F335795

General Info

Members Datasets Scaffolds Average Seq Length
223 170 171 180

Family's Representative Sequence

Representative Sequence 3300035170|Ga0373943_0097753|Ga0373943_0097753_352_996
Length 214
Sequence LFVSIKIRRSVDIIGPQRRNGMPGAGVEAKMEGCAMLPAIRLVSEAAEFAARRHTGTARKARPDEPYINHLAEVANLLAFATDGADAELVAAGWLHDTVEDTETTREELAQKFGERVASLVVEVTDDMNLSQTERRQRQVEDAPHKSPGAKLIKIADKISNIRARIVPNPAQAQRSDLVAYAIWAEKVVAGCRGVNARLDAKFDETVEAARRLF

Samples

Sample ID Description Type Environment
1 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
2 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
3 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
4 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
5 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
6 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
7 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
8 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
9 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
10 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
11 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
12 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
13 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
14 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
15 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
16 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
17 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
18 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
19 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
20 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
21 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
22 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
23 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
24 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
25 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
26 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
27 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
28 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
29 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
30 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
31 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
32 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
33 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
34 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
35 2922425934
36 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
37 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
38 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
39 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
40 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
41 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
43 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
44 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
46 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
47 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
48 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
49 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
50 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
51 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
73 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
83 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
84 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
85 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
86 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
87 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
88 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
90 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
92 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
105 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
106 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
107 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
108 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
109 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
110 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
115 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
118 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
119 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
120 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
121 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
122 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
123 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
124 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
125 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
126 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
127 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
128 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
129 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
130 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
131 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
132 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
135 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
