F335319

General Info

Members Datasets Scaffolds Average Seq Length
223 151 446 136

Family's Representative Sequence

Representative Sequence 3300005457|Ga0070662_101929529|Ga0070662_1019295291
Length 148
Sequence MGRRTLAGSLPRMASDPDCIFCKIVAGELPARKIDEDDRTIAFLDINPGTHGHSLVIPKEHSRDLLEIAPDDLAAVMQAAQRLAKRMPDALGAEGVNLVNSCGAVAWQTVFHFHVHVIPRYSYDTVRLPWAPGDGGERLDEAAAALRA

Samples

Sample ID Description Type Environment
1 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
39 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
40 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
41 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
42 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
43 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
69 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
70 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
71 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
72 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
73 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
74 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
75 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
76 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
77 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
78 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
79 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
80 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
81 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
82 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
83 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
84 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
85 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
86 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
87 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
88 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
89 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
90 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
91 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
92 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
93 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
94 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
95 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
96 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
97 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
98 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
99 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
100 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
101 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
102 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
103 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
104 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
105 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
106 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
107 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
108 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
109 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
110 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
111 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
112 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
113 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
114 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
115 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
116 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
117 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
118 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
119 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
120 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
121 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
122 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
123 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
124 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
125 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
126 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
129 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
130 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
131 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
137 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
138 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
140 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
141 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
142 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
143 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
144 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
145 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
146 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
147 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
148 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
149 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
150 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
151 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.35
Nodule 0
Rhizoplane 13.45
Rhizosphere 79.37
Stem 0
Stem Tuber 0
Unclassified 0.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070662_101929529 3300005457 Bacteria 510
2 Ga0070690_100023835 3300005330 Bacteria 3758
3 Ga0070660_100448683 3300005339 Bacteria 1070
4 Ga0070661_100273102 3300005344 Bacteria 1310
5 Ga0070692_10474162 3300005345 Bacteria 806
6 Ga0070669_100271654 3300005353 Bacteria 1356
7 Ga0070674_100629525 3300005356 Bacteria 910
8 Ga0070659_100517808 3300005366 Bacteria 1018
9 Ga0070667_100757877 3300005367 Bacteria 900
10 Ga0070709_10025029 3300005434 Bacteria 3521
11 Ga0070714_100063872 3300005435 Bacteria 3167
12 Ga0070714_100144440 3300005435 Bacteria 2139
13 Ga0070713_100184990 3300005436 Bacteria 1874
14 Ga0070713_100489694 3300005436 Bacteria 1159
15 Ga0070701_10211024 3300005438 Bacteria 1153
16 Ga0070711_100042738 3300005439 Bacteria 3065
17 Ga0070694_100594106 3300005444 Bacteria 891
18 Ga0070685_10187173 3300005466 Bacteria 1337
19 Ga0070685_10190116 3300005466 Bacteria 1328
20 Ga0070679_100775617 3300005530 Bacteria 902
21 Ga0070679_100788335 3300005530 Bacteria 893
22 Ga0068853_100336401 3300005539 Bacteria 1402
23 Ga0068853_100526492 3300005539 Bacteria 1118
24 Ga0070686_100024109 3300005544 Bacteria 3644
25 Ga0070686_100099177 3300005544 Bacteria 1965
26 Ga0070693_100176591 3300005547 Bacteria 1372
27 Ga0068852_100331422 3300005616 Bacteria 1481
28 Ga0068852_100737816 3300005616 Bacteria 996
29 Ga0068864_100573421 3300005618 Bacteria 1093
30 Ga0068851_10594542 3300005834 Bacteria 673
31 Ga0070717_11218993 3300006028 Bacteria 685
32 Ga0070716_101343698 3300006173 Bacteria 579
33 Ga0070712_100001459 3300006175 Bacteria 14415
34 Ga0070712_100630461 3300006175 Bacteria 909
35 Ga0075428_100309315 3300006844 Bacteria 1698
36 Ga0075435_100313540 3300007076 Bacteria 1342
37 Ga0075435_100470708 3300007076 Bacteria 1085
38 Ga0111539_10363711 3300009094 Bacteria 1684
39 Ga0111539_10615646 3300009094 Bacteria 1265
40 Ga0111539_11568114 3300009094 Unclassified 764
41 Ga0105245_10127522 3300009098 Bacteria 2384
42 Ga0105245_10819641 3300009098 Bacteria 969
43 Ga0105245_12098270 3300009098 Bacteria 619
44 Ga0114129_12032211 3300009147 Bacteria 694
45 Ga0105237_10221984 3300009545 Bacteria 1890
46 Ga0105238_10607280 3300009551 Bacteria 1102
47 Ga0105249_11347602 3300009553 Bacteria 785
48 Ga0105239_10476706 3300010375 Bacteria 1417
49 Ga0105239_11002996 3300010375 Bacteria 960
50 Ga0157374_11679497 3300013296 Bacteria 660
51 Ga0163163_10666315 3300014325 Bacteria 1104
52 Ga0163163_12157448 3300014325 Bacteria 616
53 Ga0182008_10777017 3300014497 Bacteria 554
54 Ga0157377_10048231 3300014745 Bacteria 2389
55 Ga0213874_10004933 3300021377 Bacteria 3083
56 Ga0213876_10167935 3300021384 Bacteria 1167
57 Ga0213876_10220832 3300021384 Bacteria 1007
58 Ga0213875_10004577 3300021388 Bacteria 7550
59 Ga0207692_10007490 3300025898 Bacteria 4476
60 Ga0207688_10054228 3300025901 Bacteria 2249
61 Ga0207699_10124013 3300025906 Bacteria 1675
62 Ga0207643_10343260 3300025908 Bacteria 936
63 Ga0207705_10558775 3300025909 Bacteria 890
64 Ga0207693_10003948 3300025915 Bacteria 12606
65 Ga0207663_10003215 3300025916 Bacteria 7958
66 Ga0207652_11209070 3300025921 Bacteria 658
