F335441

General Info

Members Datasets Scaffolds Average Seq Length
223 136 446 138

Family's Representative Sequence

Representative Sequence 3300006048|Ga0075363_100701886|Ga0075363_1007018861
Length 158
Sequence MTATPSPTNPPVLQLRVVVEAEDYDAAVAFYRDVLGLPEQAAFEGEGDARVTILEAGRATLELANPAQKRMIDDVEVGRPVSPKIRLAFEVTDADGKTRALVDAGATLIAPPTETPWRSLNSRLDAPAGVQITLFQELEGLEERTTRDGFGTSTTRDQ

Samples

Sample ID Description Type Environment
1 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
5 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
6 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
7 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
8 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
9 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
10 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
11 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
12 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
13 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
14 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
17 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
18 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
19 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
20 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
21 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
22 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
23 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
24 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
25 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
28 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
29 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
30 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
31 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
39 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
40 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
41 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
42 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
43 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
44 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
45 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
46 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
47 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
48 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
49 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
50 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
51 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
52 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
53 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
54 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
55 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
56 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
57 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
58 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
59 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
60 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
61 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
62 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
63 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
64 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
65 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
66 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
67 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
68 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
69 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
70 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
71 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
72 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
73 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
74 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
75 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
76 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
77 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
78 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
79 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
80 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
81 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
82 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
97 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
98 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
99 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