136 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
137 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
140 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
141 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
142 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
143 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
144 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
145 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
146 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
147 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
148 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
149 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
150 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
151 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
152 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
153 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
154 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
155 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
156 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
157 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
158 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
159 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
160 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
161 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
162 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
163 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
164 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
165 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
166 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
167 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
168 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
169 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
170 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 77.03
Metatranscriptomes 0
Isolates 22.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.25
Nodule 17.04
Rhizoplane 4.04
Rhizosphere 44.39
Stem 0
Stem Tuber 0
Unclassified 19.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10005214 3300003203 Bacteria 6025
2 JGI25153J46596_10000982 3300003215 Bacteria 17303
3 JGI25153J46596_10091294 3300003215 Bacteria 735
4 JGI25160J50197_1002442 3300003354 Bacteria 8653
5 JGI25404J52841_10007314 3300003659 Bacteria 2334
6 JGI25404J52841_10010047 3300003659 Bacteria 2032
7 Ga0070680_100847702 3300005336 Bacteria 788
8 Ga0070682_100054931 3300005337 Bacteria 2500
9 Ga0070709_10158230 3300005434 Bacteria 1573
10 Ga0070714_100391595 3300005435 Bacteria 1312
11 Ga0070713_100252279 3300005436 Bacteria 1610
12 Ga0070710_10369011 3300005437 Bacteria 955
13 Ga0070711_100015684 3300005439 Bacteria 4797
14 Ga0070711_100371249 3300005439 Bacteria 1154
15 Ga0070663_100329233 3300005455 Bacteria 1231
16 Ga0070678_100282241 3300005456 Bacteria 1405
17 Ga0070681_10004041 3300005458 Bacteria 13846
18 Ga0070681_10363382 3300005458 Bacteria 1358
19 Ga0070706_100841087 3300005467 Bacteria 849
20 Ga0070679_100238290 3300005530 Bacteria 1777
21 Ga0070679_100619179 3300005530 Bacteria 1026
22 Ga0070684_101559599 3300005535 Bacteria 623
23 Ga0068853_100075256 3300005539 Bacteria 2947
24 Ga0068853_100090489 3300005539 Bacteria 2689
25 Ga0070665_100548895 3300005548 Bacteria 1168
26 Ga0070665_100680824 3300005548 Bacteria 1041
27 Ga0068855_100282208 3300005563 Bacteria 1844
28 Ga0068855_100422563 3300005563 Bacteria 1458
29 Ga0068855_101107061 3300005563 Bacteria 828
30 Ga0068854_100467400 3300005578 Bacteria 1057
31 Ga0068854_100647796 3300005578 Bacteria 907
32 Ga0081455_10049153 3300005937 Bacteria 3638
33 Ga0081538_10189811 3300005981 Bacteria 864
34 Ga0081540_1003754 3300005983 Bacteria 11903
35 Ga0081540_1004532 3300005983 Bacteria 10538
36 Ga0081539_10002647 3300005985 Bacteria 24446
37 Ga0081539_10003011 3300005985 Bacteria 21952
38 Ga0075365_10137621 3300006038 Bacteria 1693
39 Ga0075368_10113864 3300006042 Bacteria 1116
40 Ga0075364_10133753 3300006051 Bacteria 1665
41 Ga0075367_10391255 3300006178 Bacteria 879
42 Ga0075369_10028654 3300006186 Bacteria 2335
43 Ga0075369_10070158 3300006186 Bacteria 1541
44 Ga0075369_10308158 3300006186 Bacteria 740
45 Ga0075370_10147359 3300006353 Bacteria 1378
46 Ga0075370_10399006 3300006353 Bacteria 825
47 Ga0099824_1016714 3300006942 Bacteria 6575
48 Ga0099822_1011448 3300006943 Bacteria 10808
49 Ga0075435_100717883 3300007076 Bacteria 869
50 Ga0099795_10100177 3300007788 Bacteria 1135
51 Ga0105243_11426115 3300009148 Bacteria 714
52 Ga0105243_11575515 3300009148 Bacteria 683
53 Ga0105237_10823418 3300009545 Bacteria 935
54 Ga0105238_10126724 3300009551 Bacteria 2531
55 Ga0105238_11041844 3300009551 Bacteria 840
56 Ga0105239_10837028 3300010375 Bacteria 1055
57 Ga0105239_11254509 3300010375 Bacteria 855
58 Ga0157374_10723531 3300013296 Bacteria 1009
59 Ga0163161_10591064 3300017792 Bacteria 914
60 Ga0214544_1000011 3300021320 Bacteria 262952
61 Ga0214542_1000009 3300021321 Bacteria 262861
62 Ga0214545_1000007 3300021324 Bacteria 262984
63 Ga0214543_1000020 3300021327 Bacteria 262861