67 Ga0207694_10719962 3300025924 Bacteria 842
68 Ga0207650_11186913 3300025925 Bacteria 650
69 Ga0207700_10062413 3300025928 Bacteria 2830
70 Ga0207664_10024348 3300025929 Bacteria 4549
71 Ga0207664_10163148 3300025929 Bacteria 1902
72 Ga0207644_10356388 3300025931 Bacteria 1189
73 Ga0207704_10423070 3300025938 Bacteria 1056
74 Ga0207665_10051335 3300025939 Bacteria 2775
75 Ga0207661_10856744 3300025944 Bacteria 837
76 Ga0207679_10179633 3300025945 Bacteria 1750
77 Ga0207668_10205047 3300025972 Bacteria 1573
78 Ga0207668_10704108 3300025972 Bacteria 888
79 Ga0207640_11021076 3300025981 Bacteria 728
80 Ga0207640_11190250 3300025981 Bacteria 677
81 Ga0207677_10196488 3300026023 Bacteria 1600
82 Ga0207677_10244862 3300026023 Bacteria 1453
83 Ga0207677_10352550 3300026023 Bacteria 1233
84 Ga0207639_10409492 3300026041 Bacteria 1223
85 Ga0207639_11146852 3300026041 Bacteria 729
86 Ga0207678_11523494 3300026067 Bacteria 590
87 Ga0207676_10491987 3300026095 Bacteria 1163
88 Ga0207698_10416949 3300026142 Bacteria 1287
89 Ga0207698_10605983 3300026142 Bacteria 1080
90 Ga0268266_11215582 3300028379 Bacteria 729
91 Ga0307413_10056552 3300031824 Bacteria 2394
92 Ga0307409_100976539 3300031995 Bacteria 864
93 Ga0307409_102256479 3300031995 Bacteria 574
94 Ga0307414_11536259 3300032004 Bacteria 620
95 Ga0373934_0296137 3300035086 Bacteria 671
96 Ga0373953_0072955 3300035117 Bacteria 1418
97 Ga0373954_0054190 3300035118 Bacteria 1886
98 Ga0373955_0241335 3300035172 Bacteria 1082
99 Ga0373935_1259972 3300035692 Bacteria 552
100 Ga0373933_0186521 3300035724 Bacteria 1324
101 Ga0395900_0109535 3300037418 Bacteria 2837
102 Ga0395900_0222060 3300037418 Bacteria 1904
103 Ga0395898_0007962 3300037466 Bacteria 11238
104 Ga0395898_0010104 3300037466 Bacteria 9878
105 Ga0395898_0011528 3300037466 Bacteria 9181
106 Ga0395905_0006109 3300037471 Bacteria 12169
107 Ga0395905_0237348 3300037471 Bacteria 1704
108 Ga0395905_0449380 3300037471 Bacteria 1187
109 Ga0395905_1181852 3300037471 Bacteria 668
110 Ga0436364_0261803 3300037853 Bacteria 13274
111 Ga0395901_0004576 3300038443 Bacteria 13969
112 Ga0395901_0092200 3300038443 Bacteria 3171
113 Ga0395901_0989246 3300038443 Bacteria 818
114 Ga0395901_1502356 3300038443 Bacteria 629
115 Ga0242420_010105 3300038996 Bacteria 1562
116 Ga0436365_0377309 3300039437 Bacteria 26799
117 Ga0436365_0398007 3300039437 Bacteria 5758
118 Ga0436365_0712803 3300039437 Bacteria 6376
119 Ga0436363_0116001 3300039450 Bacteria 48959
120 Ga0436363_0315655 3300039450 Bacteria 6108
121 Ga0436362_0542534 3300039453 Bacteria 2580
122 Ga0436362_0597548 3300039453 Bacteria 1896
123 Ga0451839_0283771 3300041496 Bacteria 506
124 Ga0451839_0698771 3300041496 Bacteria 581
125 Ga0466969_0005379 3300044656 Bacteria 6814
126 Ga0466972_0351867 3300044658 Bacteria 689
127 Ga0466965_0295375 3300044683 Bacteria 878
128 Ga0466965_0464043 3300044683 Bacteria 706
129 Ga0466966_0157996 3300044684 Bacteria 1381
130 Ga0466966_0446127 3300044684 Bacteria 778
131 Ga0466966_0697539 3300044684 Bacteria 612
132 Ga0466966_0835412 3300044684 Bacteria 555
133 Ga0466961_0008978 3300044693 Bacteria 6378
134 Ga0466963_0004205 3300044694 Bacteria 8347
135 Ga0466963_0407749 3300044694 Bacteria 958
136 Ga0466971_0038508 3300044719 Bacteria 2146
137 Ga0466971_0080357 3300044719 Bacteria 1486
138 Ga0466968_0074863 3300044735 Bacteria 1479
139 Ga0466968_0140305 3300044735 Bacteria 1105
140 Ga0466970_0531076 3300044765 Bacteria 679
141 Ga0466957_0508292 3300044842 Bacteria 836
142 Ga0466960_0214460 3300044901 Bacteria 1057
143 Ga0466959_0043297 3300045049 Bacteria 3318
144 Ga0466958_0003521 3300045836 Bacteria 8139
145 Ga0466958_0047333 3300045836 Bacteria 2596
146 Ga0466958_0623481 3300045836 Bacteria 702
147 Ga0466967_0129732 3300045976 Bacteria 2339
148 Ga0466967_0419979 3300045976 Bacteria 1303
149 Ga0495651_0110053 3300046462 Bacteria 2038
150 Ga0495651_0430194 3300046462 Bacteria 856
151 Ga0495608_0015582 3300046511 Bacteria 5266
152 Ga0495618_0000030 3300046514 Bacteria 108007
153 Ga0495628_0063859 3300046516 Bacteria 2884
154 Ga0495652_0078292 3300046529 Bacteria 2737
155 Ga0495640_0114711 3300046533 Bacteria 1756
