F334861

General Info

Members Datasets Scaffolds Average Seq Length
222 175 444 98

Family's Representative Sequence

Representative Sequence 3300047471|Ga0495684_1095974|Ga0495684_1095974_42_389
Length 115
Sequence MPHMSKSSITTKPKPPQSSQLPLIHPGQILKEEFLDPLGMSLNALSLALRVAPTRILAIVQGKRSITADTALRLSRYFGNSPEFWLNLQQFYELRCAQLAAGEKITSDVRPRVVA

Samples

Sample ID Description Type Environment
1 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
67 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
105 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
106 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
107 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
108 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
109 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
110 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
111 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
112 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
117 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
118 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
119 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
120 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
121 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
122 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
123 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
124 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
125 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
126 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
127 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
128 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
129 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
130 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
131 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
132 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
133 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
134 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
135 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
136 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
137 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
138 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
139 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
140 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
152 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
153 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
154 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
155 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
156 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
157 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
158 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
159 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
160 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
161 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
162 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
163 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
165 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
166 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
167 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
168 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
169 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
170 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
171 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
172 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
173 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
174 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
175 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.65
Metatranscriptomes 0
Isolates 1.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.15
Nodule 0.9
Rhizoplane 0.9
Rhizosphere 91.89
Stem 0
Stem Tuber 0
Unclassified 12.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495684_1095974 3300047471 Unclassified 500
