F335720

General Info

Members Datasets Scaffolds Average Seq Length
223 119 223 380

Family's Representative Sequence

Representative Sequence 3300028563|Ga0265319_1000003|Ga0265319_1000003140
Length 434
Sequence MRTPIKIQIPTKISAMPSSVSKAPFNSDLIRIFDRFTLAKNPVSRRKWQRAFACDILRRMTRTEKLLAELIALPSVNPAFLPPRHPHTGEKRVADFLATVAARAGLEIEFQKVLPGRSNVIARLRPKNKIKQTVLLAPHLDTVGADGTRFIPQRKNGRLHGRGACDTKGSVAAMFSALCELADSKSRPLETEIIFAGLIDEEHAQAGSRALVKSRFKADLAIVGEPTKLQVVTAHKGSLWLELETRGKAAHGATPQFGKNAIHEMAKIVDALETDYAVQLRKRKHPLLGTATVNVGTISGGTQPNIVPDICKSSVDRRTLPGETETGVRRELAGLLRAKNLSAKISSAKLVPSLPLETNHKLPLVQQFMRSVGQTKPAGVNFFCDASVLSLAGIPSVVFGPGDVAQAHTMDEWISLSELERGKNLLLNFLKSLS

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
7 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
8 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
9 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
10 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
11 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
12 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
13 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
14 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
15 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
16 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
17 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
18 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
19 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
20 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
21 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
23 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
25 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
26 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
27 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
28 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
29 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
30 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
31 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
40 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
41 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
42 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
43 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
44 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
45 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
46 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
47 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
48 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
49 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
50 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
51 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
52 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
53 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
54 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
55 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
56 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
57 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
58 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
59 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
60 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
61 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
62 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
63 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
64 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
65 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
66 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
67 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
68 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
69 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
70 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
71 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
72 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
73 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
74 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
75 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
76 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
77 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
78 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
79 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
80 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
81 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
82 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
83 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
84 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
85 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
86 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
87 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
88 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
89 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
90 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
91 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
92 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
93 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
94 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
95 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
96 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
97 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
98 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
99 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
100 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
101 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
102 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
103 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
104 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
