F334751

General Info

Members Datasets Scaffolds Average Seq Length
222 54 444 250

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0285084|Ga0453684_0285084_591_1379
Length 262
Sequence MAKGKTFKRPEALTENHTHYCPGCTHGVIHRLVAEVIDELGIRGRTVGIAPVGCAVLAYNYFSCDFQEAAHGRAPAMATGIKRVRPDLMVFTYQGDGDLASIGMGEIIHAANRGEKFTTIFVNNAVYGMTGGQMAPTTMPGQRTTTSPLGRNTEETGMPIRMAELLSSLATPGYITRQAAIKPKYITRAKKAIKQAFTYQMEGRCFSLVEVISTCPTNWGMTPIEAVKWAEETLLPYYPLGDFKTPESGTQLQKDSGEKNAK

Samples

Sample ID Description Type Environment
1 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
2 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
3 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
4 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
5 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
6 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
7 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
8 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
9 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
10 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
11 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
12 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
13 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
14 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
15 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
16 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
17 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
18 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
19 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
20 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
21 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
22 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
23 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
24 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
25 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
26 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
27 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
28 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
29 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
30 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
31 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
32 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
33 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
34 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
35 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
36 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
37 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
38 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
39 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
40 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
41 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
42 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
43 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
44 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
45 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
46 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
47 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
48 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
49 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
50 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
51 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
52 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
53 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
54 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.2
Metatranscriptomes 1.8
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.45
Rhizosphere 83.78
Stem 0
Stem Tuber 0
Unclassified 4.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453684_0285084 3300044712 Bacteria 1882
2 Ga0157373_10064557 3300013100 Bacteria 2591
