 Ga0495611_0006648
408 Ga0495625_0151785
409 Ga0495625_0356381
410 Ga0495625_0558377
411 Ga0495658_0772233
412 Ga0495669_0035672
413 Ga0495669_0325128
414 Ga0495669_0330665
415 Ga0495636_0402691
416 Ga0495672_0021838
417 Ga0495677_0135228
418 Ga0495681_0201833
419 Ga0495686_0004746
420 Ga0495686_0291783
421 Ga0496100_0244703
422 Ga0496101_0063927
423 Ga0496104_0517517
424 Ga0496106_0241048
425 Ga0496107_0182197
426 Ga0496108_0602570
427 Ga0496109_0208594
428 Ga0496112_0094507
429 Ga0496112_0634888
430 Ga0496113_1149447
431 Ga0501033_0239490
432 Ga0501033_0744952
433 Ga0501033_0877882
434 Ga0501036_0885264
435 Ga0501038_0429889
436 Ga0501043_0612778
437 Ga0501047_0235151
438 Ga0501047_0675296
439 Ga0501035_0068425
440 Ga0501044_0005108
441 Ga0501044_0703330
442 nmdc:mga06z11_774872_c1
443 Ga0500610_0388541
444 Ga0500555_103357
445 Ga0500595_059546
446 Ga0500608_065231
447 Ga0500645_006959
448 2644001005

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03992

ABM

Antibiotic biosynthesis monooxygenase

2

78

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e8o-assembly1.cif.gz_B crystal structure of a putative antibiotic biosynthesis monooxygenase (dr_2100) from deinococcus radiodurans at 1.40 a resolution 0.9195 1 100
3f44-assembly1.cif.gz_A crystal structure of putative monooxygenase (yp_193413.1) from lactobacillus acidophilus ncfm at 1.55 a resolution 0.9141 2 91
4zos-assembly2.cif.gz_B 2.20 angstrom resolution crystal structure of protein ye0340 of unidentified function from yersinia enterocolitica subsp. enterocolitica 8081] 0.9123 2 96
4dpo-assembly1.cif.gz_B crystal structure of a conserved protein mm_1583 from methanosarcina mazei go1 0.9097 1 92
3e8o-assembly1.cif.gz_B crystal structure of a putative antibiotic biosynthesis monooxygenase (dr_2100) from deinococcus radiodurans at 1.40 a resolution 0.9024 1 100
ID Description Score Start End Superfamily
af_Q55CR9_1_97_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9363 2 94 3.30.70.100
3e8oA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9277 1 98 3.30.70.100
4zosB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9123 2 96 3.30.70.100
2fb0A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9108 2 94 3.30.70.100
af_Q8BG18_205_343_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9051 2 92 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A4Q6G9I4-F1-model_v4 deleted 0.9943 3 100
AF-A0A328AW54-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.994 1 100 GO:0004497
AF-A0A6I4TV54-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.9876 1 100 GO:0004497
AF-A0A1B3N5Z4-F1-model_v4 Antibiotic biosynthesis monooxygenase family protein 0.9845 3 100 GO:0004497
AF-A0A2T5VIE6-F1-model_v4 Quinol monooxygenase YgiN 0.984 2 100 GO:0004497

Map