F335434

General Info

Members Datasets Scaffolds Average Seq Length
223 195 223 122

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10036867|Ga0070717_100368672
Length 127
Sequence MTATRVDIAFPYGIDGRRRTSAAANRDQHVRDLVEQVLFTSPGERVMRPDFGSGLLRLVFEPASVEVAATAQYLVQTALEQQLSDVLTVEQVSVEAVDSTITVSVSYVVRATQQREVATFRAPGSAG

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
80 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
81 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
82 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
83 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
84 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
85 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
86 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
87 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
88 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
89 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
90 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
91 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
92 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
93 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
94 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
95 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
96 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
97 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
98 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
99 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
105 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
106 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
107 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
108 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
109 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
110 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
111 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
112 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
113 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
114 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
115 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
116 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
117 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
118 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
119 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
120 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
121 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
122 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
123 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
124 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
125 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
126 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
127 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
128 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
129 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
130 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
131 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
132 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
133 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
134 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
135 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
136 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
137 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
138 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
139 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
140 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
141 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
142 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
143 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
144 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
145 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
146 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
147 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
148 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
149 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
150 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
151 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
152 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
153 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
154 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
155 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
156 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
157 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
158 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
159 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
160 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
161 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
162 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
163 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
164 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
165 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
166 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
167 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
171 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
172 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
177 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
178 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
179 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
180 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
181 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
182 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
183 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
184 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
185 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
186 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
187 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
188 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
189 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
190 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
191 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
192 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
193 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
194 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
195 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.14
Nodule 0
Rhizoplane 2.24
Rhizosphere 92.38
Stem 0
Stem Tuber 0
Unclassified 2.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10399182 3300005290 Bacteria 733
2 Ga0065715_10756214 3300005293 Bacteria 628
3 Ga0070676_10077004 3300005328 Bacteria 2015
4 Ga0070670_100184455 3300005331 Bacteria 1811
5 Ga0070677_10094328 3300005333 Bacteria 1307
6 Ga0070666_10118200 3300005335 Bacteria 1837
7 Ga0070680_100641448 3300005336 Bacteria 912
8 Ga0070682_100000002 3300005337 Bacteria 506802
9 Ga0068868_101606396 3300005338 Bacteria 611
10 Ga0070689_100829889 3300005340 Bacteria 814
11 Ga0070669_100567844 3300005353 Bacteria 947
12 Ga0070669_101482996 3300005353 Bacteria 589
13 Ga0070675_100557863 3300005354 Bacteria 1036
14 Ga0070675_101164787 3300005354 Bacteria 709
15 Ga0070671_100417419 3300005355 Bacteria 1149
16 Ga0070674_101024788 3300005356 Bacteria 725
17 Ga0070673_100047001 3300005364 Bacteria 3356
18 Ga0070713_101889624 3300005436 Bacteria 579
19 Ga0070710_10352752 3300005437 Bacteria 974
20 Ga0070700_101533770 3300005441 Bacteria 567
21 Ga0070663_100034685 3300005455 Bacteria 3496
22 Ga0070678_100995047 3300005456 Bacteria 770
23 Ga0070681_10531794 3300005458 Bacteria 1089
24 Ga0068867_100020602 3300005459 Bacteria 4698
25 Ga0070707_100126983 3300005468 Bacteria 2478
26 Ga0070698_100004299 3300005471 Bacteria 15666
27 Ga0070698_100220023 3300005471 Bacteria 1832
28 Ga0070699_100455436 3300005518 Bacteria 1160
29 Ga0070697_101568303 3300005536 Bacteria 589
30 Ga0070672_100112870 3300005543 Bacteria 2217
31 Ga0070686_100437820 3300005544 Bacteria 1002
32 Ga0070696_100013767 3300005546 Bacteria 5432
33 Ga0070704_100343931 3300005549 Bacteria 1257
34 Ga0070704_101113571 3300005549 Bacteria 717
35 Ga0070664_102391138 3300005564 Unclassified 501