105 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
106 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
113 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
115 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
116 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
117 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
118 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
119 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.45
Nodule 0
Rhizoplane 0.9
Rhizosphere 98.21
Stem 0
Stem Tuber 0
Unclassified 0.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10147718 3300005327 Bacteria 1967
2 Ga0070690_100000623 3300005330 Bacteria 17950
3 Ga0070690_100041647 3300005330 Bacteria 2908
4 Ga0070689_100067751 3300005340 Bacteria 2783
5 Ga0070689_100100609 3300005340 Bacteria 2287
6 Ga0070714_100021721 3300005435 Bacteria 5253
7 Ga0070713_100137801 3300005436 Bacteria 2158
8 Ga0070701_10001233 3300005438 Bacteria 9383
9 Ga0070685_10018488 3300005466 Bacteria 3748
10 Ga0070698_100424466 3300005471 Unclassified 1264
11 Ga0068855_100023005 3300005563 Bacteria 7469
12 Ga0068855_100078636 3300005563 Unclassified 3826
13 Ga0068856_100000610 3300005614 Bacteria 39150
14 Ga0068856_100057730 3300005614 Bacteria 3832
15 Ga0068856_100083716 3300005614 Bacteria 3168
16 Ga0068859_100014317 3300005617 Bacteria 7957
17 Ga0068864_100239083 3300005618 Bacteria 1682
18 Ga0068863_100087817 3300005841 Bacteria 2947
19 Ga0068863_100188450 3300005841 Bacteria 1982
20 Ga0070717_10049689 3300006028 Bacteria 3444
21 Ga0068871_100198848 3300006358 Bacteria 1729
22 Ga0075428_100006528 3300006844 Bacteria 12971
23 Ga0075428_100048161 3300006844 Bacteria 4679
24 Ga0075428_100360081 3300006844 Unclassified 1561
25 Ga0075431_100336778 3300006847 Unclassified 1519
26 Ga0075434_100376234 3300006871 Bacteria 1441
27 Ga0097620_100014317 3300006931 Bacteria 7957
28 Ga0105240_10123535 3300009093 Bacteria 3114
29 Ga0105240_10207010 3300009093 Bacteria 2295
30 Ga0105240_10252009 3300009093 Bacteria 2041
31 Ga0111539_10069309 3300009094 Bacteria 4164
32 Ga0111539_10214935 3300009094 Unclassified 2240
33 Ga0111539_10368423 3300009094 Bacteria 1672
34 Ga0105245_10029991 3300009098 Bacteria 4809
35 Ga0114129_10305538 3300009147 Bacteria 2119
36 Ga0114129_10534144 3300009147 Unclassified 1527
37 Ga0105242_10023721 3300009176 Bacteria 4837
38 Ga0105237_10045584 3300009545 Bacteria 4411
39 Ga0105238_10042110 3300009551 Bacteria 4624
40 Ga0105238_10183246 3300009551 Unclassified 2070
41 Ga0105249_10063586 3300009553 Bacteria 3391
42 Ga0157375_10088123 3300013308 Unclassified 3158
43 Ga0157375_10360773 3300013308 Unclassified 1619
44 Ga0163163_10149183 3300014325 Unclassified 2383
45 Ga0157376_10153594 3300014969 Bacteria 2079
46 Ga0207695_10072506 3300025913 Unclassified 3513
47 Ga0207663_10050939 3300025916 Unclassified 2576
48 Ga0207694_10016565 3300025924 Bacteria 5566
49 Ga0207694_10044124 3300025924 Unclassified 3442
50 Ga0207664_10015408 3300025929 Bacteria 5548
51 Ga0207670_10084652 3300025936 Bacteria 2227
52 Ga0207670_10250409 3300025936 Bacteria 1369
53 Ga0207711_10064102 3300025941 Bacteria 3173
54 Ga0207702_10002534 3300026078 Bacteria 17190
55 Ga0207702_10005789 3300026078 Bacteria 10751
56 Ga0207702_10171945 3300026078 Bacteria 1987
57 Ga0207676_10218942 3300026095 Bacteria 1694
58 Ga0207428_10065805 3300027907 Unclassified 2857
59 Ga0265337_1000226 3300028556 Bacteria 30178
60 Ga0265337_1000232 3300028556 Bacteria 30080
61 Ga0265337_1027359 3300028556 Bacteria 1719
62 Ga0265326_10004740 3300028558 Unclassified 4328
63 Ga0265319_1000003 3300028563 Bacteria 340561
64 Ga0265319_1000222 3300028563 Bacteria 42419
65 Ga0265319_1007525 3300028563 Unclassified 4884
66 Ga0265319_1029366 3300028563 Bacteria 1931
67 Ga0265319_1035970 3300028563 Unclassified 1696
68 Ga0265319_1058254 3300028563 Bacteria 1258
69 Ga0265334_10019498 3300028573 Unclassified 2789
70 Ga0265318_10000426 3300028577 Bacteria 32272
71 Ga0265318_10008556 3300028577 Unclassified 4547
72 Ga0265318_10022036 3300028577 Bacteria 2552
73 Ga0265323_10000286 3300028653 Bacteria 29219
74 Ga0265323_10020952 3300028653 Bacteria 2509
75 Ga0265322_10001305 3300028654 Bacteria 8370
76 Ga0265336_10001830 3300028666 Bacteria 9258
77 Ga0265338_10000008 3300028800 Bacteria 481542
78 Ga0265338_10000309 3300028800 Bacteria 88345
79 Ga0265338_10000433 3300028800 Bacteria 75181
80 Ga0265338_10000626 3300028800 Bacteria 61483
81 Ga0265338_10000988 3300028800 Bacteria 47929
82 Ga0265338_10001793 3300028800 Bacteria 33791
83 Ga0265338_10002328 3300028800 Bacteria 28735
84 Ga0265338_10002628 3300028800 Bacteria 26498
85 Ga0265338_10002940 3300028800 Bacteria 24710
86 Ga0265338_10003435 3300028800 Bacteria 22324
87 Ga0265338_10005667 3300028800 Bacteria 16195
88 Ga0265338_10008529 3300028800 Bacteria 12415
89 Ga0265338_10011187 3300028800 Bacteria 10399
90 Ga0265338_10015582 3300028800 Bacteria 8332
91 Ga0265338_10019273 3300028800 Bacteria 7253
92 Ga0265338_10032857 3300028800 Bacteria 5050
93 Ga0265338_10048329 3300028800 Unclassified 3872
94 Ga0265338_10048993 3300028800 Unclassified 3836
95 Ga0265338_10056633 3300028800 Unclassified 3474
96 Ga0265338_10095426 3300028800 Bacteria 2443
97 Ga0265324_10001611 3300029957 Bacteria 12565
98 Ga0265324_10002818 3300029957 Bacteria 8574
99 Ga0265324_10009859 3300029957 Unclassified 3712
100 Ga0265332_10012324 3300031238 Unclassified 3794
101 Ga0265332_10062061 3300031238 Unclassified 1597
102 Ga0265320_10002781 3300031240 Bacteria 12054
103 Ga0265320_10003124 3300031240 Bacteria 11241
104 Ga0265320_10004638 3300031240 Bacteria 8977
105 Ga0265320_10019215 3300031240 Unclassified 3741