100 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
101 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
102 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
103 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
104 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
105 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
106 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
107 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
108 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
109 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
110 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
111 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
114 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
115 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
116 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
117 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
118 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
119 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
120 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
121 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
122 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
123 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
124 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
125 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
126 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
127 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
128 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
129 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
130 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
131 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
132 2643221619 Agromyces sp. Root81 Isolate Unclassified
133 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
134 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
135 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
136 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.31
Metatranscriptomes 0
Isolates 2.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.48
Nodule 0
Rhizoplane 4.93
Rhizosphere 86.1
Stem 0
Stem Tuber 0
Unclassified 2.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075363_100701886 3300006048 Bacteria 611
2 JGI24735J21928_10210673 3300002067 Bacteria 564
3 Ga0068868_100204395 3300005338 Bacteria 1648
4 Ga0070673_101758335 3300005364 Bacteria 587
5 Ga0070659_101215621 3300005366 Bacteria 667
6 Ga0070708_101288108 3300005445 Bacteria 683
7 Ga0070662_100643498 3300005457 Bacteria 894
8 Ga0070681_11212803 3300005458 Bacteria 677
9 Ga0070684_100742608 3300005535 Bacteria 916
10 Ga0070684_100798393 3300005535 Bacteria 882
11 Ga0070684_101198080 3300005535 Bacteria 714
12 Ga0070686_100497888 3300005544 Bacteria 945
13 Ga0070665_100001091 3300005548 Bacteria 33648
14 Ga0068859_100002435 3300005617 Bacteria 18946
15 Ga0068863_101271726 3300005841 Bacteria 742
16 Ga0068862_100586793 3300005844 Bacteria 1068
17 Ga0081455_10392406 3300005937 Bacteria 966
18 Ga0081538_10004330 3300005981 Bacteria 13117
19 Ga0075365_10011555 3300006038 Bacteria 5197
20 Ga0075364_10069604 3300006051 Bacteria 2315
21 Ga0075364_10083348 3300006051 Bacteria 2116
22 Ga0075369_10361990 3300006186 Bacteria 681
23 Ga0075430_100315322 3300006846 Bacteria 1293
24 Ga0075431_100080124 3300006847 Bacteria 3371
25 Ga0075431_100203573 3300006847 Bacteria 2024
26 Ga0075433_10628451 3300006852 Bacteria 942
27 Ga0075434_100346866 3300006871 Bacteria 1506
28 Ga0075434_100411725 3300006871 Bacteria 1373
29 Ga0075429_100213415 3300006880 Bacteria 1691
30 Ga0097620_100002435 3300006931 Bacteria 18946
31 Ga0114129_10106662 3300009147 Bacteria 3869
32 Ga0105239_10225544 3300010375 Bacteria 2102
33 Ga0157371_10000414 3300013102 Bacteria 52787
34 Ga0157372_11872538 3300013307 Bacteria 690
35 Ga0163163_11844665 3300014325 Bacteria 665
36 Ga0207710_10003234 3300025900 Bacteria 7278
37 Ga0207684_11323316 3300025910 Bacteria 592
38 Ga0207706_10394937 3300025933 Bacteria 1199
39 Ga0207668_10675948 3300025972 Bacteria 906
40 Ga0207677_10044105 3300026023 Bacteria 2969
41 Ga0207676_10836562 3300026095 Bacteria 900
42 Ga0268266_10002426 3300028379 Bacteria 20068
43 Ga0265320_10070578 3300031240 Bacteria 1647
44 Ga0265325_10275514 3300031241 Bacteria 755
45 Ga0265316_10600980 3300031344 Unclassified 780
46 Ga0265316_10684854 3300031344 Bacteria 723
47 Ga0307408_100163369 3300031548 Bacteria 1771