3 Ga0157371_10187136 3300013102 Unclassified 1482
4 Ga0157369_10028932 3300013105 Bacteria 6129
5 Ga0157372_10107866 3300013307 Bacteria 3187
6 Ga0157372_10223856 3300013307 Bacteria 2181
7 Ga0157372_10285208 3300013307 Bacteria 1920
8 Ga0157375_10314665 3300013308 Bacteria 1730
9 Ga0209974_10014661 3300027876 Unclassified 2606
10 Ga0265337_1019837 3300028556 Bacteria 2114
11 Ga0265326_10001006 3300028558 Bacteria 10109
12 Ga0265319_1000267 3300028563 Bacteria 39440
13 Ga0265318_10010069 3300028577 Bacteria 4131
14 Ga0265323_10000026 3300028653 Bacteria 81286
15 Ga0265323_10033191 3300028653 Bacteria 1913
16 Ga0265322_10000342 3300028654 Bacteria 19616
17 Ga0265322_10000471 3300028654 Bacteria 16129
18 Ga0265322_10008133 3300028654 Bacteria 3057
19 Ga0265338_10013159 3300028800 Bacteria 9368
20 Ga0265324_10000661 3300029957 Bacteria 23256
21 Ga0265330_10000231 3300031235 Bacteria 42305
22 Ga0265330_10022648 3300031235 Bacteria 2859
23 Ga0265330_10046480 3300031235 Bacteria 1912
24 Ga0265332_10001228 3300031238 Bacteria 14813
25 Ga0265332_10017787 3300031238 Bacteria 3137
26 Ga0265320_10000274 3300031240 Bacteria 42388
27 Ga0265320_10022943 3300031240 Bacteria 3331
28 Ga0265329_10001836 3300031242 Bacteria 10091
29 Ga0265340_10005093 3300031247 Bacteria 7313
30 Ga0265339_10000148 3300031249 Bacteria 57410
31 Ga0265339_10052183 3300031249 Bacteria 2228
32 Ga0265331_10000752 3300031250 Bacteria 27072
33 Ga0265331_10001841 3300031250 Bacteria 15016
34 Ga0265316_10000342 3300031344 Bacteria 52382
35 Ga0265316_10005772 3300031344 Bacteria 11949
36 Ga0265316_10084017 3300031344 Bacteria 2438
37 Ga0265313_10070014 3300031595 Bacteria 1618
38 Ga0316575_10000555 3300031665 Bacteria 10919
39 Ga0316575_10000938 3300031665 Bacteria 8952
40 Ga0316575_10007379 3300031665 Bacteria 3979
41 Ga0316575_10028092 3300031665 Bacteria 2191
42 Ga0316575_10034280 3300031665 Bacteria 1993
43 Ga0316575_10088377 3300031665 Bacteria 1254
44 Ga0316575_10089037 3300031665 Bacteria 1249
45 Ga0316575_10089942 3300031665 Bacteria 1243
46 Ga0316575_10126247 3300031665 Bacteria 1048
47 Ga0316579_10000773 3300031691 Bacteria 10940
48 Ga0316579_10007900 3300031691 Bacteria 4412
49 Ga0316579_10009219 3300031691 Bacteria 4144
50 Ga0316579_10028314 3300031691 Bacteria 2550
51 Ga0316579_10029103 3300031691 Bacteria 2519
52 Ga0316579_10202252 3300031691 Bacteria 960
53 Ga0265314_10000812 3300031711 Bacteria 37088
54 Ga0265314_10107290 3300031711 Unclassified 1782
55 Ga0265342_10000222 3300031712 Bacteria 64396
56 Ga0265342_10005965 3300031712 Bacteria 9165
57 Ga0265342_10014081 3300031712 Bacteria 5320
58 Ga0316576_10000360 3300031727 Bacteria 20486
59 Ga0316576_10000725 3300031727 Bacteria 16325
60 Ga0316576_10000814 3300031727 Bacteria 15773
61 Ga0316576_10001764 3300031727 Bacteria 11947
62 Ga0316576_10006593 3300031727 Bacteria 7247
63 Ga0316576_10007435 3300031727 Bacteria 6900
64 Ga0316576_10009446 3300031727 Bacteria 6294
65 Ga0316576_10036703 3300031727 Bacteria 3504
66 Ga0316576_10076901 3300031727 Bacteria 2470
67 Ga0316576_10083027 3300031727 Bacteria 2380
68 Ga0316576_10085454 3300031727 Bacteria 2345
69 Ga0316576_10128945 3300031727 Bacteria 1902
70 Ga0316576_10192974 3300031727 Bacteria 1535
71 Ga0316576_10207401 3300031727 Bacteria 1476
72 Ga0316576_10381620 3300031727 Bacteria 1046
73 Ga0316576_10397179 3300031727 Bacteria 1022
74 Ga0316578_10028758 3300031728 Bacteria 3150
75 Ga0316578_10029983 3300031728 Bacteria 3089
76 Ga0316578_10033931 3300031728 Bacteria 2927
77 Ga0316578_10042389 3300031728 Bacteria 2638
78 Ga0316578_10043927 3300031728 Bacteria 2597
79 Ga0316578_10070953 3300031728 Unclassified 2062
80 Ga0316578_10120184 3300031728 Bacteria 1579
81 Ga0316578_10194922 3300031728 Unclassified 1220
82 Ga0316578_10214834 3300031728 Bacteria 1156
83 Ga0316578_10219308 3300031728 Bacteria 1143