106 Ga0265320_10029355 3300031240 Bacteria 2845
107 Ga0265325_10011966 3300031241 Bacteria 4972
108 Ga0265325_10042793 3300031241 Unclassified 2365
109 Ga0265340_10000309 3300031247 Bacteria 25713
110 Ga0265340_10034865 3300031247 Unclassified 2501
111 Ga0265340_10034970 3300031247 Bacteria 2496
112 Ga0265339_10037114 3300031249 Bacteria 2724
113 Ga0265327_10000467 3300031251 Bacteria 71664
114 Ga0265327_10001892 3300031251 Bacteria 24226
115 Ga0265316_10001936 3300031344 Bacteria 21743
116 Ga0265316_10040843 3300031344 Unclassified 3717
117 Ga0265313_10007442 3300031595 Bacteria 7481
118 Ga0265313_10014550 3300031595 Unclassified 4642
119 Ga0265314_10031966 3300031711 Unclassified 3878
120 Ga0265314_10057334 3300031711 Bacteria 2676
121 Ga0265342_10086783 3300031712 Viruses 1799
122 Ga0265342_10139036 3300031712 Unclassified 1356
123 Ga0316578_10027031 3300031728 Unclassified 3240
124 Ga0316578_10075334 3300031728 Bacteria 2002
125 Ga0307405_10117889 3300031731 Unclassified 1811
126 Ga0316577_10154697 3300031733 Bacteria 1293
127 Ga0373930_0003036 3300034816 Bacteria 2640
128 Ga0373928_0000046 3300035084 Bacteria 21141
129 Ga0373929_0000827 3300035085 Bacteria 6040
130 Ga0373944_0000012 3300035089 Bacteria 34389
131 Ga0373949_0000660 3300035090 Bacteria 11227
132 Ga0373932_0000001 3300035112 Bacteria 1459067
133 Ga0373945_0003038 3300035116 Bacteria 5276
134 Ga0373953_0016296 3300035117 Bacteria 2711
135 Ga0373954_0003079 3300035118 Bacteria 7045
136 Ga0373956_0022279 3300035119 Bacteria 2710
137 Ga0373943_0013275 3300035170 Unclassified 3719
138 Ga0373962_0000030 3300035242 Bacteria 36514
139 Ga0373931_0000008 3300035691 Bacteria 362269
140 Ga0373935_0014569 3300035692 Unclassified 4745
141 Ga0373927_0053044 3300035695 Bacteria 2622
142 Ga0373947_0006313 3300035725 Bacteria 6888
143 Ga0373947_0037907 3300035725 Bacteria 2861
144 Ga0373947_0065830 3300035725 Bacteria 2211
145 Ga0373937_0002900 3300036401 Bacteria 14318
146 Ga0373937_0064485 3300036401 Unclassified 3370
147 Ga0373937_0095644 3300036401 Bacteria 2754
148 Ga0316584_0022803 3300036712 Bacteria 4569
149 Ga0373925_0000158 3300037068 Bacteria 72961
150 Ga0373925_0002707 3300037068 Bacteria 14050
151 Ga0373925_0110855 3300037068 Bacteria 2119
152 Ga0436364_1385061 3300037853 Bacteria 1475
153 Ga0451577_0003402 3300042876 Bacteria 17770
154 Ga0451577_0006038 3300042876 Bacteria 12190
155 Ga0451577_0020123 3300042876 Bacteria 6128
156 Ga0451577_0032446 3300042876 Bacteria 4705
157 Ga0451577_0194811 3300042876 Unclassified 1829
158 Ga0453684_0007269 3300044712 Bacteria 20498
159 Ga0453684_0010638 3300044712 Bacteria 15671
160 Ga0453684_0015250 3300044712 Bacteria 12185
161 Ga0453684_0177334 3300044712 Bacteria 2505
162 Ga0453684_0207280 3300044712 Bacteria 2281
163 Ga0453684_0253304 3300044712 Unclassified 2021
164 Ga0451576_0073695 3300045051 Bacteria 3553
165 Ga0451576_0100207 3300045051 Bacteria 3013
166 Ga0451576_0116676 3300045051 Bacteria 2779
167 Ga0451576_0173923 3300045051 Bacteria 2248
168 Ga0451576_0186614 3300045051 Unclassified 2165
169 Ga0451576_0282594 3300045051 Bacteria 1735
170 Ga0495651_0072172 3300046462 Bacteria 2623
171 Ga0495618_0012190 3300046514 Bacteria 5218
172 Ga0495628_0019762 3300046516 Bacteria 5564
173 Ga0495628_0159000 3300046516 Bacteria 1718
174 Ga0495630_0000063 3300046517 Bacteria 85919
175 Ga0495630_0040248 3300046517 Unclassified 3493
176 Ga0495630_0056981 3300046517 Bacteria 2928
177 Ga0495630_0069667 3300046517 Bacteria 2646
178 Ga0495666_0050417 3300046526 Bacteria 2001
179 Ga0495666_0083152 3300046526 Bacteria 1513
180 Ga0495640_0013350 3300046533 Bacteria 6242
181 Ga0495640_0028521 3300046533 Bacteria 4018
182 Ga0495640_0050837 3300046533 Bacteria 2853
183 Ga0495640_0080157 3300046533 Unclassified 2172
184 Ga0495586_0000009 3300046535 Bacteria 144639
185 Ga0495586_0012942 3300046535 Bacteria 4423
186 Ga0495586_0049213 3300046535 Bacteria 2279
187 Ga0495586_0085214 3300046535 Bacteria 1741
188 Ga0495645_0086232 3300046543 Bacteria 2247
189 Ga0495667_0030120 3300046559 Bacteria 3649
190 Ga0495667_0078659 3300046559 Bacteria 2144
191 Ga0495634_0004500 3300046642 Bacteria 10933
192 Ga0495634_0120355 3300046642 Unclassified 1681
193 Ga0495599_0060464 3300046678 Bacteria 2369
194 Ga0495647_0034674 3300046681 Bacteria 1891
195 Ga0495658_0003435 3300046683 Bacteria 7836
196 Ga0495658_0007297 3300046683 Bacteria 5462
197 Ga0495613_0004080 3300046689 Bacteria 10914
198 Ga0495613_0020940 3300046689 Bacteria 4874
199 Ga0495581_0061664 3300047315 Bacteria 2167
200 Ga0495674_0000043 3300047319 Bacteria 92585
201 Ga0495676_0132815 3300047321 Bacteria 1794
202 Ga0495684_0065746 3300047471 Unclassified 2757
203 Ga0495684_0233576 3300047471 Unclassified 1344
204 Ga0496106_0089962 3300048909 Unclassified 2368
205 Ga0496115_0025692 3300048918 Bacteria 4589
206 Ga0501031_0046178 3300049568 Bacteria 2841
207 Ga0501032_0003563 3300049569 Bacteria 11867
208 Ga0501033_0011340 3300049570 Bacteria 6821
209 Ga0501033_0059574 3300049570 Unclassified 2819
210 Ga0501034_0184068 3300049571 Bacteria 2053
211 Ga0501037_0094300 3300049573 Unclassified 2164
212 Ga0501046_0145975 3300049580 Unclassified 1787
213 Ga0501080_0295432 3300049742 Bacteria 1470
214 Ga0501035_0020059 3300049822 Bacteria 6139
215 Ga0501035_0120011 3300049822 Unclassified 2299
216 Ga0501044_0000633 3300049823 Bacteria 42422
217 Ga0501044_0073099 3300049823 Bacteria 3485
218 nmdc:mga09592_268009_c1 3300050508 Unclassified 1481
219 nmdc:mga08y16_512143_c1 3300050511 Unclassified 1218
220 Ga0495601_0002504 3300053077 Bacteria 10457
221 Ga0495601_0072856 3300053077 Bacteria 2195
222 Ga0495619_0024371 3300053085 Bacteria 3881
223 Ga0500595_034535 3300053119 Unclassified 1672