36 Ga0068864_100410173 3300005618 Bacteria 1289
37 Ga0068858_100187619 3300005842 Bacteria 1953
38 Ga0068858_102478562 3300005842 Bacteria 512
39 Ga0068860_100457753 3300005843 Unclassified 1269
40 Ga0068862_101737988 3300005844 Bacteria 632
41 Ga0081455_10003071 3300005937 Bacteria 19459
42 Ga0070717_10036867 3300006028 Bacteria 3968
43 Ga0070717_10183860 3300006028 Bacteria 1823
44 Ga0070712_100658743 3300006175 Bacteria 890
45 Ga0068871_102275261 3300006358 Bacteria 517
46 Ga0075431_100003148 3300006847 Bacteria 15950
47 Ga0075433_10488750 3300006852 Bacteria 1084
48 Ga0075429_100191810 3300006880 Bacteria 1790
49 Ga0068865_100592098 3300006881 Bacteria 936
50 Ga0111539_10223720 3300009094 Bacteria 2192
51 Ga0105245_11838271 3300009098 Bacteria 659
52 Ga0114129_10000891 3300009147 Bacteria 38929
53 Ga0114129_12933096 3300009147 Bacteria 563
54 Ga0105243_10694391 3300009148 Bacteria 991
55 Ga0105242_10163588 3300009176 Bacteria 1950
56 Ga0105242_10424868 3300009176 Bacteria 1246
57 Ga0105248_11708105 3300009177 Bacteria 714
58 Ga0157378_10320187 3300013297 Bacteria 1506
59 Ga0157375_10076522 3300013308 Bacteria 3374
60 Ga0157375_10465308 3300013308 Bacteria 1430
61 Ga0157375_11019677 3300013308 Bacteria 967
62 Ga0157380_10786864 3300014326 Bacteria 967
63 Ga0157380_10837147 3300014326 Bacteria 940
64 Ga0157380_12183100 3300014326 Bacteria 617
65 Ga0157379_12295530 3300014968 Bacteria 537
66 Ga0157376_10805436 3300014969 Bacteria 952
67 Ga0163161_10031176 3300017792 Bacteria 3797
68 Ga0207682_10004785 3300025893 Bacteria 5610
69 Ga0207680_10373198 3300025903 Bacteria 1005
70 Ga0207645_10078462 3300025907 Bacteria 2116
71 Ga0207660_10568643 3300025917 Bacteria 922
72 Ga0207646_10272474 3300025922 Bacteria 1530
73 Ga0207700_10451554 3300025928 Bacteria 1133
74 Ga0207644_11062936 3300025931 Bacteria 680
75 Ga0207686_10082950 3300025934 Bacteria 2097
76 Ga0207686_10271603 3300025934 Bacteria 1247
77 Ga0207704_11962111 3300025938 Bacteria 504
78 Ga0207691_10124889 3300025940 Bacteria 2278
79 Ga0207691_10711393 3300025940 Bacteria 847
80 Ga0207691_11634245 3300025940 Bacteria 523
81 Ga0207711_10079208 3300025941 Bacteria 2867
82 Ga0207689_10354411 3300025942 Bacteria 1220
83 Ga0207677_11249138 3300026023 Bacteria 681
84 Ga0207703_10349160 3300026035 Bacteria 1361
85 Ga0207703_11500246 3300026035 Bacteria 649
86 Ga0207678_10106972 3300026067 Bacteria 2386
87 Ga0207648_10018824 3300026089 Bacteria 6242
88 Ga0207675_100037811 3300026118 Bacteria 4502
89 Ga0207683_10000378 3300026121 Bacteria 41000
90 Ga0207698_11194035 3300026142 Bacteria 775
91 Ga0207428_10697919 3300027907 Bacteria 726
92 Ga0268266_10599931 3300028379 Bacteria 1058
93 Ga0268265_12106396 3300028380 Bacteria 571
94 Ga0268264_10321116 3300028381 Unclassified 1464
95 Ga0307515_10218943 3300028794 Bacteria 1727
96 Ga0307513_10503122 3300031456 Unclassified 929
97 Ga0307509_10094305 3300031507 Bacteria 3052
98 Ga0373934_0082364 3300035086 Bacteria 1293
99 Ga0373923_0004754 3300035111 Bacteria 4540
100 Ga0373945_0018099 3300035116 Bacteria 2394
101 Ga0373953_0024433 3300035117 Bacteria 2297
102 Ga0373954_0006708 3300035118 Bacteria 5021
103 Ga0373956_0148330 3300035119 Bacteria 1103
104 Ga0373957_0430954 3300035120 Bacteria 569
105 Ga0373943_0001215 3300035170 Bacteria 11520
106 Ga0373946_0009151 3300035171 Bacteria 3645
107 Ga0373955_0000030 3300035172 Bacteria 56889
108 Ga0316574_0119052 3300035398 Bacteria 1695
109 Ga0373924_0001737 3300035410 Bacteria 7193
110 Ga0373931_0645434 3300035691 Bacteria 695
111 Ga0373935_0000187 3300035692 Bacteria 29255
112 Ga0373927_0005916 3300035695 Bacteria 8379
113 Ga0373933_0004479 3300035724 Bacteria 7662
114 Ga0373947_0001271 3300035725 Bacteria 15544
115 Ga0373937_0000004 3300036401 Bacteria 212269
116 Ga0373925_0000095 3300037068 Bacteria 95071
117 Ga0395900_1172771 3300037418 Bacteria 684
118 Ga0395898_0648505 3300037466 Bacteria 998
119 Ga0395901_0238566 3300038443 Bacteria 1897
120 Ga0400488_55484 3300038741 Bacteria 4750
121 Ga0451837_0699663 3300041494 Bacteria 1733
122 Ga0439450_205440 3300042008 Bacteria 528
