F334927

General Info

Members Datasets Scaffolds Average Seq Length
222 141 219 293

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0125965|Ga0501031_0125965_454_1473
Length 339
Sequence MLYYNNSNVGREPSGEGMKFMGGPLIFKALSLGRRECGEGAPRTSSLYRALTAAFVVALAGSWPGAAGAAAQPIEILAAENFYGDVAEQIGGADVHVLSILKNPDQDPHLFEVSPSTARAVAGARLVVYNGIDYDPWMDKLLAASPSPERKVIRAADLMHKQSGDNPHLWYDPTTMVAVAQAIAVELAAVDPAHQADYRKNLQAFETSLRPVNERIRAVREKYGGTMVTATEPVFGYMASAVGLKMRNEKFQLAVMNDTEPSAKDVAAFEDDLKAGKVKVLFYNSQTSDDLTRRLMDLADAANIPVVGVSETEPPGTRYQQWMIDQLDSLGQALSTGKM

Samples

Sample ID Description Type Environment
1 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
2 2909042592 Labrys sp. LIt4 Isolate Nodule
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
7 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
17 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
18 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
19 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
20 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
21 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
22 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
23 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
24 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
25 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
26 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
27 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
28 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
29 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
30 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
31 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
32 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
33 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
50 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
51 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
52 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
53 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
54 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
55 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
56 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
57 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
58 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
59 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
60 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
61 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
62 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
63 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
64 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
65 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
66 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
67 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
68 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
69 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
70 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
71 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
72 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
73 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
74 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
75 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
76 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
77 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
78 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
79 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
80 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
81 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
82 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
83 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
84 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
85 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
86 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
87 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
88 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
89 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