156 Ga0495609_0246917 3300046538 Bacteria 736
157 Ga0495645_0000021 3300046543 Bacteria 137604
158 Ga0495645_0002882 3300046543 Bacteria 11679
159 Ga0495645_0129486 3300046543 Bacteria 1770
160 Ga0495667_0008466 3300046559 Bacteria 6983
161 Ga0495635_0338862 3300046663 Bacteria 1004
162 Ga0495646_0265157 3300046680 Bacteria 917
163 Ga0495658_0189310 3300046683 Bacteria 1279
164 Ga0495624_0225564 3300046690 Bacteria 1136
165 Ga0495600_0141574 3300046809 Bacteria 1560
166 Ga0495604_0027093 3300047317 Bacteria 4560
167 Ga0495680_0025854 3300047322 Bacteria 4853
168 Ga0495602_0382578 3300048088 Bacteria 1008
169 Ga0495626_0435295 3300048091 Bacteria 505
170 Ga0496101_0074292 3300048904 Bacteria 2500
171 Ga0496103_0000569 3300048906 Bacteria 29260
172 Ga0496103_0693956 3300048906 Bacteria 645
173 Ga0496104_0092461 3300048907 Bacteria 2892
174 Ga0496104_0187653 3300048907 Bacteria 1978
175 Ga0496104_1139252 3300048907 Bacteria 683
176 Ga0496105_0072089 3300048908 Bacteria 2855
177 Ga0496105_0289527 3300048908 Bacteria 1319
178 Ga0496105_0370692 3300048908 Bacteria 1141
179 Ga0496105_0725349 3300048908 Bacteria 761
180 Ga0496108_0765526 3300048911 Bacteria 834
181 Ga0496108_0982214 3300048911 Bacteria 722
182 Ga0496108_1690008 3300048911 Bacteria 521
183 Ga0496109_0147964 3300048912 Bacteria 2198
184 Ga0496109_0256394 3300048912 Bacteria 1647
185 Ga0496109_0405801 3300048912 Bacteria 1287
186 Ga0496109_1055136 3300048912 Bacteria 750
187 Ga0496110_1018117 3300048913 Bacteria 736
188 Ga0496111_0115012 3300048914 Bacteria 1983
189 Ga0496111_0237296 3300048914 Bacteria 1354
190 Ga0496111_0267291 3300048914 Bacteria 1269
191 Ga0496111_0311015 3300048914 Bacteria 1167
192 Ga0496112_0005136 3300048915 Bacteria 11250
193 Ga0496112_0044708 3300048915 Bacteria 4340
194 Ga0496112_0096701 3300048915 Bacteria 2923
195 Ga0496112_0291362 3300048915 Bacteria 1578
196 Ga0496112_0759694 3300048915 Bacteria 895
197 Ga0496113_0085176 3300048916 Bacteria 2427
198 Ga0496113_0323451 3300048916 Bacteria 1236
199 Ga0496115_0288635 3300048918 Bacteria 1346
200 Ga0496121_0137780 3300048924 Bacteria 1816
201 Ga0501031_1028962 3300049568 Bacteria 526
202 Ga0501039_0031850 3300049575 Bacteria 4065
203 Ga0501040_0196341 3300049576 Bacteria 1432
204 Ga0501041_0032500 3300049577 Bacteria 3154
205 Ga0501042_0512521 3300049578 Bacteria 871
206 Ga0501071_0993474 3300049587 Bacteria 648
207 Ga0501076_0341025 3300049592 Bacteria 1230
208 Ga0501035_0722871 3300049822 Bacteria 801
209 Ga0501045_0471628 3300049824 Bacteria 933
210 nmdc:mga03n38_779898_c1 3300050490 Bacteria 555
211 nmdc:mga08y16_1600774_c1 3300050511 Bacteria 609
212 nmdc:mga08y16_923650_c1 3300050511 Bacteria 857
213 nmdc:mga0rr50_467964_c1 3300050513 Bacteria 1070
214 nmdc:mga08x19_695522_c1 3300050514 Bacteria 721
215 Ga0495601_0001564 3300053077 Bacteria 12652
216 Ga0495601_0016045 3300053077 Bacteria 4533
217 Ga0495612_0000039 3300053078 Bacteria 62901
218 Ga0495595_0006253 3300053084 Bacteria 4849
219 Ga0500568_0082797 3300053139 Bacteria 1217
220 Ga0500616_0107127 3300053153 Bacteria 1356
221 Ga0501084_0833348 3300054114 Bacteria 776
222 Ga0466962_0026678 3300061719 Bacteria 2773
223 Ga0530510_0723692 3300061734 Bacteria 759
224 Ga0070662_101929529
225 Ga0070690_100023835
226 Ga0070660_100448683
227 Ga0070661_100273102
228 Ga0070692_10474162
229 Ga0070669_100271654
230 Ga0070674_100629525
231 Ga0070659_100517808
232 Ga0070667_100757877
233 Ga0070709_10025029
234 Ga0070714_100063872
235 Ga0070714_100144440
236 Ga0070713_100184990
237 Ga0070713_100489694
238 Ga0070701_10211024
239 Ga0070711_100042738
240 Ga0070694_100594106
241 Ga0070685_10187173
242 Ga0070685_10190116
243 Ga0070679_100775617
244 Ga0070679_100788335
245 Ga0068853_100336401
246 Ga0068853_100526492
247 Ga0070686_100024109
248 Ga0070686_100099177
249 Ga0070693_100176591
250 Ga0068852_100331422
251 Ga0068852_100737816
252 Ga0068864_100573421
253 Ga0068851_10594542
254 Ga0070717_11218993
255 Ga0070716_101343698
256 Ga0070712_100001459
257 Ga0070712_100630461
258 Ga0075428_100309315
259 Ga0075435_100313540
260 Ga0075435_100470708
261 Ga0111539_10363711