48 Ga0307508_10069790 3300031616 Bacteria 3086
49 Ga0307514_10002316 3300031649 Bacteria 20059
50 Ga0265342_10014488 3300031712 Bacteria 5232
51 Ga0307410_11271571 3300031852 Bacteria 643
52 Ga0307407_10029722 3300031903 Bacteria 2940
53 Ga0307407_10801202 3300031903 Bacteria 717
54 Ga0307412_10313593 3300031911 Bacteria 1245
55 Ga0307409_100206828 3300031995 Bacteria 1761
56 Ga0307409_100513279 3300031995 Bacteria 1169
57 Ga0307409_100948152 3300031995 Bacteria 876
58 Ga0307416_100029312 3300032002 Bacteria 4109
59 Ga0307416_100254687 3300032002 Bacteria 1711
60 Ga0307414_10771293 3300032004 Bacteria 875
61 Ga0307411_10444239 3300032005 Bacteria 1083
62 Ga0307411_11101687 3300032005 Bacteria 716
63 Ga0307411_11732295 3300032005 Bacteria 579
64 Ga0307415_100125528 3300032126 Bacteria 1933
65 Ga0307415_100519184 3300032126 Bacteria 1045
66 Ga0307415_100935941 3300032126 Bacteria 801
67 Ga0373950_0080342 3300034818 Bacteria 680
68 Ga0373938_0062042 3300034957 Bacteria 876
69 Ga0373940_0013504 3300035088 Bacteria 1978
70 Ga0373942_0000149 3300035207 Bacteria 16701
71 Ga0439466_0100740 3300041411 Bacteria 901
72 Ga0451797_0265497 3300041453 Bacteria 831
73 Ga0451837_0438911 3300041494 Bacteria 2785
74 Ga0451853_2550968 3300041512 Bacteria 2847
75 Ga0439448_0013142 3300042005 Bacteria 2486
76 Ga0439454_030269 3300042011 Bacteria 845
77 Ga0439455_0093132 3300042012 Bacteria 828
78 Ga0439463_006915 3300042016 Bacteria 2798
79 Ga0450920_003216 3300042122 Bacteria 2819
80 Ga0450923_122157 3300042125 Bacteria 615
81 Ga0466965_0439256 3300044683 Bacteria 725
82 Ga0466963_0643273 3300044694 Bacteria 749
83 Ga0466964_0470013 3300044706 Unclassified 670
84 Ga0466967_0207869 3300045976 Bacteria 1856
85 Ga0466967_1536572 3300045976 Bacteria 663
86 Ga0466967_1673407 3300045976 Bacteria 634
87 Ga0495629_0377136 3300046459 Bacteria 965
88 Ga0495658_0024810 3300046683 Bacteria 3199
89 Ga0495613_0046123 3300046689 Bacteria 3223
90 Ga0496104_0178127 3300048907 Bacteria 2036
91 Ga0496105_0045760 3300048908 Bacteria 3611
92 Ga0496108_0460333 3300048911 Bacteria 1111
93 Ga0496109_0314407 3300048912 Bacteria 1478
94 Ga0496109_1377498 3300048912 Bacteria 641
95 Ga0496110_0149951 3300048913 Bacteria 2111
96 Ga0496110_0619539 3300048913 Bacteria 981
97 Ga0496111_0076041 3300048914 Bacteria 2447
98 Ga0496114_0266960 3300048917 Bacteria 1508
99 Ga0496114_0277491 3300048917 Bacteria 1477
100 Ga0496118_0378314 3300048921 Bacteria 744
101 Ga0501031_0001352 3300049568 Bacteria 15120
102 Ga0501031_0618024 3300049568 Bacteria 697
103 Ga0501032_0072684 3300049569 Bacteria 2292
104 Ga0501033_0017531 3300049570 Bacteria 5410
105 Ga0501033_0197203 3300049570 Bacteria 1439
106 Ga0501034_0186846 3300049571 Bacteria 2035
107 Ga0501034_0208153 3300049571 Bacteria 1912
108 Ga0501036_0003594 3300049572 Bacteria 12398
109 Ga0501036_0005044 3300049572 Bacteria 10686
110 Ga0501036_0189641 3300049572 Bacteria 1730
111 Ga0501036_1236984 3300049572 Bacteria 608
112 Ga0501036_1258967 3300049572 Bacteria 602
113 Ga0501037_0067688 3300049573 Bacteria 2600
114 Ga0501037_0078331 3300049573 Bacteria 2398
115 Ga0501037_0443157 3300049573 Bacteria 887
116 Ga0501038_0006598 3300049574 Bacteria 10733
117 Ga0501039_0004940 3300049575 Bacteria 10110
118 Ga0501039_0008058 3300049575 Bacteria 8026
119 Ga0501040_0001482 3300049576 Bacteria 14902
120 Ga0501040_0010160 3300049576 Bacteria 6152
121 Ga0501040_1330501 3300049576 Bacteria 521
122 Ga0501041_0002328 3300049577 Bacteria 10746
123 Ga0501041_0003842 3300049577 Bacteria 8648
124 Ga0501041_0194687 3300049577 Bacteria 1270
125 Ga0501042_0003281 3300049578 Bacteria 10124
126 Ga0501042_0055894 3300049578 Bacteria 2817
127 Ga0501042_0060946 3300049578 Bacteria 2695
128 Ga0501042_0101483 3300049578 Bacteria 2069
129 Ga0501043_0117506 3300049579 Bacteria 2086
130 Ga0501046_0005122 3300049580 Bacteria 11755
131 Ga0501046_0030660 3300049580 Bacteria 4363
132 Ga0501048_0001265 3300049582 Bacteria 19125
133 Ga0501048_0002709 3300049582 Bacteria 13515
134 Ga0501048_0210774 3300049582 Bacteria 1378
135 Ga0501048_0223619 3300049582 Bacteria 1336
136 Ga0501048_0340361 3300049582 Bacteria 1069
137 Ga0501067_0047783 3300049583 Bacteria 2374
138 Ga0501068_0091378 3300049584 Bacteria 1878
139 Ga0501068_0296015 3300049584 Bacteria 1035
140 Ga0501069_0062523 3300049585 Bacteria 2079
141 Ga0501070_0074937 3300049586 Bacteria 2801
142 Ga0501070_0143528 3300049586 Bacteria 1971