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047315 Ga0495581_0061664 Ga0495581_0061664_37_1005 322
2 3300009147 Ga0114129_10534144 Ga0114129_105341442 328
3 3300028563 Ga0265319_1000222 Ga0265319_10002229 333
4 3300028577 Ga0265318_10000426 Ga0265318_1000042620 333
5 3300031240 Ga0265320_10002781 Ga0265320_100027816 333
6 3300036712 Ga0316584_0022803 Ga0316584_0022803_2027_3145 341
7 3300042876 Ga0451577_0032446 Ga0451577_0032446_105_1172 352
8 3300006358 Ga0068871_100198848 Ga0068871_1001988482 357
9 3300028563 Ga0265319_1035970 Ga0265319_10359702 360
10 3300028577 Ga0265318_10008556 Ga0265318_100085562 360
11 3300028800 Ga0265338_10005667 Ga0265338_1000566712 360
12 3300031595 Ga0265313_10014550 Ga0265313_100145501 360
13 3300031712 Ga0265342_10086783 Ga0265342_100867832 360
14 3300044712 Ga0453684_0010638 Ga0453684_0010638_9658_10785 360
15 3300031728 Ga0316578_10075334 Ga0316578_100753341 362
16 3300028800 Ga0265338_10002628 Ga0265338_1000262817 363
17 3300006028 Ga0070717_10049689 Ga0070717_100496893 366
18 3300006844 Ga0075428_100048161 Ga0075428_1000481613 366
19 3300009545 Ga0105237_10045584 Ga0105237_100455842 366
20 3300053077 Ga0495601_0002504 Ga0495601_0002504_844_1980 366
21 3300053085 Ga0495619_0024371 Ga0495619_0024371_502_1638 366
22 3300037853 Ga0436364_1385061 Ga0436364_1385061_260_1414 367
23 3300028558 Ga0265326_10004740 Ga0265326_100047403 371
24 3300028800 Ga0265338_10000008 Ga0265338_10000008349 371
25 3300028800 Ga0265338_10000309 Ga0265338_100003099 371
26 3300029957 Ga0265324_10001611 Ga0265324_100016119 371
27 3300031731 Ga0307405_10117889 Ga0307405_101178891 371
28 3300044712 Ga0453684_0253304 Ga0453684_0253304_763_1890 371
29 3300045051 Ga0451576_0186614 Ga0451576_0186614_870_1997 371
30 3300005340 Ga0070689_100100609 Ga0070689_1001006092 372
31 3300005614 Ga0068856_100057730 Ga0068856_1000577302 372
32 3300005618 Ga0068864_100239083 Ga0068864_1002390832 372
33 3300006844 Ga0075428_100006528 Ga0075428_1000065282 372
34 3300006847 Ga0075431_100336778 Ga0075431_1003367782 372
35 3300009094 Ga0111539_10069309 Ga0111539_100693092 372
36 3300009094 Ga0111539_10214935 Ga0111539_102149352 372
37 3300014325 Ga0163163_10149183 Ga0163163_101491832 372
38 3300025936 Ga0207670_10084652 Ga0207670_100846522 372
39 3300025936 Ga0207670_10250409 Ga0207670_102504091 372
40 3300025941 Ga0207711_10064102 Ga0207711_100641022 372
41 3300026078 Ga0207702_10005789 Ga0207702_100057897 372
42 3300026095 Ga0207676_10218942 Ga0207676_102189422 372
43 3300027907 Ga0207428_10065805 Ga0207428_100658053 372
44 3300028800 Ga0265338_10032857 Ga0265338_100328573 372
45 3300031251 Ga0265327_10000467 Ga0265327_1000046751 372
46 3300031251 Ga0265327_10001892 Ga0265327_1000189212 372
47 3300042876 Ga0451577_0006038 Ga0451577_0006038_9529_10656 372
48 3300042876 Ga0451577_0194811 Ga0451577_0194811_435_1574 372
49 3300044712 Ga0453684_0007269 Ga0453684_0007269_17837_18964 372
50 3300044712 Ga0453684_0177334 Ga0453684_0177334_76_1218 372
51 3300045051 Ga0451576_0073695 Ga0451576_0073695_689_1819 372
52 3300045051 Ga0451576_0116676 Ga0451576_0116676_357_1484 372
53 3300046526 Ga0495666_0050417 Ga0495666_0050417_306_1436 372
54 3300046533 Ga0495640_0013350 Ga0495640_0013350_1050_2180 372
55 3300046535 Ga0495586_0049213 Ga0495586_0049213_847_1977 372
56 3300046642 Ga0495634_0120355 Ga0495634_0120355_445_1575 372