123 Ga0495592_0000029 3300046454 Bacteria 131879
124 Ga0495629_0012580 3300046459 Bacteria 6127
125 Ga0495638_0000093 3300046460 Bacteria 142356
126 Ga0495651_0000535 3300046462 Bacteria 29302
127 Ga0495653_0000045 3300046463 Bacteria 115410
128 Ga0495580_0129902 3300046472 Bacteria 1748
129 Ga0495582_0042114 3300046473 Bacteria 2516
130 Ga0495605_0016521 3300046474 Bacteria 3993
131 Ga0495662_0000642 3300046476 Bacteria 16356
132 Ga0495664_0000004 3300046477 Bacteria 489411
133 Ga0495585_0041337 3300046492 Bacteria 2586
134 Ga0495585_0333084 3300046492 Bacteria 740
135 Ga0495596_0007158 3300046500 Bacteria 5050
136 Ga0495583_0155793 3300046506 Bacteria 945
137 Ga0495608_0000017 3300046511 Bacteria 192929
138 Ga0495616_0181431 3300046513 Bacteria 935
139 Ga0495618_0000006 3300046514 Bacteria 229906
140 Ga0495620_0060970 3300046515 Bacteria 1571
141 Ga0495628_0000001 3300046516 Bacteria 917742
142 Ga0495630_0000303 3300046517 Bacteria 39488
143 Ga0495631_0007317 3300046518 Bacteria 5622
144 Ga0495631_0073932 3300046518 Bacteria 1471
145 Ga0495632_0156589 3300046519 Unclassified 1051
146 Ga0495632_0390218 3300046519 Bacteria 609
147 Ga0495643_0031940 3300046522 Bacteria 2926
148 Ga0495652_0000002 3300046529 Bacteria 946606
149 Ga0495665_0106211 3300046531 Bacteria 1473
150 Ga0495640_0000001 3300046533 Bacteria 853827
151 Ga0495586_0095690 3300046535 Bacteria 1644
152 Ga0495587_0000008 3300046536 Bacteria 271097
153 Ga0495609_0005182 3300046538 Bacteria 6936
154 Ga0495609_0158345 3300046538 Unclassified 961
155 Ga0495645_0000002 3300046543 Bacteria 651644
156 Ga0495622_0028595 3300046557 Bacteria 2603
157 Ga0495667_0000029 3300046559 Bacteria 151568
158 Ga0495668_0022795 3300046616 Bacteria 3577
159 Ga0495668_0127333 3300046616 Bacteria 1394
160 Ga0495634_0000082 3300046642 Bacteria 74301
161 Ga0495634_0894527 3300046642 Bacteria 503
162 Ga0495611_0054156 3300046648 Bacteria 1813
163 Ga0495635_0000002 3300046663 Bacteria 490490
164 Ga0495657_0000064 3300046675 Bacteria 94324
165 Ga0495599_0000064 3300046678 Bacteria 73422
166 Ga0495623_0000065 3300046679 Bacteria 65151
167 Ga0495646_0000023 3300046680 Bacteria 110212
168 Ga0495658_0042946 3300046683 Bacteria 2526
169 Ga0495658_0373346 3300046683 Bacteria 908
170 Ga0495613_0012990 3300046689 Bacteria 6187
171 Ga0495624_0021036 3300046690 Bacteria 4332
172 Ga0495670_0597601 3300046691 Bacteria 601
173 Ga0495589_0052361 3300046794 Bacteria 2017
174 Ga0495600_0000010 3300046809 Bacteria 143675
175 Ga0495581_0123645 3300047315 Bacteria 1506
176 Ga0495604_0000009 3300047317 Bacteria 326341
177 Ga0495636_0068775 3300047318 Bacteria 1508
178 Ga0495674_0000002 3300047319 Bacteria 642785
179 Ga0495672_0102968 3300047320 Bacteria 1545
180 Ga0495676_0013486 3300047321 Bacteria 7345
181 Ga0495676_0565068 3300047321 Bacteria 742
182 Ga0495680_0000263 3300047322 Bacteria 58120
183 Ga0495683_0091667 3300047323 Unclassified 1472
184 Ga0495675_0000178 3300047444 Bacteria 46542
185 Ga0495677_0172174 3300047445 Bacteria 838
186 Ga0495673_0014989 3300047469 Bacteria 4011
187 Ga0495684_0000006 3300047471 Bacteria 247568
188 Ga0495593_0000938 3300047673 Bacteria 16993
189 Ga0495602_0000005 3300048088 Bacteria 325957
190 Ga0496100_1584251 3300048903 Bacteria 517
191 Ga0496101_0111080 3300048904 Bacteria 2063
192 Ga0496105_0137746 3300048908 Bacteria 2010
193 Ga0496114_0106041 3300048917 Bacteria 2404
194 Ga0496114_1305720 3300048917 Bacteria 612
195 Ga0495678_016845 3300049459 Bacteria 3328
196 Ga0495682_0175994 3300049460 Bacteria 761
197 Ga0501031_0266254 3300049568 Bacteria 1113
198 Ga0501036_0178728 3300049572 Bacteria 1787
199 Ga0501037_0217881 3300049573 Bacteria 1344
200 Ga0501039_0076450 3300049575 Bacteria 2603
201 Ga0501039_0093397 3300049575 Bacteria 2345
202 Ga0501072_0206703 3300049588 Bacteria 1565
203 Ga0501072_0586016 3300049588 Bacteria 880
204 Ga0501045_1000538 3300049824 Bacteria 613
205 nmdc:mga05p37_8001_c1 3300050507 Bacteria 12478
206 nmdc:mga09592_38963_c1 3300050508 Bacteria 3991
207 nmdc:mga0qj67_1883_c1 3300050509 Bacteria 14875
208 nmdc:mga06r32_58874_c1 3300050510 Bacteria 3693