143 Ga0501070_1300008 3300049586 Unclassified 555
144 Ga0501071_0017083 3300049587 Bacteria 4999
145 Ga0501071_0029000 3300049587 Bacteria 3903
146 Ga0501071_0149549 3300049587 Bacteria 1741
147 Ga0501071_0226561 3300049587 Bacteria 1408
148 Ga0501071_1445016 3300049587 Bacteria 531
149 Ga0501072_0001801 3300049588 Bacteria 15953
150 Ga0501072_0016995 3300049588 Bacteria 5590
151 Ga0501072_0094517 3300049588 Bacteria 2375
152 Ga0501072_0892711 3300049588 Bacteria 694
153 Ga0501072_0926701 3300049588 Bacteria 680
154 Ga0501073_0201798 3300049589 Bacteria 1375
155 Ga0501074_0008042 3300049590 Bacteria 7638
156 Ga0501074_0016431 3300049590 Bacteria 5375
157 Ga0501074_0063632 3300049590 Bacteria 2657
158 Ga0501074_0064948 3300049590 Bacteria 2627
159 Ga0501075_0058454 3300049591 Bacteria 2904
160 Ga0501075_0363314 3300049591 Bacteria 1103
161 Ga0501075_0519940 3300049591 Unclassified 908
162 Ga0501076_0000352 3300049592 Bacteria 28454
163 Ga0501076_0002935 3300049592 Bacteria 11820
164 Ga0501076_0213920 3300049592 Bacteria 1576
165 Ga0501076_0360482 3300049592 Bacteria 1194
166 Ga0501077_0001396 3300049593 Bacteria 14557
167 Ga0501077_0054992 3300049593 Bacteria 2527
168 Ga0501077_0346091 3300049593 Bacteria 948
169 Ga0501079_0002714 3300049741 Bacteria 12898
170 Ga0501079_0014048 3300049741 Bacteria 6105
171 Ga0501079_0056003 3300049741 Bacteria 3042
172 Ga0501079_0177679 3300049741 Bacteria 1661
173 Ga0501080_0026119 3300049742 Bacteria 5425
174 Ga0501080_0038974 3300049742 Bacteria 4434
175 Ga0501081_0010166 3300049743 Bacteria 6141
176 Ga0501081_0016306 3300049743 Bacteria 4910
177 Ga0501081_0756908 3300049743 Bacteria 730
178 Ga0501083_0118458 3300049744 Bacteria 1737
179 Ga0501083_0172157 3300049744 Bacteria 1415
180 Ga0501035_0030735 3300049822 Bacteria 4896
181 Ga0501035_0054308 3300049822 Bacteria 3580
182 Ga0501044_0164854 3300049823 Bacteria 2191
183 Ga0501044_0856222 3300049823 Bacteria 786
184 Ga0501045_0000391 3300049824 Bacteria 26581
185 Ga0501045_0002531 3300049824 Bacteria 12447
186 Ga0501045_0066571 3300049824 Bacteria 2645
187 Ga0501045_0549337 3300049824 Unclassified 857
188 nmdc:mga03n38_816500_c1 3300050490 Bacteria 544
189 nmdc:mga00v17_109610_c1 3300050491 Bacteria 1750
190 nmdc:mga00v17_60955_c1 3300050491 Bacteria 2318
191 nmdc:mga0yw44_159546_c1 3300050492 Bacteria 1476
192 nmdc:mga05p37_417022_c1 3300050507 Bacteria 1563
193 nmdc:mga09592_208912_c1 3300050508 Bacteria 1691
194 nmdc:mga09592_842746_c1 3300050508 Bacteria 773
195 nmdc:mga0qj67_57013_c2 3300050509 Bacteria 1613
196 nmdc:mga0qj67_68032_c1 3300050509 Bacteria 2838
197 nmdc:mga06r32_1465766_c1 3300050510 Bacteria 623
198 nmdc:mga06r32_281613_c1 3300050510 Bacteria 1650
199 nmdc:mga0n895_115830_c1 3300050512 Bacteria 2698
200 nmdc:mga0n895_396207_c1 3300050512 Bacteria 1396
201 nmdc:mga0rr50_593941_c1 3300050513 Bacteria 944
202 nmdc:mga0a205_438381_c1 3300050515 Bacteria 1167
203 nmdc:mga0a205_503786_c1 3300050515 Bacteria 1067
204 Ga0500568_0152854 3300053139 Bacteria 853
205 Ga0501084_0038242 3300054114 Bacteria 4011
206 Ga0501084_0045274 3300054114 Bacteria 3684
207 Ga0501084_0301425 3300054114 Bacteria 1353
208 Ga0590074_056745 3300059423 Unclassified 723
209 Ga0590075_078414 3300059424 Bacteria 855
210 Ga0590077_090882 3300059426 Bacteria 708
211 Ga0501082_0017534 3300060353 Bacteria 6168
212 Ga0501082_0018701 3300060353 Bacteria 5969
213 Ga0501082_0071298 3300060353 Bacteria 2992
214 Ga0501082_0110110 3300060353 Bacteria 2384
215 Ga0530510_0008200 3300061734 Bacteria 7286
216 Ga0530510_0018507 3300061734 Bacteria 4938
217 Ga0530510_0033017 3300061734 Bacteria 3725
218 2558914444 2558860112 Bacteria 9931328
219 2644110603 2643221619 Bacteria 4158469
220 2812363647 2811994880 Bacteria 4147780
221 2855388559 2855386786 Bacteria 4752232
222 2910813139 2910809715 Bacteria 4982797
223 2939661900 2939660829 Bacteria 3784848
224 Ga0075363_100701886
225 JGI24735J21928_10210673
226 Ga0068868_100204395
227 Ga0070673_101758335
228 Ga0070659_101215621
229 Ga0070708_101288108
230 Ga0070662_100643498
231 Ga0070681_11212803
232 Ga0070684_100742608
233 Ga0070684_100798393
234 Ga0070684_101198080
235 Ga0070686_100497888
236 Ga0070665_100001091
237 Ga0068859_100002435
238 Ga0068863_101271726
239 Ga0068862_100586793
240 Ga0081455_10392406
241 Ga0081538_10004330
242 Ga0075365_10011555
243 Ga0075364_10069604
244 Ga0075364_10083348
245 Ga0075369_10361990
246 Ga0075430_100315322
247 Ga0075431_100080124
248 Ga0075431_100203573