90 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
91 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
92 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
93 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
94 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
95 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
96 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
97 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
98 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
99 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
100 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
101 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
102 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
103 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
115 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
116 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
117 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
118 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
119 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
120 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
121 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
122 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
123 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
125 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
126 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
127 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
128 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
129 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
130 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
131 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
132 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
133 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
134 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
135 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
136 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
137 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
138 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
139 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
140 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
141 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.65
Metatranscriptomes 0
Isolates 1.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.86
Nodule 0.9
Rhizoplane 2.7
Rhizosphere 81.08
Stem 0
Stem Tuber 0
Unclassified 9.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10172964 3300003320 Bacteria 1764
2 rootL2_10310267 3300003322 Bacteria 1358
3 Ga0070713_100084269 3300005436 Bacteria 2719
4 Ga0070713_100109068 3300005436 Bacteria 2411
5 Ga0070713_100417781 3300005436 Bacteria 1255
6 Ga0070708_100211041 3300005445 Bacteria 1819
7 Ga0070681_10143308 3300005458 Bacteria 2318
8 Ga0070681_10189228 3300005458 Bacteria 1978
9 Ga0070706_100005029 3300005467 Bacteria 12643
10 Ga0070698_100044929 3300005471 Bacteria 4522
11 Ga0070699_100047471 3300005518 Bacteria 3716
12 Ga0070699_100318090 3300005518 Bacteria 1398
13 Ga0070679_100087553 3300005530 Bacteria 3102
14 Ga0070679_100140317 3300005530 Bacteria 2397
15 Ga0070679_100191404 3300005530 Bacteria 2014
16 Ga0070697_100273200 3300005536 Unclassified 1449
17 Ga0070697_100375857 3300005536 Bacteria 1230
18 Ga0070665_100656071 3300005548 Bacteria 1062
19 Ga0070704_100275257 3300005549 Bacteria 1392
20 Ga0068856_100056268 3300005614 Bacteria 3881
21 Ga0068863_100446428 3300005841 Bacteria 1269
22 Ga0070717_10063520 3300006028 Bacteria 3065
23 Ga0070717_10264623 3300006028 Bacteria 1522
24 Ga0070716_100260730 3300006173 Bacteria 1186
25 Ga0105240_10110839 3300009093 Bacteria 3321
26 Ga0105240_10310614 3300009093 Bacteria 1800
27 Ga0105237_10195654 3300009545 Bacteria 2022
28 Ga0105238_10268271 3300009551 Bacteria 1687
29 Ga0105239_10790298 3300010375 Bacteria 1087
30 Ga0105246_10057787 3300011119 Bacteria 2685
31 Ga0157370_10574562 3300013104 Bacteria 1033
32 Ga0157374_10235397 3300013296 Bacteria 1800