2 JGI25406J46586_10015294 3300003203 Bacteria 3241
3 Ga0065707_10098012 3300005295 Bacteria 3121
4 Ga0070676_11319787 3300005328 Bacteria 551
5 Ga0070683_100966125 3300005329 Bacteria 817
6 Ga0070690_100083697 3300005330 Bacteria 2090
7 Ga0068869_100386890 3300005334 Bacteria 1147
8 Ga0070680_101035822 3300005336 Bacteria 709
9 Ga0070680_101490988 3300005336 Bacteria 586
10 Ga0070689_100448186 3300005340 Bacteria 1098
11 Ga0070691_10019962 3300005341 Bacteria 3094
12 Ga0070661_101393013 3300005344 Bacteria 590
13 Ga0070692_10511382 3300005345 Bacteria 780
14 Ga0070669_100000002 3300005353 Bacteria 506497
15 Ga0070669_101164669 3300005353 Unclassified 665
16 Ga0070667_100000430 3300005367 Bacteria 44193
17 Ga0070667_102077296 3300005367 Unclassified 535
18 Ga0070701_10030150 3300005438 Bacteria 2681
19 Ga0070711_101573575 3300005439 Unclassified 574
20 Ga0070705_100041750 3300005440 Bacteria 2618
21 Ga0070700_100021555 3300005441 Bacteria 3746
22 Ga0070700_100315645 3300005441 Bacteria 1146
23 Ga0070694_100089191 3300005444 Bacteria 2160
24 Ga0070694_100242074 3300005444 Bacteria 1361
25 Ga0070662_100889761 3300005457 Unclassified 759
26 Ga0068867_100130193 3300005459 Bacteria 1954
27 Ga0070685_10036161 3300005466 Bacteria 2791
28 Ga0070707_100404794 3300005468 Bacteria 1325
29 Ga0068853_101888173 3300005539 Bacteria 579
30 Ga0070686_100097211 3300005544 Unclassified 1982
31 Ga0070686_100385866 3300005544 Bacteria 1061
32 Ga0070695_100164645 3300005545 Bacteria 1560
33 Ga0070693_100028301 3300005547 Bacteria 3046
34 Ga0070693_101119842 3300005547 Bacteria 601
35 Ga0068854_101239792 3300005578 Bacteria 669
36 Ga0070702_100021067 3300005615 Bacteria 3424
37 Ga0070702_101112197 3300005615 Unclassified 632
38 Ga0068859_100689761 3300005617 Bacteria 1112
39 Ga0068864_100351969 3300005618 Bacteria 1390
40 Ga0068866_10017379 3300005718 Bacteria 3234
41 Ga0068861_100325171 3300005719 Bacteria 1340
42 Ga0068870_10044793 3300005840 Bacteria 2313
43 Ga0068858_100044804 3300005842 Bacteria 4100
44 Ga0068858_100550688 3300005842 Bacteria 1117
45 Ga0068860_100018110 3300005843 Bacteria 6857
46 Ga0068862_100047838 3300005844 Bacteria 3651
47 Ga0081455_10372863 3300005937 Bacteria 1000
48 Ga0081539_10000475 3300005985 Bacteria 85022
49 Ga0081539_10020338 3300005985 Unclassified 4492
50 Ga0070717_10270292 3300006028 Bacteria 1506
51 Ga0070716_100606221 3300006173 Unclassified 824
52 Ga0097621_100095514 3300006237 Bacteria 2493
53 Ga0075370_10017831 3300006353 Bacteria 3841
54 Ga0068871_100137755 3300006358 Bacteria 2074
55 Ga0075433_10289567 3300006852 Bacteria 1451
56 Ga0075434_101068178 3300006871 Bacteria 821
57 Ga0068865_100056654 3300006881 Bacteria 2731
58 Ga0097620_100689748 3300006931 Bacteria 1112
59 Ga0105250_10207579 3300009092 Bacteria 827
60 Ga0111539_10152727 3300009094 Bacteria 2702
61 Ga0105245_10304398 3300009098 Bacteria 1565
62 Ga0105245_10671971 3300009098 Bacteria 1067
63 Ga0105247_11222090 3300009101 Unclassified 599
64 Ga0105243_10021699 3300009148 Bacteria 4875
65 Ga0105241_12040017 3300009174 Unclassified 565
66 Ga0105242_10002260 3300009176 Bacteria 15206
67 Ga0105242_10025803 3300009176 Bacteria 4653
68 Ga0105248_10481170 3300009177 Bacteria 1399
69 Ga0105248_10805329 3300009177 Bacteria 1060
70 Ga0105248_11065103 3300009177 Bacteria 914
71 Ga0105248_11193178 3300009177 Bacteria 860
72 Ga0105249_10263983 3300009553 Bacteria 1712
73 Ga0105246_10711748 3300011119 Bacteria 881
74 Ga0157378_10082883 3300013297 Bacteria 2901
75 Ga0157378_11469568 3300013297 Bacteria 726
76 Ga0163162_10094293 3300013306 Bacteria 3079
77 Ga0163162_10292895 3300013306 Bacteria 1759
78 Ga0157375_10838043 3300013308 Unclassified 1067
79 Ga0157375_13209095 3300013308 Bacteria 545
80 Ga0163163_12985200 3300014325 Bacteria 528
81 Ga0157380_10052900 3300014326 Bacteria 3217
82 Ga0157379_11555606 3300014968 Unclassified 645