64 Ga0213876_10028107 3300021384 Bacteria 2965
65 Ga0213876_10043394 3300021384 Bacteria 2377
66 Ga0213876_10345630 3300021384 Bacteria 791
67 Ga0213875_10169733 3300021388 Bacteria 1024
68 Ga0209677_103245 3300025253 Bacteria 5419
69 Ga0209233_1009331 3300025261 Bacteria 2991
70 Ga0209233_1012034 3300025261 Bacteria 2524
71 Ga0209455_1004816 3300025272 Bacteria 4312
72 Ga0209455_1013650 3300025272 Bacteria 1875
73 Ga0209758_1000536 3300025297 Bacteria 60374
74 Ga0209758_1049940 3300025297 Bacteria 1471
75 Ga0207426_1000870 3300025302 Bacteria 31492
76 Ga0207426_1075396 3300025302 Bacteria 928
77 Ga0207707_10002136 3300025912 Bacteria 17901
78 Ga0207663_10011272 3300025916 Bacteria 4796
79 Ga0207663_10531558 3300025916 Bacteria 917
80 Ga0207649_10051399 3300025920 Bacteria 2552
81 Ga0207652_10478196 3300025921 Bacteria 1122
82 Ga0207694_10085754 3300025924 Bacteria 2479
83 Ga0207700_10202555 3300025928 Bacteria 1673
84 Ga0207700_10206514 3300025928 Bacteria 1658
85 Ga0207667_10968014 3300025949 Bacteria 840
86 Ga0207640_10329475 3300025981 Bacteria 1219
87 Ga0207639_10346786 3300026041 Bacteria 1325
88 Ga0207639_10398907 3300026041 Bacteria 1239
89 Ga0207639_10508030 3300026041 Bacteria 1102
90 Ga0207678_10347399 3300026067 Bacteria 1279
91 Ga0207678_10825146 3300026067 Bacteria 819
92 Ga0207683_10207056 3300026121 Bacteria 1784
93 Ga0209589_1000055 3300027357 Bacteria 111890
94 Ga0209489_100128 3300027361 Bacteria 111890
95 Ga0209700_100137 3300027363 Bacteria 111890
96 Ga0373943_0097753 3300035170 Bacteria 1530
97 Ga0373946_0030184 3300035171 Bacteria 2163
98 Ga0373927_0013512 3300035695 Bacteria 5425
99 Ga0373927_0284479 3300035695 Bacteria 1088
100 Ga0373947_0092885 3300035725 Bacteria 1885
101 Ga0373925_0198898 3300037068 Bacteria 1593
102 Ga0395900_0119722 3300037418 Bacteria 2702
103 Ga0395900_0376852 3300037418 Bacteria 1388
104 Ga0395898_0035453 3300037466 Bacteria 4961
105 Ga0395905_0001273 3300037471 Bacteria 31107
106 Ga0436364_0707013 3300037853 Bacteria 1842
107 Ga0436364_1382664 3300037853 Bacteria 2494
108 Ga0395901_0219096 3300038443 Bacteria 1990
109 Ga0395901_0309075 3300038443 Bacteria 1638
110 Ga0395901_0315658 3300038443 Bacteria 1618
111 Ga0436365_0083620 3300039437 Bacteria 998
112 Ga0436365_0352896 3300039437 Bacteria 681
113 Ga0436365_0360280 3300039437 Bacteria 2717
114 Ga0436365_0999855 3300039437 Bacteria 625
115 Ga0436365_1843787 3300039437 Bacteria 897
116 Ga0436365_1912355 3300039437 Bacteria 4392
117 Ga0439465_0057529 3300041413 Bacteria 1283
118 Ga0439465_0124183 3300041413 Bacteria 907
119 Ga0451793_1006818 3300041452 Bacteria 848
120 Ga0451802_1154034 3300041460 Bacteria 711
121 Ga0451845_0067159 3300041501 Bacteria 649
122 Ga0439459_0150408 3300042438 Bacteria 608
123 Ga0466969_0112289 3300044656 Bacteria 1274
124 Ga0466969_0176013 3300044656 Bacteria 980
125 Ga0466972_0000053 3300044658 Bacteria 112876
126 Ga0466972_0034849 3300044658 Bacteria 2464
127 Ga0466966_0003689 3300044684 Bacteria 10107
128 Ga0466966_0243483 3300044684 Bacteria 1084
129 Ga0466961_0004648 3300044693 Bacteria 8621
130 Ga0466963_0142159 3300044694 Bacteria 1663
131 Ga0466963_0458847 3300044694 Bacteria 899
132 Ga0466971_0366138 3300044719 Bacteria 699
133 Ga0466968_0001220 3300044735 Bacteria 9109
134 Ga0466968_0111876 3300044735 Bacteria 1228
135 Ga0466957_0196184 3300044842 Bacteria 1324
136 Ga0466957_0501622 3300044842 Bacteria 841
137 Ga0466959_0002926 3300045049 Bacteria 11013
138 Ga0466958_0384284 3300045836 Bacteria 905
139 Ga0466967_0083274 3300045976 Bacteria 2892
140 Ga0466967_0128976 3300045976 Bacteria 2346
141 Ga0495603_0073664 3300046455 Bacteria 2006
142 Ga0495582_0482368 3300046473 Bacteria 716
143 Ga0495656_0369100 3300046615 Bacteria 746
144 Ga0495624_0205698 3300046690 Bacteria 1195
145 Ga0496102_0642850 3300048905 Bacteria 984
146 Ga0496103_0246749 3300048906 Bacteria 1149
147 Ga0496106_0134789 3300048909 Bacteria 1939
148 Ga0496107_0427423 3300048910 Bacteria 985
149 Ga0496115_0102867 3300048918 Bacteria 2343
150 Ga0496115_0182918 3300048918 Bacteria 1732
151 Ga0496121_0033653 3300048924 Bacteria 4633
152 Ga0496122_0072304 3300048925 Bacteria 2453
153 Ga0496123_0120766 3300048926 Bacteria 1475
154 Ga0496125_0111301 3300048928 Bacteria 1982
155 Ga0496126_0007369 3300048929 Bacteria 12071
156 Ga0496126_0009937 3300048929 Bacteria 10047
157 Ga0496126_0555454 3300048929 Bacteria 910
158 Ga0496126_0980077 3300048929 Bacteria 636
159 nmdc:mga00v17_91569_c1 3300050491 Bacteria 1910
160 nmdc:mga0yw44_289200_c1 3300050492 Bacteria 1096
161 nmdc:mga0yw44_849879_c1 3300050492 Bacteria 619
162 nmdc:mga04h51_232246_c1 3300050495 Bacteria 734
163 nmdc:mga07m45_271386_c1 3300050496 Bacteria 987
164 nmdc:mga07m45_396360_c1 3300050496 Bacteria 801
165 nmdc:mga0sz30_58114_c1 3300050516 Bacteria 1649
166 Ga0500647_0035653 3300053091 Bacteria 2378
167 Ga0500651_0182157 3300053093 Bacteria 1247
168 Ga0500557_000032 3300053105 Bacteria 74032
169 Ga0500595_013294 3300053119 Bacteria 3156
170 Ga0500642_0000197 3300053130 Bacteria 24598
171 Ga0500601_013768 3300053737 Bacteria 916