84 Ga0316577_10000020 3300031733 Bacteria 35147
85 Ga0316577_10006915 3300031733 Bacteria 6027
86 Ga0316577_10011998 3300031733 Bacteria 4711
87 Ga0316577_10032230 3300031733 Bacteria 2927
88 Ga0316577_10034512 3300031733 Bacteria 2826
89 Ga0316577_10107999 3300031733 Bacteria 1561
90 Ga0316577_10158063 3300031733 Bacteria 1278
91 Ga0316577_10203983 3300031733 Unclassified 1117
92 Ga0316577_10248865 3300031733 Bacteria 1005
93 Ga0316577_10301497 3300031733 Bacteria 908
94 Ga0316583_10001818 3300032133 Bacteria 7256
95 Ga0316583_10002837 3300032133 Bacteria 6072
96 Ga0316583_10003932 3300032133 Bacteria 5279
97 Ga0316583_10013462 3300032133 Bacteria 2952
98 Ga0316583_10020453 3300032133 Unclassified 2371
99 Ga0316583_10037390 3300032133 Bacteria 1720
100 Ga0316583_10066416 3300032133 Bacteria 1262
101 Ga0316583_10080781 3300032133 Bacteria 1136
102 Ga0316585_10000024 3300032137 Bacteria 22379
103 Ga0316585_10002829 3300032137 Bacteria 4720
104 Ga0316585_10019098 3300032137 Bacteria 2087
105 Ga0316585_10039040 3300032137 Bacteria 1509
106 Ga0316585_10044079 3300032137 Bacteria 1425
107 Ga0316585_10045894 3300032137 Bacteria 1398
108 Ga0316585_10073982 3300032137 Bacteria 1107
109 Ga0316580_10000548 3300032139 Bacteria 8752
110 Ga0316580_10005298 3300032139 Unclassified 3759
111 Ga0316580_10006460 3300032139 Bacteria 3463
112 Ga0316580_10013618 3300032139 Bacteria 2479
113 Ga0316580_10015544 3300032139 Bacteria 2329
114 Ga0316580_10026320 3300032139 Bacteria 1799
115 Ga0316580_10027124 3300032139 Bacteria 1771
116 Ga0316580_10036342 3300032139 Bacteria 1525
117 Ga0316580_10089368 3300032139 Bacteria 942
118 Ga0316580_10101867 3300032139 Bacteria 879
119 Ga0316593_10021831 3300032168 Bacteria 2005
120 Ga0316593_10076105 3300032168 Bacteria 1166
121 Ga0316592_1006849 3300033524 Bacteria 2207
122 Ga0316596_1045523 3300033541 Bacteria 1157
123 Ga0316574_0000110 3300035398 Bacteria 24477
124 Ga0316574_0003635 3300035398 Bacteria 7975
125 Ga0316574_0008194 3300035398 Bacteria 5787
126 Ga0316574_0023405 3300035398 Bacteria 3687
127 Ga0316574_0056779 3300035398 Bacteria 2450
128 Ga0316574_0059544 3300035398 Bacteria 2395
129 Ga0316574_0155801 3300035398 Bacteria 1472
130 Ga0316574_0324725 3300035398 Bacteria 976
131 Ga0316582_0000077 3300036647 Bacteria 25182
132 Ga0316582_0000121 3300036647 Bacteria 22350
133 Ga0316582_0003041 3300036647 Bacteria 8092
134 Ga0316582_0004890 3300036647 Bacteria 6842
135 Ga0316582_0005311 3300036647 Bacteria 6618
136 Ga0316582_0012536 3300036647 Bacteria 4736
137 Ga0316582_0018515 3300036647 Bacteria 4055
138 Ga0316582_0028241 3300036647 Bacteria 3397
139 Ga0316582_0125961 3300036647 Bacteria 1717
140 Ga0316582_0192924 3300036647 Bacteria 1388
141 Ga0316582_0444306 3300036647 Bacteria 894
142 Ga0316584_0000763 3300036712 Bacteria 17957
143 Ga0316584_0002460 3300036712 Bacteria 11719
144 Ga0316584_0003727 3300036712 Bacteria 9978
145 Ga0316584_0009733 3300036712 Bacteria 6688
146 Ga0316584_0015953 3300036712 Bacteria 5381
147 Ga0316584_0018751 3300036712 Bacteria 4994
148 Ga0316584_0034422 3300036712 Bacteria 3755
149 Ga0316584_0042120 3300036712 Bacteria 3404
150 Ga0316584_0055341 3300036712 Bacteria 2970
151 Ga0316584_0070104 3300036712 Bacteria 2628
152 Ga0316584_0143517 3300036712 Bacteria 1779
153 Ga0316584_0195694 3300036712 Bacteria 1493
154 Ga0316584_0206118 3300036712 Bacteria 1449
155 Ga0316584_0245897 3300036712 Bacteria 1308
156 Ga0316584_0325217 3300036712 Bacteria 1108
157 Ga0316584_0369366 3300036712 Bacteria 1027
158 Ga0316581_0004098 3300037588 Unclassified 3685
159 Ga0316581_0012295 3300037588 Bacteria 2409
160 Ga0400484_24180 3300038725 Bacteria 2631
161 Ga0400484_28197 3300038725 Bacteria 19326
162 Ga0400484_36831 3300038725 Bacteria 14260
163 Ga0400484_41587 3300038725 Bacteria 2493
164 Ga0400490_01083 3300038726 Unclassified 2233