33 Ga0163163_10100137 3300014325 Bacteria 2920
34 Ga0182008_10018774 3300014497 Unclassified 3578
35 Ga0213872_10002900 3300021361 Bacteria 9750
36 Ga0213872_10011440 3300021361 Bacteria 4196
37 Ga0213872_10055157 3300021361 Bacteria 1802
38 Ga0213876_10012856 3300021384 Bacteria 4450
39 Ga0213876_10042811 3300021384 Bacteria 2393
40 Ga0213875_10014533 3300021388 Bacteria 3840
41 Ga0213875_10157817 3300021388 Bacteria 1064
42 Ga0213871_10043767 3300021441 Bacteria 1209
43 Ga0209148_1000799 3300025254 Bacteria 23068
44 Ga0209455_1001082 3300025272 Bacteria 13412
45 Ga0207699_10074715 3300025906 Bacteria 2083
46 Ga0207684_10040535 3300025910 Bacteria 3948
47 Ga0207684_10045615 3300025910 Bacteria 3717
48 Ga0207707_10020489 3300025912 Bacteria 5774
49 Ga0207695_10230667 3300025913 Bacteria 1756
50 Ga0207660_10253989 3300025917 Bacteria 1388
51 Ga0207652_10197623 3300025921 Bacteria 1810
52 Ga0207700_10069758 3300025928 Bacteria 2699
53 Ga0207700_10154318 3300025928 Bacteria 1901
54 Ga0207700_10342190 3300025928 Bacteria 1301
55 Ga0207644_10413871 3300025931 Bacteria 1104
56 Ga0207669_10475854 3300025937 Bacteria 995
57 Ga0207639_10297049 3300026041 Bacteria 1426
58 Ga0207702_10167164 3300026078 Bacteria 2013
59 Ga0207702_10171750 3300026078 Bacteria 1988
60 Ga0207641_10347953 3300026088 Bacteria 1412
61 Ga0207683_10278011 3300026121 Bacteria 1530
62 Ga0268266_10117270 3300028379 Bacteria 2366
63 Ga0268264_10472097 3300028381 Bacteria 1219
64 Ga0265318_10002509 3300028577 Bacteria 9753
65 Ga0265318_10069147 3300028577 Bacteria 1309
66 Ga0265338_10018173 3300028800 Bacteria 7539
67 Ga0265338_10022516 3300028800 Bacteria 6520
68 Ga0265330_10004897 3300031235 Bacteria 6743
69 Ga0265330_10007730 3300031235 Bacteria 5221
70 Ga0265330_10020764 3300031235 Bacteria 3001
71 Ga0265332_10118742 3300031238 Bacteria 1111
72 Ga0265320_10017968 3300031240 Bacteria 3907
73 Ga0265325_10006701 3300031241 Bacteria 6968
74 Ga0265325_10008049 3300031241 Bacteria 6249
75 Ga0265340_10045065 3300031247 Bacteria 2156
76 Ga0265340_10079489 3300031247 Bacteria 1546
77 Ga0265339_10002673 3300031249 Bacteria 12689
78 Ga0265331_10032638 3300031250 Bacteria 2579
79 Ga0265316_10006227 3300031344 Bacteria 11438
80 Ga0265316_10037427 3300031344 Bacteria 3916
81 Ga0265316_10220911 3300031344 Bacteria 1398
82 Ga0265313_10005671 3300031595 Bacteria 9114
83 Ga0265313_10052899 3300031595 Bacteria 1935
84 Ga0265313_10162342 3300031595 Bacteria 948
85 Ga0265314_10001782 3300031711 Bacteria 23250
86 Ga0265314_10028291 3300031711 Bacteria 4180
87 Ga0265314_10053025 3300031711 Bacteria 2815
88 Ga0265314_10081417 3300031711 Bacteria 2133
89 Ga0265314_10109363 3300031711 Bacteria 1759
90 Ga0265314_10189541 3300031711 Bacteria 1225
91 Ga0265342_10054270 3300031712 Bacteria 2381
92 Ga0373923_0097551 3300035111 Unclassified 1293
93 Ga0373954_0007088 3300035118 Bacteria 4893
94 Ga0373954_0169223 3300035118 Bacteria 1070
95 Ga0373956_0018494 3300035119 Unclassified 2952
96 Ga0373956_0062162 3300035119 Bacteria 1692
97 Ga0373957_0009180 3300035120 Bacteria 3229
98 Ga0373955_0011681 3300035172 Bacteria 4196
99 Ga0373955_0113411 3300035172 Bacteria 1569
100 Ga0373924_0079541 3300035410 Bacteria 1393
101 Ga0373931_0032294 3300035691 Bacteria 2709
102 Ga0373927_0141835 3300035695 Bacteria 1572
103 Ga0373933_0003693 3300035724 Bacteria 8466
104 Ga0373933_0136577 3300035724 Bacteria 1545
105 Ga0373933_0308405 3300035724 Unclassified 1025
106 Ga0373947_0165072 3300035725 Bacteria 1434
107 Ga0373937_0007436 3300036401 Bacteria 9480
108 Ga0373937_0013649 3300036401 Bacteria 7158
109 Ga0373937_0030013 3300036401 Bacteria 4925
110 Ga0373937_0033956 3300036401 Bacteria 4637
111 Ga0373937_0607513 3300036401 Bacteria 1038
112 Ga0373925_0051582 3300037068 Bacteria 3071
113 Ga0373925_0140686 3300037068 Bacteria 1888
114 Ga0436364_0008707 3300037853 Bacteria 3360
115 Ga0436364_0280342 3300037853 Bacteria 6241
116 Ga0436364_0653472 3300037853 Bacteria 7684
117 Ga0436364_0791267 3300037853 Bacteria 1354
118 Ga0436364_0964851 3300037853 Bacteria 9366