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 8056689827 8056696088 173
2 iso_pu_bacteria 2513237092 2513624883 175
3 iso_pu_bacteria 2513237096 2513657510 175
4 iso_pu_bacteria 2513237098 2513674986 175
5 iso_pu_bacteria 2513237145 2513916763 175
6 iso_pu_bacteria 2513237161 2514014566 175
7 iso_pu_bacteria 2517093001 2517103159 175
8 iso_pu_bacteria 2617270741 2617374778 175
9 iso_pu_bacteria 2667528175 2671119523 175
10 iso_pu_bacteria 2728368998 2728755315 175
11 iso_pu_bacteria 2824671348 2824674057 175
12 iso_pu_bacteria 2824679649 2824685798 175
13 iso_pu_bacteria 2824687955 2824690723 175
14 iso_pu_bacteria 2824704595 2824709139 175
15 iso_pu_bacteria 2824732956 2824738527 175
16 iso_pu_bacteria 2824746037 2824753121 175
17 iso_pu_bacteria 2824753945 2824760315 175
18 iso_pu_bacteria 2824763712 2824772345 175
19 iso_pu_bacteria 2838122688 2838125036 175
20 iso_pu_bacteria 2841941048 2841945775 175
21 iso_pu_bacteria 2841949485 2841956874 175
22 iso_pu_bacteria 2841957949 2841964000 175
23 iso_pu_bacteria 2841983080 2841989454 175
24 iso_pu_bacteria 2849076700 2849082132 175
25 iso_pu_bacteria 2857509624 2857513390 175
26 iso_pu_bacteria 2874628541 2874633434 175
27 iso_pu_bacteria 2885374607 2885380847 175
28 iso_pu_bacteria 2885383462 2885391648 175
29 iso_pu_bacteria 2903768456 2903774764 175
30 iso_pu_bacteria 2904711408 2904719763 175
31 iso_pu_bacteria 2906635258 2906641943 175
32 iso_pu_bacteria 2906660503 2906660971 175
33 iso_pu_bacteria 2908775508 2908777259 175
34 iso_pu_bacteria 2922393267 2922398458 175
35 iso_pu_bacteria 2922425934 2922426510 175
36 iso_pu_bacteria 2935777560 2935777709 175
37 iso_pu_bacteria 3005483717 3005491121 175
38 iso_pu_bacteria 3005506211 3005510963 175
39 iso_pu_bacteria 3005587118 3005592124 175
40 iso_pu_bacteria 8006933436 8006937169 175
41 iso_pu_bacteria 8006973647 8006977179 175
42 iso_pu_bacteria 8016603502 8016605627 175
43 iso_pu_bacteria 8016613128 8016617542 175
44 iso_pu_bacteria 8016622563 8016624029 175
45 iso_pu_bacteria 8019538911 8019539604 175
46 iso_pu_bacteria 8019547302 8019551053 175
47 iso_pu_bacteria 8019555841 8019561489 175
48 iso_pu_bacteria 8019565922 8019571564 175
49 iso_pu_bacteria 8056681323 8056681664 175
50 3300025272 Ga0209455_1004816 Ga0209455_10048162 177
51 3300044694 Ga0466963_0458847 Ga0466963_0458847_15_560 177
52 3300045976 Ga0466967_0128976 Ga0466967_0128976_781_1326 177
53 3300005455 Ga0070663_100329233 Ga0070663_1003292332 178
54 3300005539 Ga0068853_100090489 Ga0068853_1000904895 178
55 3300010375 Ga0105239_10837028 Ga0105239_108370282 178
56 3300025920 Ga0207649_10051399 Ga0207649_100513995 178
57 3300026041 Ga0207639_10346786 Ga0207639_103467863 178
58 3300026067 Ga0207678_10347399 Ga0207678_103473992 178
59 3300003203 JGI25406J46586_10005214 JGI25406J46586_100052146 179
60 3300003215 JGI25153J46596_10000982 JGI25153J46596_1000098216 179
61 3300003215 JGI25153J46596_10091294 JGI25153J46596_100912941 179
62 3300003354 JGI25160J50197_1002442 JGI25160J50197_10024426 179
63 3300003659 JGI25404J52841_10007314 JGI25404J52841_100073143 179
64 3300003659 JGI25404J52841_10010047 JGI25404J52841_100100471 179
65 3300005336 Ga0070680_100847702 Ga0070680_1008477022 179