209 nmdc:mga08y16_216152_c1 3300050511 Bacteria 1985
210 nmdc:mga0n895_1051646_c1 3300050512 Bacteria 793
211 nmdc:mga0n895_1451224_c1 3300050512 Bacteria 653
212 Ga0495601_0000002 3300053077 Bacteria 528704
213 Ga0495612_0000010 3300053078 Bacteria 227618
214 Ga0495595_0000020 3300053084 Bacteria 115983
215 Ga0495619_0000110 3300053085 Bacteria 61419
216 Ga0500650_0184191 3300053098 Unclassified 956
217 Ga0500594_0001033 3300053118 Bacteria 5955
218 Ga0500568_0203271 3300053139 Bacteria 725
219 Ga0500577_0228199 3300053142 Unclassified 807
220 Ga0500616_0002984 3300053153 Bacteria 13394
221 Ga0500627_0252332 3300053158 Unclassified 780
222 Ga0500645_210641 3300053730 Unclassified 522
223 Ga0501082_0740911 3300060353 Bacteria 860

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048903 Ga0496100_1584251 Ga0496100_1584251_165_500 109
2 3300005842 Ga0068858_102478562 Ga0068858_1024785621 117
3 3300014326 Ga0157380_12183100 Ga0157380_121831002 117
4 3300026035 Ga0207703_11500246 Ga0207703_115002462 117
5 3300005471 Ga0070698_100220023 Ga0070698_1002200233 118
6 3300005544 Ga0070686_100437820 Ga0070686_1004378202 118
7 3300026142 Ga0207698_11194035 Ga0207698_111940352 118
8 3300042008 Ga0439450_205440 Ga0439450_205440_78_443 118
9 3300048908 Ga0496105_0137746 Ga0496105_0137746_1440_1805 118
10 3300005293 Ga0065715_10756214 Ga0065715_107562141 120
11 3300006881 Ga0068865_100592098 Ga0068865_1005920982 120
12 3300013297 Ga0157378_10320187 Ga0157378_103201874 120
13 3300025938 Ga0207704_11962111 Ga0207704_119621111 120
14 3300037418 Ga0395900_1172771 Ga0395900_1172771_83_445 120
15 3300037466 Ga0395898_0648505 Ga0395898_0648505_619_981 120
16 3300038443 Ga0395901_0238566 Ga0395901_0238566_650_1012 120
17 3300005337 Ga0070682_100000002 Ga0070682_100000002151 121
18 3300005436 Ga0070713_101889624 Ga0070713_1018896241 121
19 3300005437 Ga0070710_10352752 Ga0070710_103527522 121
20 3300005468 Ga0070707_100126983 Ga0070707_1001269834 121
21 3300005471 Ga0070698_100004299 Ga0070698_10000429911 121
22 3300005536 Ga0070697_101568303 Ga0070697_1015683031 121
23 3300005564 Ga0070664_102391138 Ga0070664_1023911382 121
24 3300013308 Ga0157375_10076522 Ga0157375_100765226 121
25 3300025922 Ga0207646_10272474 Ga0207646_102724742 121
26 3300025928 Ga0207700_10451554 Ga0207700_104515542 121
27 3300025942 Ga0207689_10354411 Ga0207689_103544112 121
28 3300035398 Ga0316574_0119052 Ga0316574_0119052_436_801 121
29 3300048917 Ga0496114_1305720 Ga0496114_1305720_51_416 121
30 3300049568 Ga0501031_0266254 Ga0501031_0266254_433_798 121
31 3300049575 Ga0501039_0093397 Ga0501039_0093397_214_579 121
32 3300005290 Ga0065712_10399182 Ga0065712_103991822 122
33 3300005328 Ga0070676_10077004 Ga0070676_100770042 122
34 3300005331 Ga0070670_100184455 Ga0070670_1001844552 122
35 3300005333 Ga0070677_10094328 Ga0070677_100943283 122
36 3300005335 Ga0070666_10118200 Ga0070666_101182004 122
37 3300005336 Ga0070680_100641448 Ga0070680_1006414481 122
38 3300005338 Ga0068868_101606396 Ga0068868_1016063962 122
39 3300005340 Ga0070689_100829889 Ga0070689_1008298892 122
40 3300005353 Ga0070669_100567844 Ga0070669_1005678443 122
41 3300005353 Ga0070669_101482996 Ga0070669_1014829962 122
42 3300005354 Ga0070675_100557863 Ga0070675_1005578632 122
43 3300005354 Ga0070675_101164787 Ga0070675_1011647872 122
44 3300005355 Ga0070671_100417419 Ga0070671_1004174192 122
45 3300005356 Ga0070674_101024788 Ga0070674_1010247882 122
46 3300005364 Ga0070673_100047001 Ga0070673_1000470012 122
47 3300005441 Ga0070700_101533770 Ga0070700_1015337701 122
48 3300005455 Ga0070663_100034685 Ga0070663_1000346852 122
49 3300005456 Ga0070678_100995047 Ga0070678_1009950471 122
50 3300005458 Ga0070681_10531794 Ga0070681_105317941 122
51 3300005459 Ga0068867_100020602 Ga0068867_1000206023 122
52 3300005518 Ga0070699_100455436 Ga0070699_1004554362 122
53 3300005543 Ga0070672_100112870 Ga0070672_1001128701 122
54 3300005546 Ga0070696_100013767 Ga0070696_1000137677 122
55 3300005549 Ga0070704_100343931 Ga0070704_1003439313 122
56 3300005549 Ga0070704_101113571 Ga0070704_1011135712 122