165 Ga0400490_06651 3300038726 Bacteria 44225
166 Ga0400490_35087 3300038726 Bacteria 6779
167 Ga0400491_01792 3300038727 Bacteria 2709
168 Ga0400485_07802 3300038735 Bacteria 1571
169 Ga0400485_12791 3300038735 Bacteria 25460
170 Ga0400485_18422 3300038735 Bacteria 32961
171 Ga0400485_18722 3300038735 Bacteria 12083
172 Ga0400488_20310 3300038741 Bacteria 6096
173 Ga0400488_29991 3300038741 Bacteria 1720
174 Ga0400488_46636 3300038741 Bacteria 1547
175 Ga0400488_63719 3300038741 Bacteria 6667
176 Ga0400486_18425 3300038742 Bacteria 17295
177 Ga0400486_18753 3300038742 Bacteria 46597
178 Ga0400486_19779 3300038742 Bacteria 39072
179 Ga0400483_034551 3300039062 Bacteria 1536
180 Ga0400483_061917 3300039062 Bacteria 4794
181 Ga0400483_063004 3300039062 Bacteria 2524
182 Ga0400483_097471 3300039062 Bacteria 9551
183 Ga0400483_141846 3300039062 Bacteria 2192
184 Ga0400483_167899 3300039062 Bacteria 14559
185 Ga0400483_176499 3300039062 Bacteria 8033
186 Ga0400483_195000 3300039062 Bacteria 103610
187 Ga0400489_19840 3300039093 Bacteria 22846
188 Ga0400489_62086 3300039093 Bacteria 14747
189 Ga0400489_77515 3300039093 Bacteria 15547
190 Ga0400489_93966 3300039093 Bacteria 37739
191 Ga0400487_01631 3300039110 Bacteria 32665
192 Ga0400487_33435 3300039110 Bacteria 2080
193 Ga0400487_47535 3300039110 Unclassified 1142
194 Ga0400487_60177 3300039110 Bacteria 1179
195 Ga0451795_0489624 3300041456 Bacteria 1409
196 Ga0451577_0045013 3300042876 Bacteria 3950
197 Ga0451577_0152350 3300042876 Bacteria 2080
198 Ga0451577_0359789 3300042876 Bacteria 1320
199 Ga0453683_0000017 3300044673 Bacteria 309594
200 Ga0453683_0001940 3300044673 Bacteria 16804
201 Ga0453683_0009096 3300044673 Bacteria 6634
202 Ga0453683_0162531 3300044673 Bacteria 1413
203 Ga0453684_0001634 3300044712 Bacteria 61013
204 Ga0453684_0005678 3300044712 Bacteria 24463
205 Ga0453684_0007870 3300044712 Bacteria 19375
206 Ga0453684_0012771 3300044712 Bacteria 13780
207 Ga0453684_0016180 3300044712 Bacteria 11693
208 Ga0453684_0017539 3300044712 Bacteria 11079
209 Ga0453684_0025591 3300044712 Bacteria 8563
210 Ga0453684_0156457 3300044712 Bacteria 2702
211 Ga0453684_0213080 3300044712 Bacteria 2244
212 Ga0453684_0236454 3300044712 Bacteria 2106
213 Ga0453684_0360307 3300044712 Bacteria 1637
214 Ga0453684_0463786 3300044712 Bacteria 1408
215 Ga0453684_0876936 3300044712 Bacteria 962
216 Ga0451576_0000001 3300045051 Bacteria 1802108
217 Ga0451576_0000021 3300045051 Bacteria 505854
218 Ga0451576_0000482 3300045051 Bacteria 88682
219 Ga0451576_0001096 3300045051 Bacteria 49439
220 Ga0451576_0016132 3300045051 Bacteria 8254
221 Ga0451576_0049943 3300045051 Bacteria 4389
222 Ga0451576_0084658 3300045051 Bacteria 3299
223 Ga0453684_0285084
224 Ga0157373_10064557
225 Ga0157371_10187136
226 Ga0157369_10028932
227 Ga0157372_10107866
228 Ga0157372_10223856
229 Ga0157372_10285208
230 Ga0157375_10314665
231 Ga0209974_10014661
232 Ga0265337_1019837
233 Ga0265326_10001006
234 Ga0265319_1000267
235 Ga0265318_10010069
236 Ga0265323_10000026
237 Ga0265323_10033191
238 Ga0265322_10000342
239 Ga0265322_10000471
240 Ga0265322_10008133
241 Ga0265338_10013159
242 Ga0265324_10000661
243 Ga0265330_10000231
244 Ga0265330_10022648
245 Ga0265330_10046480
246 Ga0265332_10001228
247 Ga0265332_10017787
248 Ga0265320_10000274
249 Ga0265320_10022943
250 Ga0265329_10001836
251 Ga0265340_10005093
252 Ga0265339_10000148
253 Ga0265339_10052183
254 Ga0265331_10000752
255 Ga0265331_10001841
256 Ga0265316_10000342
257 Ga0265316_10005772
258 Ga0265316_10084017
259 Ga0265313_10070014
260 Ga0316575_10000555
261 Ga0316575_10000938
262 Ga0316575_10007379
263 Ga0316575_10028092
264 Ga0316575_10034280
265 Ga0316575_10088377
266 Ga0316575_10089037
267 Ga0316575_10089942
268 Ga0316575_10126247
269 Ga0316579_10000773
270 Ga0316579_10007900