66 3300005337 Ga0070682_100054931 Ga0070682_1000549314 179
67 3300005434 Ga0070709_10158230 Ga0070709_101582302 179
68 3300005435 Ga0070714_100391595 Ga0070714_1003915952 179
69 3300005436 Ga0070713_100252279 Ga0070713_1002522792 179
70 3300005437 Ga0070710_10369011 Ga0070710_103690112 179
71 3300005439 Ga0070711_100015684 Ga0070711_1000156846 179
72 3300005439 Ga0070711_100371249 Ga0070711_1003712492 179
73 3300005456 Ga0070678_100282241 Ga0070678_1002822413 179
74 3300005458 Ga0070681_10004041 Ga0070681_1000404117 179
75 3300005458 Ga0070681_10363382 Ga0070681_103633822 179
76 3300005467 Ga0070706_100841087 Ga0070706_1008410871 179
77 3300005530 Ga0070679_100238290 Ga0070679_1002382903 179
78 3300005530 Ga0070679_100619179 Ga0070679_1006191791 179
79 3300005535 Ga0070684_101559599 Ga0070684_1015595991 179
80 3300005539 Ga0068853_100075256 Ga0068853_1000752565 179
81 3300005548 Ga0070665_100548895 Ga0070665_1005488953 179
82 3300005548 Ga0070665_100680824 Ga0070665_1006808242 179
83 3300005563 Ga0068855_100282208 Ga0068855_1002822082 179
84 3300005563 Ga0068855_100422563 Ga0068855_1004225633 179
85 3300005563 Ga0068855_101107061 Ga0068855_1011070612 179
86 3300005578 Ga0068854_100467400 Ga0068854_1004674002 179
87 3300005578 Ga0068854_100647796 Ga0068854_1006477962 179
88 3300005937 Ga0081455_10049153 Ga0081455_100491533 179
89 3300005981 Ga0081538_10189811 Ga0081538_101898111 179
90 3300005983 Ga0081540_1003754 Ga0081540_100375412 179
91 3300005983 Ga0081540_1004532 Ga0081540_100453212 179
92 3300005985 Ga0081539_10002647 Ga0081539_100026474 179
93 3300005985 Ga0081539_10003011 Ga0081539_1000301125 179
94 3300006038 Ga0075365_10137621 Ga0075365_101376213 179
95 3300006042 Ga0075368_10113864 Ga0075368_101138641 179
96 3300006051 Ga0075364_10133753 Ga0075364_101337533 179
97 3300006178 Ga0075367_10391255 Ga0075367_103912552 179
98 3300006186 Ga0075369_10028654 Ga0075369_100286546 179
99 3300006186 Ga0075369_10070158 Ga0075369_100701581 179
100 3300006186 Ga0075369_10308158 Ga0075369_103081582 179
101 3300006353 Ga0075370_10147359 Ga0075370_101473592 179
102 3300006353 Ga0075370_10399006 Ga0075370_103990062 179
103 3300006942 Ga0099824_1016714 Ga0099824_10167146 179
104 3300006943 Ga0099822_1011448 Ga0099822_10114489 179
105 3300007076 Ga0075435_100717883 Ga0075435_1007178832 179
106 3300007788 Ga0099795_10100177 Ga0099795_101001772 179
107 3300009148 Ga0105243_11426115 Ga0105243_114261151 179
108 3300009148 Ga0105243_11575515 Ga0105243_115755151 179
109 3300009545 Ga0105237_10823418 Ga0105237_108234181 179
110 3300009551 Ga0105238_10126724 Ga0105238_101267242 179
111 3300009551 Ga0105238_11041844 Ga0105238_110418442 179
112 3300010375 Ga0105239_11254509 Ga0105239_112545092 179
113 3300013296 Ga0157374_10723531 Ga0157374_107235311 179
114 3300017792 Ga0163161_10591064 Ga0163161_105910642 179
115 3300021320 Ga0214544_1000011 Ga0214544_1000011158 179
116 3300021321 Ga0214542_1000009 Ga0214542_100000984 179
117 3300021324 Ga0214545_1000007 Ga0214545_1000007158 179
118 3300021327 Ga0214543_1000020 Ga0214543_100002084 179
119 3300021384 Ga0213876_10028107 Ga0213876_100281073 179
120 3300021384 Ga0213876_10043394 Ga0213876_100433942 179