262 Ga0111539_10615646
263 Ga0111539_11568114
264 Ga0105245_10127522
265 Ga0105245_10819641
266 Ga0105245_12098270
267 Ga0114129_12032211
268 Ga0105237_10221984
269 Ga0105238_10607280
270 Ga0105249_11347602
271 Ga0105239_10476706
272 Ga0105239_11002996
273 Ga0157374_11679497
274 Ga0163163_10666315
275 Ga0163163_12157448
276 Ga0182008_10777017
277 Ga0157377_10048231
278 Ga0213874_10004933
279 Ga0213876_10167935
280 Ga0213876_10220832
281 Ga0213875_10004577
282 Ga0207692_10007490
283 Ga0207688_10054228
284 Ga0207699_10124013
285 Ga0207643_10343260
286 Ga0207705_10558775
287 Ga0207693_10003948
288 Ga0207663_10003215
289 Ga0207652_11209070
290 Ga0207694_10719962
291 Ga0207650_11186913
292 Ga0207700_10062413
293 Ga0207664_10024348
294 Ga0207664_10163148
295 Ga0207644_10356388
296 Ga0207704_10423070
297 Ga0207665_10051335
298 Ga0207661_10856744
299 Ga0207679_10179633
300 Ga0207668_10205047
301 Ga0207668_10704108
302 Ga0207640_11021076
303 Ga0207640_11190250
304 Ga0207677_10196488
305 Ga0207677_10244862
306 Ga0207677_10352550
307 Ga0207639_10409492
308 Ga0207639_11146852
309 Ga0207678_11523494
310 Ga0207676_10491987
311 Ga0207698_10416949
312 Ga0207698_10605983
313 Ga0268266_11215582
314 Ga0307413_10056552
315 Ga0307409_100976539
316 Ga0307409_102256479
317 Ga0307414_11536259
318 Ga0373934_0296137
319 Ga0373953_0072955
320 Ga0373954_0054190
321 Ga0373955_0241335
322 Ga0373935_1259972
323 Ga0373933_0186521
324 Ga0395900_0109535
325 Ga0395900_0222060
326 Ga0395898_0007962
327 Ga0395898_0010104
328 Ga0395898_0011528
329 Ga0395905_0006109
330 Ga0395905_0237348
331 Ga0395905_0449380
332 Ga0395905_1181852
333 Ga0436364_0261803
334 Ga0395901_0004576
335 Ga0395901_0092200
336 Ga0395901_0989246
337 Ga0395901_1502356
338 Ga0242420_010105
339 Ga0436365_0377309
340 Ga0436365_0398007
341 Ga0436365_0712803
342 Ga0436363_0116001
343 Ga0436363_0315655
344 Ga0436362_0542534
345 Ga0436362_0597548
346 Ga0451839_0283771
347 Ga0451839_0698771
348 Ga0466969_0005379
349 Ga0466972_0351867
350 Ga0466965_0295375
351 Ga0466965_0464043
352 Ga0466966_0157996
353 Ga0466966_0446127
354 Ga0466966_0697539
355 Ga0466966_0835412
356 Ga0466961_0008978
357 Ga0466963_0004205
358 Ga0466963_0407749
359 Ga0466971_0038508
360 Ga0466971_0080357
361 Ga0466968_0074863
362 Ga0466968_0140305
363 Ga0466970_0531076
364 Ga0466957_0508292
365 Ga0466960_0214460
366 Ga0466959_0043297
367 Ga0466958_0003521
368 Ga0466958_0047333
369 Ga0466958_0623481
370 Ga0466967_0129732
371 Ga0466967_0419979
372 Ga0495651_0110053
373 Ga0495651_0430194
374 Ga0495608_0015582
375 Ga0495618_0000030
376 Ga0495628_0063859
377 Ga0495652_0078292
378 Ga0495640_0114711
379 Ga0495609_0246917
380 Ga0495645_0000021
381 Ga0495645_0002882
382 Ga0495645_0129486
383 Ga0495667_0008466
384 Ga0495635_0338862
385 Ga0495646_0265157
386 Ga0495658_0189310
387 Ga0495624_0225564
388 Ga0495600_0141574
389 Ga0495604_0027093
390 Ga0495680_0025854
391 Ga0495602_0382578
392 Ga0495626_0435295
393 Ga0496101_0074292
394 Ga0496103_0000569
395 Ga0496103_0693956
396 Ga0496104_0092461
397 Ga0496104_0187653
398 Ga0496104_1139252
399 Ga0496105_0072089
400 Ga0496105_0289527
401 Ga0496105_0370692
402 Ga0496105_0725349
403 Ga0496108_0765526
404 Ga0496108_0982214
405 Ga0496108_1690008
406 Ga0496109_0147964
407 Ga0496109_0256394
408 Ga0496109_0405801
409 Ga0496109_1055136
410 Ga0496110_1018117
411 Ga0496111_0115012
412 Ga0496111_0237296
413 Ga0496111_0267291
414 Ga0496111_0311015
415 Ga0496112_0005136
416 Ga0496112_0044708
417 Ga0496112_0096701
418 Ga0496112_0291362
419 Ga0496112_0759694
420 Ga0496113_0085176
421 Ga0496113_0323451
422 Ga0496115_0288635
423 Ga0496121_0137780
424 Ga0501031_1028962
425 Ga0501039_0031850
426 Ga0501040_0196341
427 Ga0501041_0032500
428 Ga0501042_0512521
429 Ga0501071_0993474
430 Ga0501076_0341025
431 Ga0501035_0722871
432 Ga0501045_0471628
433 nmdc:mga03n38_779898_c1
434 nmdc:mga08y16_1600774_c1
435 nmdc:mga08y16_923650_c1
436 nmdc:mga0rr50_467964_c1
437 nmdc:mga08x19_695522_c1
438 Ga0495601_0001564
439 Ga0495601_0016045
440 Ga0495612_0000039
441 Ga0495595_0006253
442 Ga0500568_0082797
443 Ga0500616_0107127
444 Ga0501084_0833348
445 Ga0466962_0026678
446 Ga0530510_0723692