119 Ga0436364_1308578 3300037853 Bacteria 9659
120 Ga0436364_1340622 3300037853 Bacteria 1061
121 Ga0436364_1365669 3300037853 Bacteria 1483
122 Ga0436365_0060899 3300039437 Bacteria 4062
123 Ga0436365_0138218 3300039437 Bacteria 1402
124 Ga0436365_1890384 3300039437 Bacteria 50687
125 Ga0436360_0119874 3300039438 Bacteria 2784
126 Ga0436360_0160485 3300039438 Bacteria 2799
127 Ga0436360_0294078 3300039438 Bacteria 1045
128 Ga0436360_0583678 3300039438 Bacteria 4217
129 Ga0436361_0119844 3300039447 Bacteria 1579
130 Ga0436361_0125242 3300039447 Bacteria 8016
131 Ga0436361_0130657 3300039447 Bacteria 6432
132 Ga0436361_0177796 3300039447 Bacteria 70210
133 Ga0436361_0411070 3300039447 Bacteria 1273
134 Ga0436361_0445544 3300039447 Bacteria 6130
135 Ga0436361_0616697 3300039447 Bacteria 966
136 Ga0436361_0625890 3300039447 Bacteria 1666
137 Ga0436363_0152659 3300039450 Bacteria 1848
138 Ga0466965_0054415 3300044683 Bacteria 1990
139 Ga0466966_0038059 3300044684 Bacteria 3101
140 Ga0495653_0329769 3300046463 Unclassified 987
141 Ga0495664_0125518 3300046477 Bacteria 1553
142 Ga0495628_0057172 3300046516 Bacteria 3069
143 Ga0495652_0083418 3300046529 Bacteria 2631
144 Ga0495652_0118443 3300046529 Bacteria 2116
145 Ga0495640_0134374 3300046533 Bacteria 1599
146 Ga0495587_0134120 3300046536 Bacteria 1415
147 Ga0495667_0008574 3300046559 Bacteria 6937
148 Ga0495625_0121892 3300046660 Bacteria 1773
149 Ga0495657_0028640 3300046675 Bacteria 3915
150 Ga0495657_0219487 3300046675 Bacteria 1153
151 Ga0495599_0025381 3300046678 Bacteria 3709
152 Ga0495599_0267261 3300046678 Bacteria 1038
153 Ga0495646_0091207 3300046680 Bacteria 1759
154 Ga0495600_0119412 3300046809 Bacteria 1715
155 Ga0495680_0031462 3300047322 Bacteria 4319
156 Ga0495680_0099889 3300047322 Bacteria 2163
157 Ga0495602_0018162 3300048088 Bacteria 7035
158 Ga0495602_0163094 3300048088 Bacteria 1738
159 Ga0496104_0291065 3300048907 Bacteria 1546
160 Ga0496105_0045529 3300048908 Bacteria 3620
161 Ga0496107_0071907 3300048910 Bacteria 2514
162 Ga0496108_0285041 3300048911 Bacteria 1438
163 Ga0496109_0487059 3300048912 Bacteria 1164
164 Ga0496115_0315103 3300048918 Bacteria 1280
165 Ga0496121_0127241 3300048924 Bacteria 1913
166 Ga0496126_0023003 3300048929 Bacteria 6046
167 Ga0501031_0125965 3300049568 Bacteria 1673
168 Ga0501032_0002230 3300049569 Bacteria 15268
169 Ga0501033_0003568 3300049570 Bacteria 12725
170 Ga0501033_0213081 3300049570 Bacteria 1377
171 Ga0501034_0051093 3300049571 Bacteria 4168
172 Ga0501034_0449468 3300049571 Bacteria 1206
173 Ga0501036_0001185 3300049572 Bacteria 19860
174 Ga0501037_0012173 3300049573 Bacteria 6332
175 Ga0501038_0003926 3300049574 Bacteria 13821
176 Ga0501038_0196296 3300049574 Bacteria 1622
177 Ga0501039_0002319 3300049575 Bacteria 14134
178 Ga0501043_0002419 3300049579 Bacteria 15799
179 Ga0501046_0002689 3300049580 Bacteria 16559
180 Ga0501048_0052930 3300049582 Bacteria 2888
181 Ga0501067_0006196 3300049583 Bacteria 6630
182 Ga0501067_0130482 3300049583 Bacteria 1399
183 Ga0501068_0003636 3300049584 Bacteria 8341
184 Ga0501068_0263437 3300049584 Bacteria 1100
185 Ga0501069_0000207 3300049585 Bacteria 26116
186 Ga0501070_0007881 3300049586 Bacteria 9024
187 Ga0501070_0115257 3300049586 Bacteria 2220
188 Ga0501073_0001222 3300049589 Bacteria 18734
189 Ga0501073_0088719 3300049589 Bacteria 2150
190 Ga0501074_0010412 3300049590 Bacteria 6748
191 Ga0501079_0413534 3300049741 Unclassified 1058
192 Ga0501080_0003272 3300049742 Bacteria 14303
193 Ga0501080_0337845 3300049742 Bacteria 1361
194 Ga0501083_0008962 3300049744 Bacteria 7063
195 Ga0501083_0070420 3300049744 Bacteria 2326
196 Ga0501035_0010883 3300049822 Bacteria 8422
197 Ga0501044_0032854 3300049823 Bacteria 5454
198 Ga0501044_0203201 3300049823 Bacteria 1939
199 Ga0501044_0479064 3300049823 Bacteria 1148
200 Ga0501044_0484360 3300049823 Bacteria 1140
201 nmdc:mga04h51_51812_c1 3300050495 Bacteria 1380
202 Ga0495601_0009258 3300053077 Bacteria 5821
203 Ga0495612_0019731 3300053078 Bacteria 2701