249 Ga0075433_10628451
250 Ga0075434_100346866
251 Ga0075434_100411725
252 Ga0075429_100213415
253 Ga0097620_100002435
254 Ga0114129_10106662
255 Ga0105239_10225544
256 Ga0157371_10000414
257 Ga0157372_11872538
258 Ga0163163_11844665
259 Ga0207710_10003234
260 Ga0207684_11323316
261 Ga0207706_10394937
262 Ga0207668_10675948
263 Ga0207677_10044105
264 Ga0207676_10836562
265 Ga0268266_10002426
266 Ga0265320_10070578
267 Ga0265325_10275514
268 Ga0265316_10600980
269 Ga0265316_10684854
270 Ga0307408_100163369
271 Ga0307508_10069790
272 Ga0307514_10002316
273 Ga0265342_10014488
274 Ga0307410_11271571
275 Ga0307407_10029722
276 Ga0307407_10801202
277 Ga0307412_10313593
278 Ga0307409_100206828
279 Ga0307409_100513279
280 Ga0307409_100948152
281 Ga0307416_100029312
282 Ga0307416_100254687
283 Ga0307414_10771293
284 Ga0307411_10444239
285 Ga0307411_11101687
286 Ga0307411_11732295
287 Ga0307415_100125528
288 Ga0307415_100519184
289 Ga0307415_100935941
290 Ga0373950_0080342
291 Ga0373938_0062042
292 Ga0373940_0013504
293 Ga0373942_0000149
294 Ga0439466_0100740
295 Ga0451797_0265497
296 Ga0451837_0438911
297 Ga0451853_2550968
298 Ga0439448_0013142
299 Ga0439454_030269
300 Ga0439455_0093132
301 Ga0439463_006915
302 Ga0450920_003216
303 Ga0450923_122157
304 Ga0466965_0439256
305 Ga0466963_0643273
306 Ga0466964_0470013
307 Ga0466967_0207869
308 Ga0466967_1536572
309 Ga0466967_1673407
310 Ga0495629_0377136
311 Ga0495658_0024810
312 Ga0495613_0046123
313 Ga0496104_0178127
314 Ga0496105_0045760
315 Ga0496108_0460333
316 Ga0496109_0314407
317 Ga0496109_1377498
318 Ga0496110_0149951
319 Ga0496110_0619539
320 Ga0496111_0076041
321 Ga0496114_0266960
322 Ga0496114_0277491
323 Ga0496118_0378314
324 Ga0501031_0001352
325 Ga0501031_0618024
326 Ga0501032_0072684
327 Ga0501033_0017531
328 Ga0501033_0197203
329 Ga0501034_0186846
330 Ga0501034_0208153
331 Ga0501036_0003594
332 Ga0501036_0005044
333 Ga0501036_0189641
334 Ga0501036_1236984
335 Ga0501036_1258967
336 Ga0501037_0067688
337 Ga0501037_0078331
338 Ga0501037_0443157
339 Ga0501038_0006598
340 Ga0501039_0004940
341 Ga0501039_0008058
342 Ga0501040_0001482
343 Ga0501040_0010160
344 Ga0501040_1330501
345 Ga0501041_0002328
346 Ga0501041_0003842
347 Ga0501041_0194687
348 Ga0501042_0003281
349 Ga0501042_0055894
350 Ga0501042_0060946
351 Ga0501042_0101483
352 Ga0501043_0117506
353 Ga0501046_0005122
354 Ga0501046_0030660
355 Ga0501048_0001265
356 Ga0501048_0002709
357 Ga0501048_0210774
358 Ga0501048_0223619
359 Ga0501048_0340361
360 Ga0501067_0047783
361 Ga0501068_0091378
362 Ga0501068_0296015
363 Ga0501069_0062523
364 Ga0501070_0074937
365 Ga0501070_0143528
366 Ga0501070_1300008
367 Ga0501071_0017083
368 Ga0501071_0029000
369 Ga0501071_0149549
370 Ga0501071_0226561
371 Ga0501071_1445016
372 Ga0501072_0001801
373 Ga0501072_0016995
374 Ga0501072_0094517
375 Ga0501072_0892711
376 Ga0501072_0926701
377 Ga0501073_0201798
378 Ga0501074_0008042
379 Ga0501074_0016431
380 Ga0501074_0063632
381 Ga0501074_0064948
382 Ga0501075_0058454
383 Ga0501075_0363314
384 Ga0501075_0519940
385 Ga0501076_0000352
386 Ga0501076_0002935
387 Ga0501076_0213920
388 Ga0501076_0360482
389 Ga0501077_0001396
390 Ga0501077_0054992
391 Ga0501077_0346091
392 Ga0501079_0002714
393 Ga0501079_0014048
394 Ga0501079_0056003
395 Ga0501079_0177679
396 Ga0501080_0026119
397 Ga0501080_0038974
398 Ga0501081_0010166
399 Ga0501081_0016306
400 Ga0501081_0756908
401 Ga0501083_0118458
402 Ga0501083_0172157
403 Ga0501035_0030735
404 Ga0501035_0054308
405 Ga0501044_0164854
406 Ga0501044_0856222
407 Ga0501045_0000391
408 Ga0501045_0002531
409 Ga0501045_0066571
410 Ga0501045_0549337
411 nmdc:mga03n38_816500_c1
412 nmdc:mga00v17_109610_c1
413 nmdc:mga00v17_60955_c1
414 nmdc:mga0yw44_159546_c1
415 nmdc:mga05p37_417022_c1
416 nmdc:mga09592_208912_c1
417 nmdc:mga09592_842746_c1
418 nmdc:mga0qj67_57013_c2
419 nmdc:mga0qj67_68032_c1
420 nmdc:mga06r32_1465766_c1
421 nmdc:mga06r32_281613_c1
422 nmdc:mga0n895_115830_c1
423 nmdc:mga0n895_396207_c1
424 nmdc:mga0rr50_593941_c1
425 nmdc:mga0a205_438381_c1
426 nmdc:mga0a205_503786_c1
427 Ga0500568_0152854
428 Ga0501084_0038242
429 Ga0501084_0045274
430 Ga0501084_0301425
431 Ga0590074_056745
432 Ga0590075_078414
433 Ga0590077_090882
434 Ga0501082_0017534
435 Ga0501082_0018701
436 Ga0501082_0071298
437 Ga0501082_0110110
438 Ga0530510_0008200
439 Ga0530510_0018507
440 Ga0530510_0033017
441 2558914444
442 2644110603
443 2812363647
444 2855388559
445 2910813139
446 2939661900