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01230

HIT

HIT domain

26

123

0.98

PF11969

DcpS_C

Scavenger mRNA decapping enzyme C-term binding

18

126

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lb5-assembly1.cif.gz_B crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.9534 1 134
3lb5-assembly2.cif.gz_C crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.9527 1 134
3lb5-assembly1.cif.gz_A crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.9479 1 134
3lb5-assembly2.cif.gz_D crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.9356 1 134
3o0m-assembly1.cif.gz_A crystal structure of a zn-bound histidine triad family protein from mycobacterium smegmatis 0.9305 2 134
ID Description Score Start End Superfamily
af_A0A140LH01_2_105_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9548 17 105 3.30.428.10
3lb5A00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9479 1 134 3.30.428.10
1y23D01 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.942 3 112 3.30.428.10
3o0mB00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9367 3 134 3.30.428.10
1y23D01 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.918 3 112 3.30.428.10
ID Description Score Start End GO Terms
AF-A0A838MGY5-F1-model_v4 HIT family protein 0.9792 4 109 GO:0003824
GO:0009117
AF-A0A2E5KGQ5-F1-model_v4 HIT family hydrolase 0.9773 3 112 GO:0009117
GO:0016787
AF-A0A6B2CMD2-F1-model_v4 HIT domain-containing protein 0.9771 3 108 GO:0006790
GO:0009150
GO:0047627
AF-A0A4R0XMN1-F1-model_v4 HIT domain-containing protein 0.9758 4 106 GO:0003824
GO:0009117
AF-A0A3D2CVU6-F1-model_v4 deleted 0.9725 1 103

Map