271 Ga0316579_10009219
272 Ga0316579_10028314
273 Ga0316579_10029103
274 Ga0316579_10202252
275 Ga0265314_10000812
276 Ga0265314_10107290
277 Ga0265342_10000222
278 Ga0265342_10005965
279 Ga0265342_10014081
280 Ga0316576_10000360
281 Ga0316576_10000725
282 Ga0316576_10000814
283 Ga0316576_10001764
284 Ga0316576_10006593
285 Ga0316576_10007435
286 Ga0316576_10009446
287 Ga0316576_10036703
288 Ga0316576_10076901
289 Ga0316576_10083027
290 Ga0316576_10085454
291 Ga0316576_10128945
292 Ga0316576_10192974
293 Ga0316576_10207401
294 Ga0316576_10381620
295 Ga0316576_10397179
296 Ga0316578_10028758
297 Ga0316578_10029983
298 Ga0316578_10033931
299 Ga0316578_10042389
300 Ga0316578_10043927
301 Ga0316578_10070953
302 Ga0316578_10120184
303 Ga0316578_10194922
304 Ga0316578_10214834
305 Ga0316578_10219308
306 Ga0316577_10000020
307 Ga0316577_10006915
308 Ga0316577_10011998
309 Ga0316577_10032230
310 Ga0316577_10034512
311 Ga0316577_10107999
312 Ga0316577_10158063
313 Ga0316577_10203983
314 Ga0316577_10248865
315 Ga0316577_10301497
316 Ga0316583_10001818
317 Ga0316583_10002837
318 Ga0316583_10003932
319 Ga0316583_10013462
320 Ga0316583_10020453
321 Ga0316583_10037390
322 Ga0316583_10066416
323 Ga0316583_10080781
324 Ga0316585_10000024
325 Ga0316585_10002829
326 Ga0316585_10019098
327 Ga0316585_10039040
328 Ga0316585_10044079
329 Ga0316585_10045894
330 Ga0316585_10073982
331 Ga0316580_10000548
332 Ga0316580_10005298
333 Ga0316580_10006460
334 Ga0316580_10013618
335 Ga0316580_10015544
336 Ga0316580_10026320
337 Ga0316580_10027124
338 Ga0316580_10036342
339 Ga0316580_10089368
340 Ga0316580_10101867
341 Ga0316593_10021831
342 Ga0316593_10076105
343 Ga0316592_1006849
344 Ga0316596_1045523
345 Ga0316574_0000110
346 Ga0316574_0003635
347 Ga0316574_0008194
348 Ga0316574_0023405
349 Ga0316574_0056779
350 Ga0316574_0059544
351 Ga0316574_0155801
352 Ga0316574_0324725
353 Ga0316582_0000077
354 Ga0316582_0000121
355 Ga0316582_0003041
356 Ga0316582_0004890
357 Ga0316582_0005311
358 Ga0316582_0012536
359 Ga0316582_0018515
360 Ga0316582_0028241
361 Ga0316582_0125961
362 Ga0316582_0192924
363 Ga0316582_0444306
364 Ga0316584_0000763
365 Ga0316584_0002460
366 Ga0316584_0003727
367 Ga0316584_0009733
368 Ga0316584_0015953
369 Ga0316584_0018751
370 Ga0316584_0034422
371 Ga0316584_0042120
372 Ga0316584_0055341
373 Ga0316584_0070104
374 Ga0316584_0143517
375 Ga0316584_0195694
376 Ga0316584_0206118
377 Ga0316584_0245897
378 Ga0316584_0325217
379 Ga0316584_0369366
380 Ga0316581_0004098
381 Ga0316581_0012295
382 Ga0400484_24180
383 Ga0400484_28197
384 Ga0400484_36831
385 Ga0400484_41587
386 Ga0400490_01083
387 Ga0400490_06651
388 Ga0400490_35087
389 Ga0400491_01792
390 Ga0400485_07802
391 Ga0400485_12791
392 Ga0400485_18422
393 Ga0400485_18722
394 Ga0400488_20310
395 Ga0400488_29991
396 Ga0400488_46636
397 Ga0400488_63719
398 Ga0400486_18425
399 Ga0400486_18753
400 Ga0400486_19779
401 Ga0400483_034551
402 Ga0400483_061917
403 Ga0400483_063004
404 Ga0400483_097471
405 Ga0400483_141846
406 Ga0400483_167899
407 Ga0400483_176499
408 Ga0400483_195000
409 Ga0400489_19840
410 Ga0400489_62086
411 Ga0400489_77515
412 Ga0400489_93966
413 Ga0400487_01631
414 Ga0400487_33435
415 Ga0400487_47535
416 Ga0400487_60177
417 Ga0451795_0489624
418 Ga0451577_0045013
419 Ga0451577_0152350
420 Ga0451577_0359789
421 Ga0453683_0000017
422 Ga0453683_0001940
423 Ga0453683_0009096
424 Ga0453683_0162531
425 Ga0453684_0001634
426 Ga0453684_0005678
427 Ga0453684_0007870
428 Ga0453684_0012771
429 Ga0453684_0016180
430 Ga0453684_0017539
431 Ga0453684_0025591
432 Ga0453684_0156457
433 Ga0453684_0213080
434 Ga0453684_0236454
435 Ga0453684_0360307
436 Ga0453684_0463786
437 Ga0453684_0876936
438 Ga0451576_0000001
439 Ga0451576_0000021
440 Ga0451576_0000482
441 Ga0451576_0001096
442 Ga0451576_0016132
443 Ga0451576_0049943
444 Ga0451576_0084658