57 3300046683 Ga0495658_0007297 Ga0495658_0007297_3322_4452 372
58 3300046689 Ga0495613_0004080 Ga0495613_0004080_4243_5373 372
59 3300047471 Ga0495684_0233576 Ga0495684_0233576_33_1160 372
60 3300048909 Ga0496106_0089962 Ga0496106_0089962_417_1544 372
61 3300049571 Ga0501034_0184068 Ga0501034_0184068_341_1486 372
62 3300050508 nmdc:mga09592_268009_c1 nmdc:mga09592_268009_c1_201_1331 372
63 3300050511 nmdc:mga08y16_512143_c1 nmdc:mga08y16_512143_c1_26_1156 372
64 3300053077 Ga0495601_0072856 Ga0495601_0072856_336_1463 372
65 3300005330 Ga0070690_100041647 Ga0070690_1000416473 373
66 3300005340 Ga0070689_100067751 Ga0070689_1000677514 373
67 3300005435 Ga0070714_100021721 Ga0070714_1000217214 373
68 3300005436 Ga0070713_100137801 Ga0070713_1001378012 373
69 3300005438 Ga0070701_10001233 Ga0070701_100012333 373
70 3300005466 Ga0070685_10018488 Ga0070685_100184884 373
71 3300005471 Ga0070698_100424466 Ga0070698_1004244661 373
72 3300005563 Ga0068855_100078636 Ga0068855_1000786362 373
73 3300005614 Ga0068856_100083716 Ga0068856_1000837164 373
74 3300005841 Ga0068863_100188450 Ga0068863_1001884502 373
75 3300006844 Ga0075428_100360081 Ga0075428_1003600811 373
76 3300006871 Ga0075434_100376234 Ga0075434_1003762341 373
77 3300009093 Ga0105240_10123535 Ga0105240_101235353 373
78 3300009093 Ga0105240_10207010 Ga0105240_102070102 373
79 3300009094 Ga0111539_10368423 Ga0111539_103684232 373
80 3300009098 Ga0105245_10029991 Ga0105245_100299915 373
81 3300009147 Ga0114129_10305538 Ga0114129_103055382 373
82 3300009176 Ga0105242_10023721 Ga0105242_100237212 373
83 3300009551 Ga0105238_10183246 Ga0105238_101832462 373
84 3300009553 Ga0105249_10063586 Ga0105249_100635862 373
85 3300013308 Ga0157375_10088123 Ga0157375_100881232 373
86 3300013308 Ga0157375_10360773 Ga0157375_103607732 373
87 3300014969 Ga0157376_10153594 Ga0157376_101535943 373
88 3300025913 Ga0207695_10072506 Ga0207695_100725064 373
89 3300025924 Ga0207694_10016565 Ga0207694_100165656 373
90 3300025929 Ga0207664_10015408 Ga0207664_100154084 373
91 3300028556 Ga0265337_1000226 Ga0265337_100022633 373
92 3300028563 Ga0265319_1029366 Ga0265319_10293661 373
93 3300028653 Ga0265323_10000286 Ga0265323_100002862 373
94 3300028654 Ga0265322_10001305 Ga0265322_1000130511 373
95 3300028800 Ga0265338_10019273 Ga0265338_100192734 373
96 3300028800 Ga0265338_10048329 Ga0265338_100483293 373
97 3300028800 Ga0265338_10095426 Ga0265338_100954262 373
98 3300029957 Ga0265324_10002818 Ga0265324_100028183 373
99 3300031249 Ga0265339_10037114 Ga0265339_100371142 373
100 3300031344 Ga0265316_10040843 Ga0265316_100408433 373
101 3300031728 Ga0316578_10027031 Ga0316578_100270313 373
102 3300031733 Ga0316577_10154697 Ga0316577_101546971 373
103 3300035170 Ga0373943_0013275 Ga0373943_0013275_602_1735 373
104 3300035692 Ga0373935_0014569 Ga0373935_0014569_1936_3069 373
105 3300035725 Ga0373947_0006313 Ga0373947_0006313_4754_5887 373
106 3300035725 Ga0373947_0065830 Ga0373947_0065830_519_1646 373
107 3300036401 Ga0373937_0064485 Ga0373937_0064485_2106_3233 373
108 3300036401 Ga0373937_0095644 Ga0373937_0095644_649_1779 373
109 3300037068 Ga0373925_0002707 Ga0373925_0002707_805_1938 373
110 3300037068 Ga0373925_0110855 Ga0373925_0110855_482_1609 373
111 3300042876 Ga0451577_0003402 Ga0451577_0003402_604_1731 373
112 3300042876 Ga0451577_0020123 Ga0451577_0020123_69_1199 373
113 3300044712 Ga0453684_0015250 Ga0453684_0015250_2183_3313 373