204 Ga0495595_0012507 3300053084 Bacteria 3569
205 Ga0495619_0015316 3300053085 Bacteria 4850
206 Ga0495619_0027982 3300053085 Bacteria 3634
207 Ga0500644_0000602 3300053088 Bacteria 13665
208 Ga0500647_0079878 3300053091 Unclassified 1569
209 Ga0500651_0008128 3300053093 Bacteria 6151
210 Ga0500651_0267209 3300053093 Bacteria 990
211 Ga0500595_000006 3300053119 Bacteria 300857
212 Ga0500595_009728 3300053119 Bacteria 3866
213 Ga0500652_014190 3300053131 Bacteria 2842
214 Ga0500616_0000001 3300053153 Bacteria 1986011
215 Ga0500620_000715 3300053155 Bacteria 5674
216 Ga0500645_000106 3300053730 Bacteria 67066
217 Ga0501084_0008180 3300054114 Bacteria 8627
218 Ga0501082_0212482 3300060353 Bacteria 1683
219 Ga0466962_0062922 3300061719 Bacteria 1772

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037853 Ga0436364_1365669 Ga0436364_1365669_301_1203 260
2 3300025937 Ga0207669_10475854 Ga0207669_104758541 262
3 3300039438 Ga0436360_0160485 Ga0436360_0160485_72_890 262
4 3300046660 Ga0495625_0121892 Ga0495625_0121892_781_1662 262
5 3300053155 Ga0500620_000715 Ga0500620_000715_2118_2999 262
6 3300025931 Ga0207644_10413871 Ga0207644_104138711 263
7 3300048924 Ga0496121_0127241 Ga0496121_0127241_771_1655 263
8 3300053119 Ga0500595_000006 Ga0500595_000006_120641_121519 263
9 3300053093 Ga0500651_0008128 Ga0500651_0008128_2238_3113 264
10 3300053093 Ga0500651_0267209 Ga0500651_0267209_53_931 264
11 3300053119 Ga0500595_009728 Ga0500595_009728_2566_3474 264
12 3300053131 Ga0500652_014190 Ga0500652_014190_822_1697 265
13 3300053153 Ga0500616_0000001 Ga0500616_0000001_382582_383460 265
14 3300053730 Ga0500645_000106 Ga0500645_000106_33805_34680 265
15 3300049584 Ga0501068_0263437 Ga0501068_0263437_43_870 267
16 3300053088 Ga0500644_0000602 Ga0500644_0000602_7348_8238 267
17 3300048929 Ga0496126_0023003 Ga0496126_0023003_3669_4583 268
18 3300010375 Ga0105239_10790298 Ga0105239_107902982 269
19 3300031250 Ga0265331_10032638 Ga0265331_100326382 269
20 3300031711 Ga0265314_10109363 Ga0265314_101093632 269
21 3300049583 Ga0501067_0130482 Ga0501067_0130482_10_828 269
22 3300031344 Ga0265316_10037427 Ga0265316_100374273 270
23 3300031711 Ga0265314_10081417 Ga0265314_100814172 270
24 3300046678 Ga0495599_0267261 Ga0495599_0267261_19_852 270
25 3300039437 Ga0436365_0138218 Ga0436365_0138218_358_1191 272
26 3300035118 Ga0373954_0007088 Ga0373954_0007088_3095_3979 274
27 3300035120 Ga0373957_0009180 Ga0373957_0009180_1565_2449 274
28 3300035172 Ga0373955_0011681 Ga0373955_0011681_3112_3996 274
29 3300035695 Ga0373927_0141835 Ga0373927_0141835_122_967 274
30 3300035724 Ga0373933_0003693 Ga0373933_0003693_3395_4279 274
31 3300035724 Ga0373933_0136577 Ga0373933_0136577_689_1531 274
32 3300036401 Ga0373937_0013649 Ga0373937_0013649_2572_3414 274
33 3300036401 Ga0373937_0033956 Ga0373937_0033956_74_958 274
34 3300037068 Ga0373925_0140686 Ga0373925_0140686_435_1277 274
35 3300039447 Ga0436361_0130657 Ga0436361_0130657_3586_4455 274
36 3300046516 Ga0495628_0057172 Ga0495628_0057172_384_1226 274
37 3300046529 Ga0495652_0083418 Ga0495652_0083418_1003_1845 274
38 3300046678 Ga0495599_0025381 Ga0495599_0025381_1117_1959 274
39 3300047322 Ga0495680_0031462 Ga0495680_0031462_2691_3533 274
40 3300031711 Ga0265314_10001782 Ga0265314_1000178211 275
41 iso_pu_bacteria 2909042592 2909045829 275
42 3300005518 Ga0070699_100047471 Ga0070699_1000474712 276
43 3300025906 Ga0207699_10074715 Ga0207699_100747151 276
44 3300028577 Ga0265318_10069147 Ga0265318_100691471 276
45 3300031247 Ga0265340_10079489 Ga0265340_100794891 276
46 3300031595 Ga0265313_10162342 Ga0265313_101623421 276
47 3300039447 Ga0436361_0119844 Ga0436361_0119844_553_1422 276
48 3300039447 Ga0436361_0616697 Ga0436361_0616697_92_946 276
49 3300048910 Ga0496107_0071907 Ga0496107_0071907_1613_2482 276
50 3300048911 Ga0496108_0285041 Ga0496108_0285041_345_1214 276
51 3300048912 Ga0496109_0487059 Ga0496109_0487059_76_945 276
52 3300049571 Ga0501034_0449468 Ga0501034_0449468_16_885 276
53 3300049574 Ga0501038_0196296 Ga0501038_0196296_92_946 276