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18029

Glyoxalase_6

Glyoxalase-like domain

16

135

0.85

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

14

134

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
6isd-assembly1.cif.gz_B crystal structure of arabidopsis thaliana hppd complexed with sulcotrione 0.7998 77 128
7x5w-assembly1.cif.gz_A-2 crystal structure of athppd-y18022 complex 0.7983 77 130
7ezq-assembly1.cif.gz_A complex structure of athppd with inhibitor y15832 0.7983 77 128
7cqr-assembly1.cif.gz_A complex structure of hppd with y16550 0.7981 77 128
8i0y-assembly1.cif.gz_A crystal structure of athppd-y191713 complex 0.7979 77 130
ID Description Score Start End Superfamily
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8912 76 133 3.30.720.110
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8543 77 126 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8244 77 129 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8009 76 125 3.30.720.110
5yy7B01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7755 77 132 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A420EUJ2-F1-model_v4 VOC family protein 0.9992 1 130
AF-A0A542T837-F1-model_v4 deleted 0.9991 3 130
AF-A0A1C5HRM1-F1-model_v4 Uncharacterized conserved protein PhnB, glyoxalase superfamily 0.999 1 130
AF-A0A5C4QVC2-F1-model_v4 VOC family protein 0.9965 1 130
AF-A0A2W2DTF5-F1-model_v4 Glyoxalase 0.995 1 131

Map