121 3300021384 Ga0213876_10345630 Ga0213876_103456301 179
122 3300021388 Ga0213875_10169733 Ga0213875_101697332 179
123 3300025253 Ga0209677_103245 Ga0209677_1032452 179
124 3300025261 Ga0209233_1009331 Ga0209233_10093316 179
125 3300025261 Ga0209233_1012034 Ga0209233_10120342 179
126 3300025272 Ga0209455_1013650 Ga0209455_10136502 179
127 3300025297 Ga0209758_1000536 Ga0209758_100053645 179
128 3300025297 Ga0209758_1049940 Ga0209758_10499403 179
129 3300025302 Ga0207426_1000870 Ga0207426_100087011 179
130 3300025302 Ga0207426_1075396 Ga0207426_10753962 179
131 3300025912 Ga0207707_10002136 Ga0207707_1000213618 179
132 3300025916 Ga0207663_10011272 Ga0207663_100112724 179
133 3300025916 Ga0207663_10531558 Ga0207663_105315582 179
134 3300025921 Ga0207652_10478196 Ga0207652_104781963 179
135 3300025924 Ga0207694_10085754 Ga0207694_100857541 179
136 3300025928 Ga0207700_10202555 Ga0207700_102025552 179
137 3300025928 Ga0207700_10206514 Ga0207700_102065142 179
138 3300025949 Ga0207667_10968014 Ga0207667_109680142 179
139 3300025981 Ga0207640_10329475 Ga0207640_103294753 179
140 3300026041 Ga0207639_10398907 Ga0207639_103989072 179
141 3300026041 Ga0207639_10508030 Ga0207639_105080302 179
142 3300026067 Ga0207678_10825146 Ga0207678_108251462 179
143 3300026121 Ga0207683_10207056 Ga0207683_102070563 179
144 3300027357 Ga0209589_1000055 Ga0209589_100005598 179
145 3300027361 Ga0209489_100128 Ga0209489_10012898 179
146 3300027363 Ga0209700_100137 Ga0209700_10013798 179
147 3300035170 Ga0373943_0097753 Ga0373943_0097753_352_996 179
148 3300035171 Ga0373946_0030184 Ga0373946_0030184_200_844 179
149 3300035695 Ga0373927_0013512 Ga0373927_0013512_3765_4409 179
150 3300035695 Ga0373927_0284479 Ga0373927_0284479_195_734 179
151 3300035725 Ga0373947_0092885 Ga0373947_0092885_324_968 179
152 3300037068 Ga0373925_0198898 Ga0373925_0198898_932_1576 179
153 3300037418 Ga0395900_0119722 Ga0395900_0119722_1841_2380 179
154 3300037418 Ga0395900_0376852 Ga0395900_0376852_690_1241 179
155 3300037466 Ga0395898_0035453 Ga0395898_0035453_4133_4672 179
156 3300037471 Ga0395905_0001273 Ga0395905_0001273_6964_7515 179
157 3300037853 Ga0436364_0707013 Ga0436364_0707013_1075_1614 179
158 3300037853 Ga0436364_1382664 Ga0436364_1382664_1334_1873 179
159 3300038443 Ga0395901_0219096 Ga0395901_0219096_1165_1716 179
160 3300038443 Ga0395901_0309075 Ga0395901_0309075_102_641 179
161 3300038443 Ga0395901_0315658 Ga0395901_0315658_11_616 179
162 3300039437 Ga0436365_0083620 Ga0436365_0083620_94_633 179
163 3300039437 Ga0436365_0352896 Ga0436365_0352896_73_612 179
164 3300039437 Ga0436365_0360280 Ga0436365_0360280_715_1254 179
165 3300039437 Ga0436365_0999855 Ga0436365_0999855_14_553 179
166 3300039437 Ga0436365_1843787 Ga0436365_1843787_211_750 179
167 3300039437 Ga0436365_1912355 Ga0436365_1912355_1182_1721 179
168 3300041413 Ga0439465_0057529 Ga0439465_0057529_328_885 179
169 3300041413 Ga0439465_0124183 Ga0439465_0124183_138_686 179
170 3300041452 Ga0451793_1006818 Ga0451793_1006818_79_636 179
171 3300041460 Ga0451802_1154034 Ga0451802_1154034_134_673 179
172 3300041501 Ga0451845_0067159 Ga0451845_0067159_42_599 179
173 3300042438 Ga0439459_0150408 Ga0439459_0150408_49_588 179