54 3300049742 Ga0501080_0337845 Ga0501080_0337845_264_1133 276
55 3300049823 Ga0501044_0203201 Ga0501044_0203201_951_1820 276
56 3300005530 Ga0070679_100087553 Ga0070679_1000875532 277
57 3300025917 Ga0207660_10253989 Ga0207660_102539891 277
58 3300026121 Ga0207683_10278011 Ga0207683_102780112 277
59 3300037853 Ga0436364_0653472 Ga0436364_0653472_3199_4068 277
60 3300039438 Ga0436360_0119874 Ga0436360_0119874_1091_1975 277
61 iso_pu_bacteria 2671180139 2671692221 277
62 3300005458 Ga0070681_10143308 Ga0070681_101433083 278
63 3300005530 Ga0070679_100191404 Ga0070679_1001914043 278
64 3300009093 Ga0105240_10110839 Ga0105240_101108393 278
65 3300009093 Ga0105240_10310614 Ga0105240_103106142 278
66 3300009545 Ga0105237_10195654 Ga0105237_101956543 278
67 3300009551 Ga0105238_10268271 Ga0105238_102682712 278
68 3300021384 Ga0213876_10012856 Ga0213876_100128564 278
69 3300025912 Ga0207707_10020489 Ga0207707_100204894 278
70 3300025913 Ga0207695_10230667 Ga0207695_102306672 278
71 3300035691 Ga0373931_0032294 Ga0373931_0032294_711_1580 278
72 3300035725 Ga0373947_0165072 Ga0373947_0165072_14_883 278
73 3300048907 Ga0496104_0291065 Ga0496104_0291065_99_971 278
74 3300048908 Ga0496105_0045529 Ga0496105_0045529_656_1540 278
75 3300048918 Ga0496115_0315103 Ga0496115_0315103_254_1126 278
76 3300053091 Ga0500647_0079878 Ga0500647_0079878_137_1027 278
77 3300005458 Ga0070681_10189228 Ga0070681_101892281 279
78 3300005518 Ga0070699_100318090 Ga0070699_1003180902 279
79 3300005536 Ga0070697_100375857 Ga0070697_1003758572 279
80 3300005548 Ga0070665_100656071 Ga0070665_1006560712 279
81 3300005614 Ga0068856_100056268 Ga0068856_1000562684 279
82 3300005841 Ga0068863_100446428 Ga0068863_1004464282 279
83 3300006173 Ga0070716_100260730 Ga0070716_1002607302 279
84 3300014325 Ga0163163_10100137 Ga0163163_101001372 279
85 3300021361 Ga0213872_10055157 Ga0213872_100551572 279
86 3300021384 Ga0213876_10042811 Ga0213876_100428111 279
87 3300025910 Ga0207684_10045615 Ga0207684_100456154 279
88 3300026041 Ga0207639_10297049 Ga0207639_102970492 279
89 3300026078 Ga0207702_10167164 Ga0207702_101671643 279
90 3300026088 Ga0207641_10347953 Ga0207641_103479531 279
91 3300028379 Ga0268266_10117270 Ga0268266_101172702 279
92 3300035111 Ga0373923_0097551 Ga0373923_0097551_324_1184 279
93 3300035119 Ga0373956_0018494 Ga0373956_0018494_40_900 279
94 3300035410 Ga0373924_0079541 Ga0373924_0079541_246_1106 279
95 3300036401 Ga0373937_0607513 Ga0373937_0607513_159_1019 279
96 3300037853 Ga0436364_0791267 Ga0436364_0791267_416_1294 279
97 3300039437 Ga0436365_0060899 Ga0436365_0060899_1491_2363 279
98 3300039450 Ga0436363_0152659 Ga0436363_0152659_948_1826 279
99 3300044684 Ga0466966_0038059 Ga0466966_0038059_506_1387 279
100 3300046463 Ga0495653_0329769 Ga0495653_0329769_110_970 279
101 3300046533 Ga0495640_0134374 Ga0495640_0134374_165_1025 279
102 3300046536 Ga0495587_0134120 Ga0495587_0134120_130_990 279
103 3300046675 Ga0495657_0219487 Ga0495657_0219487_89_949 279
104 3300047322 Ga0495680_0099889 Ga0495680_0099889_1092_1952 279
105 3300053085 Ga0495619_0015316 Ga0495619_0015316_1785_2645 279
106 3300061719 Ga0466962_0062922 Ga0466962_0062922_459_1340 279
107 3300021441 Ga0213871_10043767 Ga0213871_100437671 280
108 3300026078 Ga0207702_10171750 Ga0207702_101717501 280
109 3300031235 Ga0265330_10004897 Ga0265330_100048975 280
110 3300031241 Ga0265325_10006701 Ga0265325_100067016 280
111 3300031711 Ga0265314_10189541 Ga0265314_101895412 280
112 3300035119 Ga0373956_0062162 Ga0373956_0062162_62_946 280
113 3300039438 Ga0436360_0294078 Ga0436360_0294078_54_923 280
114 3300039438 Ga0436360_0583678 Ga0436360_0583678_598_1464 280
115 3300039447 Ga0436361_0625890 Ga0436361_0625890_208_1077 280
116 3300046559 Ga0495667_0008574 Ga0495667_0008574_5348_6232 280
117 3300046675 Ga0495657_0028640 Ga0495657_0028640_1563_2447 280
118 3300046809 Ga0495600_0119412 Ga0495600_0119412_456_1340 280
119 3300048088 Ga0495602_0163094 Ga0495602_0163094_101_985 280
120 3300053077 Ga0495601_0009258 Ga0495601_0009258_1476_2360 280