83 Ga0157376_10860923 3300014969 Bacteria 922
84 Ga0213875_10000013 3300021388 Bacteria 305595
85 Ga0207692_10385408 3300025898 Bacteria 871
86 Ga0207710_10703706 3300025900 Unclassified 530
87 Ga0207643_10009709 3300025908 Bacteria 5163
88 Ga0207643_10088354 3300025908 Bacteria 1804
89 Ga0207663_11639454 3300025916 Unclassified 518
90 Ga0207662_10145846 3300025918 Bacteria 1502
91 Ga0207649_10700835 3300025920 Bacteria 785
92 Ga0207646_10414407 3300025922 Bacteria 1216
93 Ga0207681_10000009 3300025923 Bacteria 410736
94 Ga0207681_10473087 3300025923 Bacteria 1022
95 Ga0207681_10864854 3300025923 Bacteria 756
96 Ga0207650_10636943 3300025925 Unclassified 898
97 Ga0207650_11866233 3300025925 Bacteria 508
98 Ga0207659_10110719 3300025926 Bacteria 2087
99 Ga0207700_11396419 3300025928 Bacteria 623
100 Ga0207644_10047751 3300025931 Bacteria 3057
101 Ga0207686_10000674 3300025934 Bacteria 21144
102 Ga0207686_10039964 3300025934 Bacteria 2849
103 Ga0207709_10585604 3300025935 Bacteria 882
104 Ga0207670_10340278 3300025936 Unclassified 1185
105 Ga0207669_10563185 3300025937 Bacteria 921
106 Ga0207669_10910675 3300025937 Unclassified 735
107 Ga0207704_10174140 3300025938 Bacteria 1547
108 Ga0207665_11260449 3300025939 Unclassified 590
109 Ga0207691_10111531 3300025940 Bacteria 2432
110 Ga0207711_10603540 3300025941 Bacteria 1024
111 Ga0207711_11003014 3300025941 Bacteria 774
112 Ga0207689_10006101 3300025942 Bacteria 10658
113 Ga0207689_10472141 3300025942 Bacteria 1050
114 Ga0207661_11042408 3300025944 Bacteria 753
115 Ga0207679_10171811 3300025945 Bacteria 1785
116 Ga0207679_10285696 3300025945 Bacteria 1416
117 Ga0207679_10339535 3300025945 Bacteria 1306
118 Ga0207651_10816141 3300025960 Bacteria 827
119 Ga0207712_10118323 3300025961 Bacteria 2000
120 Ga0207640_10172446 3300025981 Bacteria 1613
121 Ga0207658_10000809 3300025986 Bacteria 26239
122 Ga0207658_10106587 3300025986 Unclassified 2207
123 Ga0207677_10438143 3300026023 Bacteria 1117
124 Ga0207703_10371392 3300026035 Bacteria 1321
125 Ga0207708_10332073 3300026075 Bacteria 1243
126 Ga0207708_10359149 3300026075 Bacteria 1197
127 Ga0207641_10042061 3300026088 Bacteria 3832
128 Ga0207648_10004017 3300026089 Bacteria 15271
129 Ga0207648_10832313 3300026089 Bacteria 860
130 Ga0207676_10022339 3300026095 Bacteria 4652
131 Ga0207676_10220376 3300026095 Bacteria 1689
132 Ga0207675_100044458 3300026118 Bacteria 4150
133 Ga0207683_10075140 3300026121 Bacteria 2991
134 Ga0207683_10304264 3300026121 Bacteria 1459
135 Ga0268265_10076166 3300028380 Bacteria 2631
136 Ga0268265_11285686 3300028380 Unclassified 731
137 Ga0268264_10156371 3300028381 Bacteria 2049
138 Ga0265318_10116839 3300028577 Bacteria 980
139 Ga0265329_10328740 3300031242 Bacteria 520
140 Ga0265316_10070808 3300031344 Bacteria 2689
141 Ga0307408_100850099 3300031548 Bacteria 832
142 Ga0307408_101792716 3300031548 Bacteria 586
143 Ga0316579_10288505 3300031691 Bacteria 793
144 Ga0316576_10372047 3300031727 Bacteria 1062
145 Ga0307405_11031292 3300031731 Bacteria 703
146 Ga0316577_10043665 3300031733 Bacteria 2508
147 Ga0316577_10411095 3300031733 Bacteria 769
148 Ga0307410_11744058 3300031852 Bacteria 552
149 Ga0307409_101084410 3300031995 Bacteria 821
150 Ga0307416_100842445 3300032002 Bacteria 1015
151 Ga0307411_12338797 3300032005 Bacteria 502
152 Ga0316585_10142947 3300032137 Bacteria 789
153 Ga0316574_0391849 3300035398 Bacteria 875
154 Ga0316574_0420024 3300035398 Bacteria 840
155 Ga0316582_0100235 3300036647 Bacteria 1917
156 Ga0316582_0924676 3300036647 Bacteria 596
157 Ga0316584_0073286 3300036712 Bacteria 2566
158 Ga0316584_0374621 3300036712 Bacteria 1018
159 Ga0316581_0070931 3300037588 Bacteria 1070
160 Ga0436364_0449695 3300037853 Bacteria 85327
161 Ga0400489_96207 3300039093 Bacteria 1006
162 Ga0436363_0616456 3300039450 Bacteria 652
163 Ga0451577_0000132 3300042876 Bacteria 167282
164 Ga0453683_0041735 3300044673 Bacteria 2881