174 3300044656 Ga0466969_0112289 Ga0466969_0112289_217_756 179
175 3300044656 Ga0466969_0176013 Ga0466969_0176013_213_752 179
176 3300044658 Ga0466972_0000053 Ga0466972_0000053_44767_45306 179
177 3300044658 Ga0466972_0034849 Ga0466972_0034849_1425_1964 179
178 3300044684 Ga0466966_0003689 Ga0466966_0003689_6284_6823 179
179 3300044684 Ga0466966_0243483 Ga0466966_0243483_158_697 179
180 3300044693 Ga0466961_0004648 Ga0466961_0004648_6537_7076 179
181 3300044694 Ga0466963_0142159 Ga0466963_0142159_875_1414 179
182 3300044719 Ga0466971_0366138 Ga0466971_0366138_77_616 179
183 3300044735 Ga0466968_0001220 Ga0466968_0001220_108_647 179
184 3300044735 Ga0466968_0111876 Ga0466968_0111876_491_1030 179
185 3300044842 Ga0466957_0196184 Ga0466957_0196184_436_975 179
186 3300044842 Ga0466957_0501622 Ga0466957_0501622_153_692 179
187 3300045049 Ga0466959_0002926 Ga0466959_0002926_4204_4743 179
188 3300045836 Ga0466958_0384284 Ga0466958_0384284_199_738 179
189 3300045976 Ga0466967_0083274 Ga0466967_0083274_1130_1669 179
190 3300046455 Ga0495603_0073664 Ga0495603_0073664_226_807 179
191 3300046473 Ga0495582_0482368 Ga0495582_0482368_38_577 179
192 3300046615 Ga0495656_0369100 Ga0495656_0369100_134_673 179
193 3300046690 Ga0495624_0205698 Ga0495624_0205698_306_845 179
194 3300048905 Ga0496102_0642850 Ga0496102_0642850_61_600 179
195 3300048906 Ga0496103_0246749 Ga0496103_0246749_577_1116 179
196 3300048909 Ga0496106_0134789 Ga0496106_0134789_724_1263 179
197 3300048910 Ga0496107_0427423 Ga0496107_0427423_356_913 179
198 3300048918 Ga0496115_0102867 Ga0496115_0102867_1562_2101 179
199 3300048918 Ga0496115_0182918 Ga0496115_0182918_144_683 179
200 3300048924 Ga0496121_0033653 Ga0496121_0033653_3026_3565 179
201 3300048925 Ga0496122_0072304 Ga0496122_0072304_269_808 179
202 3300048926 Ga0496123_0120766 Ga0496123_0120766_10_549 179
203 3300048928 Ga0496125_0111301 Ga0496125_0111301_963_1508 179
204 3300048929 Ga0496126_0007369 Ga0496126_0007369_5414_5953 179
205 3300048929 Ga0496126_0009937 Ga0496126_0009937_4503_5042 179
206 3300048929 Ga0496126_0555454 Ga0496126_0555454_191_748 179
207 3300048929 Ga0496126_0980077 Ga0496126_0980077_24_563 179
208 3300050491 nmdc:mga00v17_91569_c1 nmdc:mga00v17_91569_c1_1156_1701 179
209 3300050492 nmdc:mga0yw44_289200_c1 nmdc:mga0yw44_289200_c1_31_576 179
210 3300050492 nmdc:mga0yw44_849879_c1 nmdc:mga0yw44_849879_c1_53_592 179
211 3300050495 nmdc:mga04h51_232246_c1 nmdc:mga04h51_232246_c1_117_656 179
212 3300050496 nmdc:mga07m45_271386_c1 nmdc:mga07m45_271386_c1_325_870 179
213 3300050496 nmdc:mga07m45_396360_c1 nmdc:mga07m45_396360_c1_154_711 179
214 3300050516 nmdc:mga0sz30_58114_c1 nmdc:mga0sz30_58114_c1_680_1225 179
215 3300053091 Ga0500647_0035653 Ga0500647_0035653_1189_1728 179
216 3300053093 Ga0500651_0182157 Ga0500651_0182157_496_1047 179
217 3300053105 Ga0500557_000032 Ga0500557_000032_13025_13564 179
218 3300053119 Ga0500595_013294 Ga0500595_013294_2108_2665 179
219 3300053130 Ga0500642_0000197 Ga0500642_0000197_1060_1599 179
220 3300053737 Ga0500601_013768 Ga0500601_013768_145_684 179
221 iso_pu_bacteria 2524023210 2524465302 179
222 iso_pu_bacteria 3005594810 3005595925 179
223 iso_pu_bacteria 8006994254 8006996934 179