121 3300053078 Ga0495612_0019731 Ga0495612_0019731_1573_2457 280
122 3300053084 Ga0495595_0012507 Ga0495595_0012507_2584_3468 280
123 3300053085 Ga0495619_0027982 Ga0495619_0027982_1378_2262 280
124 3300003322 rootL2_10310267 rootL2_103102672 281
125 3300005445 Ga0070708_100211041 Ga0070708_1002110413 281
126 3300005536 Ga0070697_100273200 Ga0070697_1002732001 281
127 3300005549 Ga0070704_100275257 Ga0070704_1002752572 281
128 3300013104 Ga0157370_10574562 Ga0157370_105745621 281
129 3300021388 Ga0213875_10014533 Ga0213875_100145332 281
130 3300021388 Ga0213875_10157817 Ga0213875_101578171 281
131 3300025254 Ga0209148_1000799 Ga0209148_10007993 281
132 3300025272 Ga0209455_1001082 Ga0209455_100108215 281
133 3300028577 Ga0265318_10002509 Ga0265318_100025098 281
134 3300031235 Ga0265330_10020764 Ga0265330_100207643 281
135 3300031240 Ga0265320_10017968 Ga0265320_100179683 281
136 3300031247 Ga0265340_10045065 Ga0265340_100450652 281
137 3300031344 Ga0265316_10220911 Ga0265316_102209112 281
138 3300031595 Ga0265313_10052899 Ga0265313_100528992 281
139 3300031711 Ga0265314_10028291 Ga0265314_100282914 281
140 3300035118 Ga0373954_0169223 Ga0373954_0169223_191_1057 281
141 3300035172 Ga0373955_0113411 Ga0373955_0113411_657_1538 281
142 3300035724 Ga0373933_0308405 Ga0373933_0308405_79_960 281
143 3300036401 Ga0373937_0007436 Ga0373937_0007436_7957_8838 281
144 3300036401 Ga0373937_0030013 Ga0373937_0030013_3215_4081 281
145 3300037068 Ga0373925_0051582 Ga0373925_0051582_418_1284 281
146 3300037853 Ga0436364_1308578 Ga0436364_1308578_304_1185 281
147 3300037853 Ga0436364_1340622 Ga0436364_1340622_91_954 281
148 3300049570 Ga0501033_0213081 Ga0501033_0213081_412_1281 281
149 3300049586 Ga0501070_0115257 Ga0501070_0115257_440_1309 281
150 3300049589 Ga0501073_0088719 Ga0501073_0088719_705_1574 281
151 3300049744 Ga0501083_0070420 Ga0501083_0070420_1021_1890 281
152 3300049823 Ga0501044_0479064 Ga0501044_0479064_220_1089 281
153 3300049823 Ga0501044_0484360 Ga0501044_0484360_44_913 281
154 3300060353 Ga0501082_0212482 Ga0501082_0212482_607_1476 281
155 3300005436 Ga0070713_100084269 Ga0070713_1000842693 282
156 3300005436 Ga0070713_100109068 Ga0070713_1001090682 282
157 3300005467 Ga0070706_100005029 Ga0070706_1000050294 282
158 3300005471 Ga0070698_100044929 Ga0070698_1000449294 282
159 3300006028 Ga0070717_10063520 Ga0070717_100635203 282
160 3300011119 Ga0105246_10057787 Ga0105246_100577873 282
161 3300013296 Ga0157374_10235397 Ga0157374_102353972 282
162 3300014497 Ga0182008_10018774 Ga0182008_100187743 282
163 3300021361 Ga0213872_10002900 Ga0213872_100029007 282
164 3300021361 Ga0213872_10011440 Ga0213872_100114403 282
165 3300025910 Ga0207684_10040535 Ga0207684_100405355 282
166 3300025928 Ga0207700_10069758 Ga0207700_100697583 282
167 3300025928 Ga0207700_10154318 Ga0207700_101543181 282
168 3300028381 Ga0268264_10472097 Ga0268264_104720971 282
169 3300037853 Ga0436364_0964851 Ga0436364_0964851_843_1739 282
170 3300039447 Ga0436361_0125242 Ga0436361_0125242_4829_5704 282
171 3300039447 Ga0436361_0177796 Ga0436361_0177796_8231_9100 282
172 3300039447 Ga0436361_0411070 Ga0436361_0411070_128_1003 282
173 3300039447 Ga0436361_0445544 Ga0436361_0445544_3619_4491 282
174 3300046477 Ga0495664_0125518 Ga0495664_0125518_497_1378 282
175 3300046529 Ga0495652_0118443 Ga0495652_0118443_628_1509 282
176 3300050495 nmdc:mga04h51_51812_c1 nmdc:mga04h51_51812_c1_376_1278 282
177 iso_pu_bacteria 8055266321 8055273300 282
178 3300005436 Ga0070713_100417781 Ga0070713_1004177812 283
179 3300006028 Ga0070717_10264623 Ga0070717_102646232 283
180 3300025928 Ga0207700_10342190 Ga0207700_103421901 283
181 3300028800 Ga0265338_10022516 Ga0265338_100225165 283
182 3300031235 Ga0265330_10007730 Ga0265330_100077304 283
183 3300031238 Ga0265332_10118742 Ga0265332_101187422 283
184 3300031241 Ga0265325_10008049 Ga0265325_100080496 283
185 3300031249 Ga0265339_10002673 Ga0265339_100026736 283
186 3300031344 Ga0265316_10006227 Ga0265316_100062277 283
187 3300031595 Ga0265313_10005671 Ga0265313_100056716 283