165 Ga0453684_0000319 3300044712 Bacteria 203440
166 Ga0453684_0249355 3300044712 Bacteria 2039
167 Ga0451576_0055518 3300045051 Bacteria 4143
168 Ga0451576_0603668 3300045051 Unclassified 1153
169 Ga0495580_0200287 3300046472 Unclassified 1376
170 Ga0495580_0275001 3300046472 Bacteria 1150
171 Ga0495665_0455005 3300046531 Bacteria 647
172 Ga0495621_0190070 3300046539 Bacteria 823
173 Ga0495658_0811337 3300046683 Bacteria 599
174 Ga0495581_0061982 3300047315 Bacteria 2161
175 Ga0495672_0185223 3300047320 Bacteria 1051
176 Ga0495684_0290266 3300047471 Unclassified 1178
177 Ga0495686_0101667 3300047472 Bacteria 1733
178 Ga0495686_0433579 3300047472 Bacteria 701
179 Ga0496106_1536204 3300048909 Unclassified 511
180 Ga0496108_0335430 3300048911 Bacteria 1319
181 Ga0496122_0130049 3300048925 Bacteria 1602
182 Ga0496123_0420239 3300048926 Unclassified 603
183 Ga0496124_0059002 3300048927 Bacteria 3225
184 Ga0501032_0007940 3300049569 Bacteria 7729
185 Ga0501033_0071147 3300049570 Bacteria 2555
186 Ga0501034_0192415 3300049571 Bacteria 2001
187 Ga0501037_0011009 3300049573 Bacteria 6652
188 Ga0501038_0019382 3300049574 Bacteria 6133
189 Ga0501039_0043330 3300049575 Bacteria 3476
190 Ga0501042_0963527 3300049578 Bacteria 622
191 Ga0501043_0011944 3300049579 Bacteria 6795
192 Ga0501046_0004545 3300049580 Bacteria 12573
193 Ga0501047_0149686 3300049581 Bacteria 2210
194 Ga0501048_0279327 3300049582 Bacteria 1187
195 Ga0501067_0012329 3300049583 Bacteria 4740
196 Ga0501068_0272669 3300049584 Bacteria 1080
197 Ga0501069_0008588 3300049585 Bacteria 5372
198 Ga0501069_0400348 3300049585 Bacteria 812
199 Ga0501070_0009052 3300049586 Bacteria 8422
200 Ga0501070_1331771 3300049586 Bacteria 547
201 Ga0501072_1319768 3300049588 Bacteria 559
202 Ga0501073_0024715 3300049589 Bacteria 4313
203 Ga0501074_0041710 3300049590 Bacteria 3322
204 Ga0501234_079737 3300049707 Unclassified 576
205 Ga0501079_0550342 3300049741 Bacteria 907
206 Ga0501080_0124234 3300049742 Bacteria 2390
207 Ga0501083_0033813 3300049744 Bacteria 3498
208 Ga0501241_049831 3300049758 Bacteria 826
209 Ga0501035_0030148 3300049822 Bacteria 4945
210 Ga0501044_0093456 3300049823 Bacteria 3032
211 nmdc:mga07m45_110004_c2 3300050496 Bacteria 1022
212 nmdc:mga07m45_8900_c2 3300050496 Bacteria 3079
213 nmdc:mga08y16_531203_c1 3300050511 Bacteria 1192
214 Ga0500643_070862 3300053087 Bacteria 967
215 Ga0500641_0000192 3300053096 Bacteria 22979
216 Ga0500595_000432 3300053119 Bacteria 26247
217 Ga0500568_0374488 3300053139 Unclassified 516
218 Ga0501084_0183015 3300054114 Bacteria 1769
219 Ga0501082_0106669 3300060353 Bacteria 2423
220 2585996877 2585427633 Bacteria 6413184
221 2586001466 2585427634 Bacteria 6455027
222 2946026545 2946024296 Bacteria 3508095
223 Ga0495684_1095974
224 JGI25406J46586_10015294
225 Ga0065707_10098012
226 Ga0070676_11319787
227 Ga0070683_100966125
228 Ga0070690_100083697
229 Ga0068869_100386890
230 Ga0070680_101035822
231 Ga0070680_101490988
232 Ga0070689_100448186
233 Ga0070691_10019962
234 Ga0070661_101393013
235 Ga0070692_10511382
236 Ga0070669_100000002
237 Ga0070669_101164669
238 Ga0070667_100000430
239 Ga0070667_102077296
240 Ga0070701_10030150
241 Ga0070711_101573575
242 Ga0070705_100041750
243 Ga0070700_100021555
244 Ga0070700_100315645
245 Ga0070694_100089191
246 Ga0070694_100242074
247 Ga0070662_100889761
248 Ga0068867_100130193
249 Ga0070685_10036161
250 Ga0070707_100404794
251 Ga0068853_101888173
252 Ga0070686_100097211
253 Ga0070686_100385866
254 Ga0070695_100164645
255 Ga0070693_100028301
256 Ga0070693_101119842
257 Ga0068854_101239792
258 Ga0070702_100021067
259 Ga0070702_101112197
260 Ga0068859_100689761
261 Ga0068864_100351969
262 Ga0068866_10017379
263 Ga0068861_100325171
264 Ga0068870_10044793
265 Ga0068858_100044804
266 Ga0068858_100550688
267 Ga0068860_100018110
268 Ga0068862_100047838
269 Ga0081455_10372863
270 Ga0081539_10000475
271 Ga0081539_10020338