114 3300044712 Ga0453684_0207280 Ga0453684_0207280_507_1640 373
115 3300045051 Ga0451576_0100207 Ga0451576_0100207_59_1186 373
116 3300045051 Ga0451576_0173923 Ga0451576_0173923_1092_2219 373
117 3300045051 Ga0451576_0282594 Ga0451576_0282594_251_1390 373
118 3300046462 Ga0495651_0072172 Ga0495651_0072172_795_1925 373
119 3300046516 Ga0495628_0019762 Ga0495628_0019762_1423_2553 373
120 3300046516 Ga0495628_0159000 Ga0495628_0159000_123_1250 373
121 3300046517 Ga0495630_0000063 Ga0495630_0000063_64125_65252 373
122 3300046517 Ga0495630_0040248 Ga0495630_0040248_1640_2773 373
123 3300046517 Ga0495630_0069667 Ga0495630_0069667_932_2062 373
124 3300046526 Ga0495666_0083152 Ga0495666_0083152_161_1288 373
125 3300046533 Ga0495640_0050837 Ga0495640_0050837_1154_2281 373
126 3300046535 Ga0495586_0000009 Ga0495586_0000009_35201_36328 373
127 3300046678 Ga0495599_0060464 Ga0495599_0060464_188_1315 373
128 3300046681 Ga0495647_0034674 Ga0495647_0034674_550_1761 373
129 3300046683 Ga0495658_0003435 Ga0495658_0003435_155_1288 373
130 3300047319 Ga0495674_0000043 Ga0495674_0000043_18809_19936 373
131 3300047321 Ga0495676_0132815 Ga0495676_0132815_620_1747 373
132 3300048918 Ga0496115_0025692 Ga0496115_0025692_2591_3724 373
133 3300053119 Ga0500595_034535 Ga0500595_034535_221_1354 373
134 3300046543 Ga0495645_0086232 Ga0495645_0086232_769_1896 374
135 3300005327 Ga0070658_10147718 Ga0070658_101477183 375
136 3300005330 Ga0070690_100000623 Ga0070690_1000006232 375
137 3300005563 Ga0068855_100023005 Ga0068855_1000230056 375
138 3300005614 Ga0068856_100000610 Ga0068856_10000061014 375
139 3300005617 Ga0068859_100014317 Ga0068859_1000143175 375
140 3300005841 Ga0068863_100087817 Ga0068863_1000878173 375
141 3300006931 Ga0097620_100014317 Ga0097620_1000143175 375
142 3300009093 Ga0105240_10252009 Ga0105240_102520092 375
143 3300009551 Ga0105238_10042110 Ga0105238_100421102 375
144 3300025916 Ga0207663_10050939 Ga0207663_100509392 375
145 3300025924 Ga0207694_10044124 Ga0207694_100441242 375
146 3300026078 Ga0207702_10002534 Ga0207702_1000253410 375
147 3300026078 Ga0207702_10171945 Ga0207702_101719452 375
148 3300028556 Ga0265337_1000232 Ga0265337_100023228 375
149 3300028556 Ga0265337_1027359 Ga0265337_10273592 375
150 3300028563 Ga0265319_1000003 Ga0265319_1000003140 375
151 3300028563 Ga0265319_1007525 Ga0265319_10075253 375
152 3300028563 Ga0265319_1058254 Ga0265319_10582541 375
153 3300028573 Ga0265334_10019498 Ga0265334_100194983 375
154 3300028577 Ga0265318_10022036 Ga0265318_100220362 375
155 3300028653 Ga0265323_10020952 Ga0265323_100209522 375
156 3300028666 Ga0265336_10001830 Ga0265336_100018307 375
157 3300028800 Ga0265338_10000433 Ga0265338_1000043367 375
158 3300028800 Ga0265338_10000626 Ga0265338_1000062636 375
159 3300028800 Ga0265338_10000988 Ga0265338_1000098832 375
160 3300028800 Ga0265338_10001793 Ga0265338_1000179312 375
161 3300028800 Ga0265338_10002328 Ga0265338_1000232827 375
162 3300028800 Ga0265338_10002940 Ga0265338_1000294010 375
163 3300028800 Ga0265338_10003435 Ga0265338_100034357 375
164 3300028800 Ga0265338_10008529 Ga0265338_1000852912 375
165 3300028800 Ga0265338_10011187 Ga0265338_100111878 375
166 3300028800 Ga0265338_10015582 Ga0265338_100155824 375
167 3300028800 Ga0265338_10048993 Ga0265338_100489932 375
168 3300028800 Ga0265338_10056633 Ga0265338_100566333 375
169 3300029957 Ga0265324_10009859 Ga0265324_100098593 375