188 3300031711 Ga0265314_10053025 Ga0265314_100530253 283
189 3300031712 Ga0265342_10054270 Ga0265342_100542702 283
190 3300037853 Ga0436364_0008707 Ga0436364_0008707_517_1398 283
191 3300037853 Ga0436364_0280342 Ga0436364_0280342_4126_5004 283
192 3300039437 Ga0436365_1890384 Ga0436365_1890384_27149_28036 283
193 3300044683 Ga0466965_0054415 Ga0466965_0054415_728_1648 283
194 3300046680 Ga0495646_0091207 Ga0495646_0091207_58_933 283
195 3300048088 Ga0495602_0018162 Ga0495602_0018162_5126_6001 283
196 3300049568 Ga0501031_0125965 Ga0501031_0125965_454_1473 283
197 3300049569 Ga0501032_0002230 Ga0501032_0002230_5854_6873 283
198 3300049570 Ga0501033_0003568 Ga0501033_0003568_9754_10773 283
199 3300049571 Ga0501034_0051093 Ga0501034_0051093_1197_2216 283
200 3300049572 Ga0501036_0001185 Ga0501036_0001185_10011_11030 283
201 3300049573 Ga0501037_0012173 Ga0501037_0012173_1196_2215 283
202 3300049574 Ga0501038_0003926 Ga0501038_0003926_11606_12625 283
203 3300049575 Ga0501039_0002319 Ga0501039_0002319_4494_5513 283
204 3300049579 Ga0501043_0002419 Ga0501043_0002419_6555_7574 283
205 3300049580 Ga0501046_0002689 Ga0501046_0002689_7422_8441 283
206 3300049582 Ga0501048_0052930 Ga0501048_0052930_101_1120 283
207 3300049583 Ga0501067_0006196 Ga0501067_0006196_1617_2636 283
208 3300049584 Ga0501068_0003636 Ga0501068_0003636_2638_3657 283
209 3300049585 Ga0501069_0000207 Ga0501069_0000207_6904_7923 283
210 3300049586 Ga0501070_0007881 Ga0501070_0007881_2466_3485 283
211 3300049589 Ga0501073_0001222 Ga0501073_0001222_3402_4421 283
212 3300049590 Ga0501074_0010412 Ga0501074_0010412_2548_3567 283
213 3300049741 Ga0501079_0413534 Ga0501079_0413534_63_1031 283
214 3300049742 Ga0501080_0003272 Ga0501080_0003272_4427_5446 283
215 3300049744 Ga0501083_0008962 Ga0501083_0008962_4445_5464 283
216 3300049822 Ga0501035_0010883 Ga0501035_0010883_1864_2883 283
217 3300049823 Ga0501044_0032854 Ga0501044_0032854_3239_4258 283
218 3300054114 Ga0501084_0008180 Ga0501084_0008180_6445_7464 283
219 3300005530 Ga0070679_100140317 Ga0070679_1001403173 284
220 3300025921 Ga0207652_10197623 Ga0207652_101976232 284
221 3300028800 Ga0265338_10018173 Ga0265338_100181732 284
222 3300003320 rootH2_10172964 rootH2_101729642 286

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01297

ZnuA

Zinc-uptake complex component A periplasmic

76

333

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7rcj-assembly6.cif.gz_F crystal structure of znua from citrobacter koseri 0.8195 24 283
7rcj-assembly2.cif.gz_B crystal structure of znua from citrobacter koseri 0.8161 24 283
1toa-assembly2.cif.gz_B periplasmic zinc binding protein troa from treponema pallidum 0.8153 21 283
2osv-assembly1.cif.gz_A crystal structure of znua from e. coli 0.814 24 283
2prs-assembly1.cif.gz_A structure and metal binding properties of znua, a periplasmic zinc transporter from escherichia coli 0.8135 24 283
ID Description Score Start End Superfamily
af_O07257_253_352_3.40.50.1980 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.8982 173 268 3.40.50.1980
af_O07257_253_352_3.40.50.1980 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.8555 173 268 3.40.50.1980
af_O07257_108_245_3.40.50.1980 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.8525 30 153 3.40.50.1980
4oxrA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.8323 21 152 3.40.50.1980
1toaB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.8239 21 152 3.40.50.1980
ID Description Score Start End GO Terms
AF-A0A0R2B1R0-F1-model_v4 deleted 0.9862 178 282
AF-A0A372K3U0-F1-model_v4 Cation ABC transporter substrate-binding protein 0.9855 20 282 GO:0007155
GO:0030001
GO:0046872
AF-J4RMM2-F1-model_v4 deleted 0.9827 20 282
AF-A0A0H2WIP5-F1-model_v4 Cation ABC transporter, periplasmic cation-binding protein, putative 0.9818 17 283 GO:0007155
GO:0030001
GO:0046872
AF-A0A0G3ETE1-F1-model_v4 Cation ABC transporter substrate-binding protein 0.9811 13 282 GO:0030001
GO:0046872

Feature Viewer

pLDDT pTM Quality
91.69 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map