57 3300005618 Ga0068864_100410173 Ga0068864_1004101733 122
58 3300005842 Ga0068858_100187619 Ga0068858_1001876192 122
59 3300005843 Ga0068860_100457753 Ga0068860_1004577533 122
60 3300005844 Ga0068862_101737988 Ga0068862_1017379882 122
61 3300005937 Ga0081455_10003071 Ga0081455_1000307111 122
62 3300006028 Ga0070717_10036867 Ga0070717_100368672 122
63 3300006028 Ga0070717_10183860 Ga0070717_101838604 122
64 3300006175 Ga0070712_100658743 Ga0070712_1006587432 122
65 3300006358 Ga0068871_102275261 Ga0068871_1022752611 122
66 3300006847 Ga0075431_100003148 Ga0075431_1000031486 122
67 3300006852 Ga0075433_10488750 Ga0075433_104887503 122
68 3300006880 Ga0075429_100191810 Ga0075429_1001918104 122
69 3300009094 Ga0111539_10223720 Ga0111539_102237202 122
70 3300009098 Ga0105245_11838271 Ga0105245_118382712 122
71 3300009147 Ga0114129_10000891 Ga0114129_100008914 122
72 3300009147 Ga0114129_12933096 Ga0114129_129330962 122
73 3300009148 Ga0105243_10694391 Ga0105243_106943913 122
74 3300009176 Ga0105242_10163588 Ga0105242_101635882 122
75 3300009176 Ga0105242_10424868 Ga0105242_104248682 122
76 3300009177 Ga0105248_11708105 Ga0105248_117081052 122
77 3300013308 Ga0157375_10465308 Ga0157375_104653083 122
78 3300013308 Ga0157375_11019677 Ga0157375_110196772 122
79 3300014326 Ga0157380_10786864 Ga0157380_107868642 122
80 3300014326 Ga0157380_10837147 Ga0157380_108371472 122
81 3300014968 Ga0157379_12295530 Ga0157379_122955301 122
82 3300014969 Ga0157376_10805436 Ga0157376_108054362 122
83 3300017792 Ga0163161_10031176 Ga0163161_100311763 122
84 3300025893 Ga0207682_10004785 Ga0207682_100047853 122
85 3300025903 Ga0207680_10373198 Ga0207680_103731982 122
86 3300025907 Ga0207645_10078462 Ga0207645_100784623 122
87 3300025917 Ga0207660_10568643 Ga0207660_105686431 122
88 3300025931 Ga0207644_11062936 Ga0207644_110629362 122
89 3300025934 Ga0207686_10082950 Ga0207686_100829503 122
90 3300025934 Ga0207686_10271603 Ga0207686_102716032 122
91 3300025940 Ga0207691_10124889 Ga0207691_101248892 122
92 3300025940 Ga0207691_10711393 Ga0207691_107113932 122
93 3300025940 Ga0207691_11634245 Ga0207691_116342452 122
94 3300025941 Ga0207711_10079208 Ga0207711_100792084 122
95 3300026023 Ga0207677_11249138 Ga0207677_112491382 122
96 3300026035 Ga0207703_10349160 Ga0207703_103491603 122
97 3300026067 Ga0207678_10106972 Ga0207678_101069722 122
98 3300026089 Ga0207648_10018824 Ga0207648_100188244 122
99 3300026118 Ga0207675_100037811 Ga0207675_1000378112 122
100 3300026121 Ga0207683_10000378 Ga0207683_1000037811 122
101 3300027907 Ga0207428_10697919 Ga0207428_106979192 122
102 3300028379 Ga0268266_10599931 Ga0268266_105999312 122
103 3300028380 Ga0268265_12106396 Ga0268265_121063962 122
104 3300028381 Ga0268264_10321116 Ga0268264_103211162 122
105 3300028794 Ga0307515_10218943 Ga0307515_102189432 122
106 3300031456 Ga0307513_10503122 Ga0307513_105031222 122
107 3300031507 Ga0307509_10094305 Ga0307509_100943055 122
108 3300035086 Ga0373934_0082364 Ga0373934_0082364_406_774 122
109 3300035111 Ga0373923_0004754 Ga0373923_0004754_1889_2257 122
110 3300035116 Ga0373945_0018099 Ga0373945_0018099_419_787 122
111 3300035117 Ga0373953_0024433 Ga0373953_0024433_1446_1814 122
112 3300035118 Ga0373954_0006708 Ga0373954_0006708_1574_1942 122
113 3300035119 Ga0373956_0148330 Ga0373956_0148330_301_669 122
114 3300035120 Ga0373957_0430954 Ga0373957_0430954_178_546 122
115 3300035170 Ga0373943_0001215 Ga0373943_0001215_483_851 122
116 3300035171 Ga0373946_0009151 Ga0373946_0009151_2899_3267 122
117 3300035172 Ga0373955_0000030 Ga0373955_0000030_22011_22379 122
118 3300035410 Ga0373924_0001737 Ga0373924_0001737_6397_6765 122
119 3300035691 Ga0373931_0645434 Ga0373931_0645434_243_611 122
120 3300035692 Ga0373935_0000187 Ga0373935_0000187_14178_14546 122
121 3300035695 Ga0373927_0005916 Ga0373927_0005916_3575_3943 122
122 3300035724 Ga0373933_0004479 Ga0373933_0004479_99_467 122
123 3300035725 Ga0373947_0001271 Ga0373947_0001271_1201_1569 122
124 3300036401 Ga0373937_0000004 Ga0373937_0000004_184478_184846 122