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02775

TPP_enzyme_C

Thiamine pyrophosphate enzyme, C-terminal TPP binding domain

51

211

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5b48-assembly1.cif.gz_B 2-oxoacid:ferredoxin oxidoreductase 1 from sulfolobus tokodai 0.9254 27 230
5b46-assembly1.cif.gz_B-2 2-oxoacid:ferredoxin oxidoreductase 2 from sulfolobus tokodai - ligand free form 0.9025 30 231
5b48-assembly1.cif.gz_D 2-oxoacid:ferredoxin oxidoreductase 1 from sulfolobus tokodai 0.8735 38 224
6n2o-assembly1.cif.gz_D 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound 0.8136 25 261
7plm-assembly1.cif.gz_B cryoem reconstruction of pyruvate ferredoxin oxidoreductase (pfor) in anaerobic conditions 0.7767 34 243
ID Description Score Start End Superfamily
af_Q2FZ04_70_219_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8424 87 246 3.40.50.970
af_Q57957_74_243_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8256 90 254 3.40.50.970
af_Q2FZ04_70_219_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8118 87 246 3.40.50.970
af_Q57957_74_243_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.7799 90 254 3.40.50.970
af_Q57714_86_295_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.7478 95 257 3.40.50.970
ID Description Score Start End GO Terms
AF-A0A7V6E837-F1-model_v4 2-oxoglutarate oxidoreductase 0.9836 26 258 GO:0016625
GO:0030976
AF-A0A109CGY2-F1-model_v4 deleted 0.9819 38 257
AF-A0A1F8TUE0-F1-model_v4 2-oxoglutarate oxidoreductase 0.9816 50 261 GO:0016625
GO:0030976
AF-A0A4V2JT46-F1-model_v4 2-oxoglutarate oxidoreductase 0.9814 16 259 GO:0000287
GO:0016625
GO:0030976
AF-A0A7X8UL37-F1-model_v4 2-oxoglutarate oxidoreductase 0.9809 47 261 GO:0000287
GO:0016625
GO:0030976

Map