272 Ga0070717_10270292
273 Ga0070716_100606221
274 Ga0097621_100095514
275 Ga0075370_10017831
276 Ga0068871_100137755
277 Ga0075433_10289567
278 Ga0075434_101068178
279 Ga0068865_100056654
280 Ga0097620_100689748
281 Ga0105250_10207579
282 Ga0111539_10152727
283 Ga0105245_10304398
284 Ga0105245_10671971
285 Ga0105247_11222090
286 Ga0105243_10021699
287 Ga0105241_12040017
288 Ga0105242_10002260
289 Ga0105242_10025803
290 Ga0105248_10481170
291 Ga0105248_10805329
292 Ga0105248_11065103
293 Ga0105248_11193178
294 Ga0105249_10263983
295 Ga0105246_10711748
296 Ga0157378_10082883
297 Ga0157378_11469568
298 Ga0163162_10094293
299 Ga0163162_10292895
300 Ga0157375_10838043
301 Ga0157375_13209095
302 Ga0163163_12985200
303 Ga0157380_10052900
304 Ga0157379_11555606
305 Ga0157376_10860923
306 Ga0213875_10000013
307 Ga0207692_10385408
308 Ga0207710_10703706
309 Ga0207643_10009709
310 Ga0207643_10088354
311 Ga0207663_11639454
312 Ga0207662_10145846
313 Ga0207649_10700835
314 Ga0207646_10414407
315 Ga0207681_10000009
316 Ga0207681_10473087
317 Ga0207681_10864854
318 Ga0207650_10636943
319 Ga0207650_11866233
320 Ga0207659_10110719
321 Ga0207700_11396419
322 Ga0207644_10047751
323 Ga0207686_10000674
324 Ga0207686_10039964
325 Ga0207709_10585604
326 Ga0207670_10340278
327 Ga0207669_10563185
328 Ga0207669_10910675
329 Ga0207704_10174140
330 Ga0207665_11260449
331 Ga0207691_10111531
332 Ga0207711_10603540
333 Ga0207711_11003014
334 Ga0207689_10006101
335 Ga0207689_10472141
336 Ga0207661_11042408
337 Ga0207679_10171811
338 Ga0207679_10285696
339 Ga0207679_10339535
340 Ga0207651_10816141
341 Ga0207712_10118323
342 Ga0207640_10172446
343 Ga0207658_10000809
344 Ga0207658_10106587
345 Ga0207677_10438143
346 Ga0207703_10371392
347 Ga0207708_10332073
348 Ga0207708_10359149
349 Ga0207641_10042061
350 Ga0207648_10004017
351 Ga0207648_10832313
352 Ga0207676_10022339
353 Ga0207676_10220376
354 Ga0207675_100044458
355 Ga0207683_10075140
356 Ga0207683_10304264
357 Ga0268265_10076166
358 Ga0268265_11285686
359 Ga0268264_10156371
360 Ga0265318_10116839
361 Ga0265329_10328740
362 Ga0265316_10070808
363 Ga0307408_100850099
364 Ga0307408_101792716
365 Ga0316579_10288505
366 Ga0316576_10372047
367 Ga0307405_11031292
368 Ga0316577_10043665
369 Ga0316577_10411095
370 Ga0307410_11744058
371 Ga0307409_101084410
372 Ga0307416_100842445
373 Ga0307411_12338797
374 Ga0316585_10142947
375 Ga0316574_0391849
376 Ga0316574_0420024
377 Ga0316582_0100235
378 Ga0316582_0924676
379 Ga0316584_0073286
380 Ga0316584_0374621
381 Ga0316581_0070931
382 Ga0436364_0449695
383 Ga0400489_96207
384 Ga0436363_0616456
385 Ga0451577_0000132
386 Ga0453683_0041735
387 Ga0453684_0000319
388 Ga0453684_0249355
389 Ga0451576_0055518
390 Ga0451576_0603668
391 Ga0495580_0200287
392 Ga0495580_0275001
393 Ga0495665_0455005
394 Ga0495621_0190070
395 Ga0495658_0811337
396 Ga0495581_0061982
397 Ga0495672_0185223
398 Ga0495684_0290266
399 Ga0495686_0101667
400 Ga0495686_0433579
401 Ga0496106_1536204
402 Ga0496108_0335430
403 Ga0496122_0130049
404 Ga0496123_0420239
405 Ga0496124_0059002
406 Ga0501032_0007940
407 Ga0501033_0071147
408 Ga0501034_0192415
409 Ga0501037_0011009
410 Ga0501038_0019382
411 Ga0501039_0043330
412 Ga0501042_0963527
413 Ga0501043_0011944
414 Ga0501046_0004545
415 Ga0501047_0149686
416 Ga0501048_0279327
417 Ga0501067_0012329
418 Ga0501068_0272669
419 Ga0501069_0008588
420 Ga0501069_0400348
421 Ga0501070_0009052
422 Ga0501070_1331771
423 Ga0501072_1319768
424 Ga0501073_0024715
425 Ga0501074_0041710
426 Ga0501234_079737
427 Ga0501079_0550342
428 Ga0501080_0124234
429 Ga0501083_0033813
430 Ga0501241_049831
431 Ga0501035_0030148
432 Ga0501044_0093456
433 nmdc:mga07m45_110004_c2
434 nmdc:mga07m45_8900_c2
435 nmdc:mga08y16_531203_c1
436 Ga0500643_070862
437 Ga0500641_0000192
438 Ga0500595_000432
439 Ga0500568_0374488
440 Ga0501084_0183015
441 Ga0501082_0106669
442 2585996877
443 2586001466
444 2946026545