125 3300037068 Ga0373925_0000095 Ga0373925_0000095_28167_28535 122
126 3300038741 Ga0400488_55484 Ga0400488_55484_489_857 122
127 3300041494 Ga0451837_0699663 Ga0451837_0699663_1247_1618 122
128 3300046454 Ga0495592_0000029 Ga0495592_0000029_30023_30391 122
129 3300046459 Ga0495629_0012580 Ga0495629_0012580_2582_2950 122
130 3300046460 Ga0495638_0000093 Ga0495638_0000093_68958_69329 122
131 3300046462 Ga0495651_0000535 Ga0495651_0000535_15691_16059 122
132 3300046463 Ga0495653_0000045 Ga0495653_0000045_59676_60044 122
133 3300046472 Ga0495580_0129902 Ga0495580_0129902_420_788 122
134 3300046473 Ga0495582_0042114 Ga0495582_0042114_1177_1545 122
135 3300046474 Ga0495605_0016521 Ga0495605_0016521_686_1057 122
136 3300046476 Ga0495662_0000642 Ga0495662_0000642_9201_9569 122
137 3300046477 Ga0495664_0000004 Ga0495664_0000004_59687_60055 122
138 3300046492 Ga0495585_0041337 Ga0495585_0041337_1357_1728 122
139 3300046492 Ga0495585_0333084 Ga0495585_0333084_319_690 122
140 3300046500 Ga0495596_0007158 Ga0495596_0007158_2731_3099 122
141 3300046506 Ga0495583_0155793 Ga0495583_0155793_441_809 122
142 3300046511 Ga0495608_0000017 Ga0495608_0000017_59674_60042 122
143 3300046513 Ga0495616_0181431 Ga0495616_0181431_128_496 122
144 3300046514 Ga0495618_0000006 Ga0495618_0000006_18780_19148 122
145 3300046515 Ga0495620_0060970 Ga0495620_0060970_1021_1392 122
146 3300046516 Ga0495628_0000001 Ga0495628_0000001_59676_60044 122
147 3300046517 Ga0495630_0000303 Ga0495630_0000303_12543_12911 122
148 3300046518 Ga0495631_0007317 Ga0495631_0007317_368_739 122
149 3300046518 Ga0495631_0073932 Ga0495631_0073932_511_879 122
150 3300046519 Ga0495632_0156589 Ga0495632_0156589_463_834 122
151 3300046519 Ga0495632_0390218 Ga0495632_0390218_95_463 122
152 3300046522 Ga0495643_0031940 Ga0495643_0031940_2487_2855 122
153 3300046529 Ga0495652_0000002 Ga0495652_0000002_274210_274578 122
154 3300046531 Ga0495665_0106211 Ga0495665_0106211_683_1051 122
155 3300046533 Ga0495640_0000001 Ga0495640_0000001_368214_368582 122
156 3300046535 Ga0495586_0095690 Ga0495586_0095690_161_529 122
157 3300046536 Ga0495587_0000008 Ga0495587_0000008_59894_60262 122
158 3300046538 Ga0495609_0005182 Ga0495609_0005182_5867_6235 122
159 3300046538 Ga0495609_0158345 Ga0495609_0158345_86_457 122
160 3300046543 Ga0495645_0000002 Ga0495645_0000002_59689_60057 122
161 3300046557 Ga0495622_0028595 Ga0495622_0028595_1103_1471 122
162 3300046559 Ga0495667_0000029 Ga0495667_0000029_59685_60053 122
163 3300046616 Ga0495668_0022795 Ga0495668_0022795_1174_1545 122
164 3300046616 Ga0495668_0127333 Ga0495668_0127333_960_1328 122
165 3300046642 Ga0495634_0000082 Ga0495634_0000082_14539_14907 122
166 3300046642 Ga0495634_0894527 Ga0495634_0894527_15_383 122
167 3300046648 Ga0495611_0054156 Ga0495611_0054156_297_668 122
168 3300046663 Ga0495635_0000002 Ga0495635_0000002_426880_427248 122
169 3300046675 Ga0495657_0000064 Ga0495657_0000064_34270_34638 122
170 3300046678 Ga0495599_0000064 Ga0495599_0000064_59688_60056 122
171 3300046679 Ga0495623_0000065 Ga0495623_0000065_59703_60071 122
172 3300046680 Ga0495646_0000023 Ga0495646_0000023_59563_59931 122
173 3300046683 Ga0495658_0042946 Ga0495658_0042946_1677_2045 122
174 3300046683 Ga0495658_0373346 Ga0495658_0373346_416_784 122
175 3300046689 Ga0495613_0012990 Ga0495613_0012990_1071_1439 122
176 3300046690 Ga0495624_0021036 Ga0495624_0021036_1053_1421 122
177 3300046691 Ga0495670_0597601 Ga0495670_0597601_70_441 122
178 3300046794 Ga0495589_0052361 Ga0495589_0052361_412_780 122
179 3300046809 Ga0495600_0000010 Ga0495600_0000010_64925_65293 122
180 3300047315 Ga0495581_0123645 Ga0495581_0123645_739_1107 122
181 3300047317 Ga0495604_0000009 Ga0495604_0000009_266248_266616 122
182 3300047318 Ga0495636_0068775 Ga0495636_0068775_256_627 122
183 3300047319 Ga0495674_0000002 Ga0495674_0000002_59677_60045 122
184 3300047320 Ga0495672_0102968 Ga0495672_0102968_917_1285 122
185 3300047321 Ga0495676_0013486 Ga0495676_0013486_5778_6146 122
186 3300047321 Ga0495676_0565068 Ga0495676_0565068_331_699 122
187 3300047322 Ga0495680_0000263 Ga0495680_0000263_44505_44873 122