170 3300031238 Ga0265332_10012324 Ga0265332_100123242 375
171 3300031238 Ga0265332_10062061 Ga0265332_100620611 375
172 3300031240 Ga0265320_10003124 Ga0265320_100031249 375
173 3300031240 Ga0265320_10004638 Ga0265320_100046388 375
174 3300031240 Ga0265320_10019215 Ga0265320_100192153 375
175 3300031240 Ga0265320_10029355 Ga0265320_100293552 375
176 3300031241 Ga0265325_10011966 Ga0265325_100119662 375
177 3300031241 Ga0265325_10042793 Ga0265325_100427932 375
178 3300031247 Ga0265340_10000309 Ga0265340_1000030913 375
179 3300031247 Ga0265340_10034865 Ga0265340_100348652 375
180 3300031247 Ga0265340_10034970 Ga0265340_100349702 375
181 3300031344 Ga0265316_10001936 Ga0265316_100019366 375
182 3300031595 Ga0265313_10007442 Ga0265313_100074425 375
183 3300031711 Ga0265314_10031966 Ga0265314_100319662 375
184 3300031711 Ga0265314_10057334 Ga0265314_100573342 375
185 3300031712 Ga0265342_10139036 Ga0265342_101390361 375
186 3300034816 Ga0373930_0003036 Ga0373930_0003036_1174_2301 375
187 3300035084 Ga0373928_0000046 Ga0373928_0000046_6967_8094 375
188 3300035085 Ga0373929_0000827 Ga0373929_0000827_3614_4741 375
189 3300035089 Ga0373944_0000012 Ga0373944_0000012_24650_25777 375
190 3300035090 Ga0373949_0000660 Ga0373949_0000660_2721_3848 375
191 3300035112 Ga0373932_0000001 Ga0373932_0000001_714715_715842 375
192 3300035116 Ga0373945_0003038 Ga0373945_0003038_3295_4422 375
193 3300035117 Ga0373953_0016296 Ga0373953_0016296_186_1403 375
194 3300035118 Ga0373954_0003079 Ga0373954_0003079_4433_5650 375
195 3300035119 Ga0373956_0022279 Ga0373956_0022279_494_1711 375
196 3300035242 Ga0373962_0000030 Ga0373962_0000030_20656_21783 375
197 3300035691 Ga0373931_0000008 Ga0373931_0000008_181289_182416 375
198 3300035695 Ga0373927_0053044 Ga0373927_0053044_808_1935 375
199 3300035725 Ga0373947_0037907 Ga0373947_0037907_267_1394 375
200 3300036401 Ga0373937_0002900 Ga0373937_0002900_13020_14237 375
201 3300037068 Ga0373925_0000158 Ga0373925_0000158_20424_21551 375
202 3300046514 Ga0495618_0012190 Ga0495618_0012190_2872_4089 375
203 3300046517 Ga0495630_0056981 Ga0495630_0056981_342_1472 375
204 3300046533 Ga0495640_0028521 Ga0495640_0028521_1113_2330 375
205 3300046533 Ga0495640_0080157 Ga0495640_0080157_432_1562 375
206 3300046535 Ga0495586_0012942 Ga0495586_0012942_1436_2653 375
207 3300046535 Ga0495586_0085214 Ga0495586_0085214_109_1239 375
208 3300046559 Ga0495667_0030120 Ga0495667_0030120_2493_3623 375
209 3300046559 Ga0495667_0078659 Ga0495667_0078659_206_1423 375
210 3300046642 Ga0495634_0004500 Ga0495634_0004500_7153_8370 375
211 3300046689 Ga0495613_0020940 Ga0495613_0020940_3500_4717 375
212 3300047471 Ga0495684_0065746 Ga0495684_0065746_418_1635 375
213 3300049568 Ga0501031_0046178 Ga0501031_0046178_507_1634 375
214 3300049569 Ga0501032_0003563 Ga0501032_0003563_835_1962 375
215 3300049570 Ga0501033_0011340 Ga0501033_0011340_1575_2702 375
216 3300049570 Ga0501033_0059574 Ga0501033_0059574_1029_2156 375
217 3300049573 Ga0501037_0094300 Ga0501037_0094300_74_1201 375
218 3300049580 Ga0501046_0145975 Ga0501046_0145975_473_1600 375
219 3300049742 Ga0501080_0295432 Ga0501080_0295432_29_1177 375
220 3300049822 Ga0501035_0020059 Ga0501035_0020059_12_1139 375
221 3300049822 Ga0501035_0120011 Ga0501035_0120011_428_1555 375
222 3300049823 Ga0501044_0000633 Ga0501044_0000633_19661_20788 375
223 3300049823 Ga0501044_0073099 Ga0501044_0073099_1576_2703 375