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01381

HTH_3

Helix-turn-helix

30

85

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jpi-assembly1.cif.gz_C crystal structure of pa4674 in complex with its operator dna (28bp) from pseudomonas aeruginosa 0.9708 8 96
6f8h-assembly2.cif.gz_C-3 antitoxin graa 0.9699 6 96
7csy-assembly1.cif.gz_A pseudomonas aeruginosa antitoxin higa with higba promoter 0.9696 8 98
6f8s-assembly1.cif.gz_C toxin-antitoxin complex grata 0.9588 8 99
6lb3-assembly2.cif.gz_B crystal structure of pa4674 in complex with its operator dna (18bp) from pseudomonas aeruginosa 0.9569 8 96
ID Description Score Start End Superfamily
2ebyA01 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9832 8 84 1.10.260.40
3trbA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9679 8 96 1.10.260.40
6f8sA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9562 6 99 1.10.260.40
4mcxE01 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9555 4 81 1.10.260.40
2ebyA01 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9469 8 84 1.10.260.40
ID Description Score Start End GO Terms
AF-C2GU12-F1-model_v4 deleted 0.9972 8 80
AF-A0A7T8RTM2-F1-model_v4 deleted 0.9925 9 99
AF-A0A534GKY4-F1-model_v4 HigA family addiction module antidote protein 0.9899 9 99 GO:0003677
AF-Q213Q9-F1-model_v4 Plasmid maintenance system antidote protein, XRE family 0.9889 7 97 GO:0003677
AF-A0A6L5XM88-F1-model_v4 HigA family addiction module antidote protein 0.9865 6 81 GO:0003677

Map