188 3300047323 Ga0495683_0091667 Ga0495683_0091667_873_1244 122
189 3300047444 Ga0495675_0000178 Ga0495675_0000178_29282_29650 122
190 3300047445 Ga0495677_0172174 Ga0495677_0172174_261_629 122
191 3300047469 Ga0495673_0014989 Ga0495673_0014989_3181_3549 122
192 3300047471 Ga0495684_0000006 Ga0495684_0000006_59636_60004 122
193 3300047673 Ga0495593_0000938 Ga0495593_0000938_6407_6775 122
194 3300048088 Ga0495602_0000005 Ga0495602_0000005_285629_285997 122
195 3300048904 Ga0496101_0111080 Ga0496101_0111080_1073_1444 122
196 3300048917 Ga0496114_0106041 Ga0496114_0106041_1143_1514 122
197 3300049459 Ga0495678_016845 Ga0495678_016845_189_560 122
198 3300049460 Ga0495682_0175994 Ga0495682_0175994_20_388 122
199 3300049572 Ga0501036_0178728 Ga0501036_0178728_1344_1712 122
200 3300049573 Ga0501037_0217881 Ga0501037_0217881_315_689 122
201 3300049575 Ga0501039_0076450 Ga0501039_0076450_742_1116 122
202 3300049588 Ga0501072_0206703 Ga0501072_0206703_581_949 122
203 3300049588 Ga0501072_0586016 Ga0501072_0586016_82_450 122
204 3300049824 Ga0501045_1000538 Ga0501045_1000538_84_452 122
205 3300050507 nmdc:mga05p37_8001_c1 nmdc:mga05p37_8001_c1_6536_6904 122
206 3300050508 nmdc:mga09592_38963_c1 nmdc:mga09592_38963_c1_3217_3585 122
207 3300050509 nmdc:mga0qj67_1883_c1 nmdc:mga0qj67_1883_c1_10450_10824 122
208 3300050510 nmdc:mga06r32_58874_c1 nmdc:mga06r32_58874_c1_2629_2997 122
209 3300050511 nmdc:mga08y16_216152_c1 nmdc:mga08y16_216152_c1_433_801 122
210 3300050512 nmdc:mga0n895_1051646_c1 nmdc:mga0n895_1051646_c1_31_399 122
211 3300050512 nmdc:mga0n895_1451224_c1 nmdc:mga0n895_1451224_c1_32_400 122
212 3300053077 Ga0495601_0000002 Ga0495601_0000002_251417_251785 122
213 3300053078 Ga0495612_0000010 Ga0495612_0000010_187305_187673 122
214 3300053084 Ga0495595_0000020 Ga0495595_0000020_59686_60054 122
215 3300053085 Ga0495619_0000110 Ga0495619_0000110_1386_1754 122
216 3300053098 Ga0500650_0184191 Ga0500650_0184191_489_860 122
217 3300053118 Ga0500594_0001033 Ga0500594_0001033_530_901 122
218 3300053139 Ga0500568_0203271 Ga0500568_0203271_264_632 122
219 3300053142 Ga0500577_0228199 Ga0500577_0228199_185_556 122
220 3300053153 Ga0500616_0002984 Ga0500616_0002984_3444_3815 122
221 3300053158 Ga0500627_0252332 Ga0500627_0252332_19_390 122
222 3300053730 Ga0500645_210641 Ga0500645_210641_20_391 122
223 3300060353 Ga0501082_0740911 Ga0501082_0740911_51_419 122

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04965

GPW_gp25

Baseplate wedge protein gp25

24

114

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6j7m-assembly2.cif.gz_N complex structure of the pseudomonas aeruginosa rhamnosyltransferase earp with the acceptor elongation factor ef-p 0.8813 82 117
6q84-assembly1.cif.gz_C crystal structure of rangtp-pdr6-eif5a export complex 0.8737 82 117
1iz6-assembly3.cif.gz_C crystal structure of translation initiation factor 5a from pyrococcus horikoshii 0.8705 82 116
5dge-assembly1.cif.gz_f coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome 0.8691 82 116
3sr2-assembly3.cif.gz_D crystal structure of human xlf-xrcc4 complex 0.8647 86 116
ID Description Score Start End Superfamily
af_Q9U2D5_568_750_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.893 87 119 2.40.128.20
af_F4JUX3_73_134_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8918 82 115 2.30.30.30
af_A0A1D6L8D5_102_153_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8917 82 116 2.30.30.30
af_Q8I318_33_94_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8915 82 115 2.30.30.30
af_Q9SUR8_88_348_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.8633 86 122 2.120.10.80
ID Description Score Start End GO Terms
AF-A0A0C2D3V1-F1-model_v4 Uncharacterized protein 0.978 72 119
AF-A0A1P8YPY5-F1-model_v4 Lysozyme family protein 0.9742 22 116
AF-A0A519DRW4-F1-model_v4 deleted 0.9554 30 117
AF-A0A429AGL9-F1-model_v4 IraD/Gp25-like domain-containing protein 0.9519 17 116
AF-A0A0S8A7G7-F1-model_v4 IraD/Gp25-like domain-containing protein 0.9398 19 111

Feature Viewer

pLDDT pTM Quality
80.6 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map