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07687

M20_dimer

Peptidase dimerisation domain

233

344

0.95

PF01546

Peptidase_M20

Peptidase family M20/M25/M40

135

432

0.9

PF04389

Peptidase_M28

Peptidase family M28

119

287

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xoy-assembly1.cif.gz_B-2 crystal structure of lysk from thermus thermophilus in complex with lysine 0.8705 4 373
3ct9-assembly1.cif.gz_B crystal structure of a putative zinc peptidase (np_812461.1) from bacteroides thetaiotaomicron vpi-5482 at 2.31 a resolution 0.8639 4 375
5xoy-assembly1.cif.gz_B-2 crystal structure of lysk from thermus thermophilus in complex with lysine 0.8611 4 373
7uoi-assembly1.cif.gz_A-2 crystallographic structure of dape from enterococcus faecium 0.8597 1 372
5xoy-assembly1.cif.gz_A-2 crystal structure of lysk from thermus thermophilus in complex with lysine 0.852 4 373
ID Description Score Start End Superfamily
af_P65807_191_290_3.30.70.360 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8984 185 282 3.30.70.360
af_Q2FWN8_3_180_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8779 4 168 3.40.630.10
af_P23908_180_301_3.30.70.360 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.876 177 292 3.30.70.360
af_Q4CYZ4_4_238_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8712 142 359 3.40.630.10
af_Q18621_6_172_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8683 1 171 3.40.630.10
ID Description Score Start End GO Terms
AF-A0A2V9XQP4-F1-model_v4 Peptidase 0.9819 148 375 GO:0006526
GO:0008777
GO:0046872
AF-A0A2V9XQP4-F1-model_v4 Peptidase 0.9777 148 375 GO:0006526
GO:0008777
GO:0046872
AF-A0A7C3I549-F1-model_v4 M20 family peptidase 0.9772 2 375 GO:0016787
GO:0046872
AF-A0A7C3I549-F1-model_v4 M20 family peptidase 0.9747 2 375 GO:0016787
GO:0046872
AF-A0A382K7U0-F1-model_v4 Peptidase M20 dimerisation domain-containing protein 0.9557 1 283 GO:0016787
GO:0046872

Feature Viewer

pLDDT pTM Quality
96.23 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map