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13328

HD_4

HD domain

46

190

0.87

PF01966

HD

HD domain

67

162

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nr1-assembly1.cif.gz_B a metazoan ortholog of spot hydrolyzes ppgpp and plays a role in starvation responses 0.9205 2 176
5vxa-assembly1.cif.gz_A structure of the human mesh1-nadph complex 0.9177 2 175
3nr1-assembly1.cif.gz_B a metazoan ortholog of spot hydrolyzes ppgpp and plays a role in starvation responses 0.9008 2 176
5vxa-assembly1.cif.gz_A structure of the human mesh1-nadph complex 0.8932 2 175
3nqw-assembly1.cif.gz_B a metazoan ortholog of spot hydrolyzes ppgpp and plays a role in starvation responses 0.8929 1 179
ID Description Score Start End Superfamily
af_O18307_57_228_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.9233 5 175 1.10.3210.10
af_Q54KN3_7_177_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.9113 7 172 1.10.3210.10
af_O18307_57_228_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.908 5 175 1.10.3210.10
af_Q54KN3_7_177_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.8755 7 172 1.10.3210.10
af_Q9LVJ3_188_384_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.7736 7 175 1.10.3210.10
ID Description Score Start End GO Terms
AF-A0A1G7X7K8-F1-model_v4 Very-short-patch-repair endonuclease 0.9929 1 179 GO:0004519
GO:0008893
AF-A0A1G7X7K8-F1-model_v4 Very-short-patch-repair endonuclease 0.9874 1 179 GO:0004519
GO:0008893
AF-A0A7C5ZWP4-F1-model_v4 Bifunctional (P)ppGpp synthetase/guanosine-3',5'-bis(Diphosphate) 3'-pyrophosphohydrolase 0.9605 2 177 GO:0008893
AF-A0A7R9QIU3-F1-model_v4 Guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase MESH1 (Metazoan SpoT homolog 1) (Penta-phosphate guanosine-3'-pyrophosphohydrolase) 0.9543 4 119 GO:0008893
AF-A0A670YQC1-F1-model_v4 Guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase MESH1 (EC 3.1.7.2) (Metazoan SpoT homolog 1) (Penta-phosphate guanosine-3'-pyrophosphohydrolase) 0.952 4 128 GO:0008893

Feature Viewer

pLDDT pTM Quality
97.6 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map