F334543

General Info

Members Datasets Scaffolds Average Seq Length
222 163 444 217

Family's Representative Sequence

Representative Sequence 3300025920|Ga0207649_10269579|Ga0207649_102695791
Length 256
Sequence VGQGEVDGNVSRIRVDPRHPRPDFYFARLDGAHESTMPEAQAKTRLLLVDDHAVMRHGLAAIVNEEPDLVVCGEAEDAVQAVKXXAAAAPDIAIVDITLKDTYGIELIKQLKDLRPKLPILVLSMHDESLYGERALRAGAKGYLTKQEASKKIVDAIRRILRGEIYVSDKLAGSLVRKVAGGNDQGGGSPVDVLTDRELEVFQLLGQGLTVREVAERLFVSAKTVEAHREHIKQKLNFKTSSELLRFAIQYTLQEK

Samples

Sample ID Description Type Environment
1 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
113 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
116 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
119 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
125 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
126 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
127 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
128 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
129 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
130 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
131 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
132 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
133 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
134 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
135 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
136 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
137 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
138 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
139 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
140 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
141 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
142 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
143 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
144 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
145 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
146 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
155 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
156 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
157 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
158 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
159 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
160 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
161 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
162 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
163 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.25
Rhizosphere 94.14
Stem 0
Stem Tuber 0
Unclassified 16.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207649_10269579 3300025920 Bacteria 1233
2 SwRhRL3b_contig_3262875 2162886006 Bacteria 1151
3 SwRhRL2b_contig_497106 2162886007 Bacteria 3114
4 rootH1_10019609 3300003316 Bacteria 7809
5 rootL2_10009642 3300003322 Bacteria 9618
6 rootL2_10013254 3300003322 Bacteria 7524
7 rootL2_10038413 3300003322 Bacteria 7761
8 rootL2_10203124 3300003322 Unclassified 2119
9 rootH1_10015045 3300003323 Bacteria 20716
10 rootH1_10027255 3300003323 Bacteria 8001
11 Ga0065704_10009620 3300005289 Bacteria 3080
12 Ga0065715_10093059 3300005293 Unclassified 4825
13 Ga0065707_10005087 3300005295 Bacteria 3231
14 Ga0070658_10048961 3300005327 Bacteria 3423
15 Ga0070690_100150312 3300005330 Bacteria 1588
16 Ga0070670_100073867 3300005331 Bacteria 2929
17 Ga0068869_100012413 3300005334 Bacteria 5631
18 Ga0068869_100078402 3300005334 Bacteria 2460
19 Ga0068869_100570894 3300005334 Bacteria 953
20 Ga0070666_10000465 3300005335 Bacteria 24503
21 Ga0070689_100323011 3300005340 Bacteria 1289
22 Ga0070661_100084296 3300005344 Bacteria 2348
23 Ga0070661_100321770 3300005344 Bacteria 1208
24 Ga0070668_100632872 3300005347 Bacteria 939
25 Ga0070669_100085505 3300005353 Bacteria 2355
26 Ga0070675_100079522 3300005354 Unclassified 2732
27 Ga0070675_100394692 3300005354 Bacteria 1233
28 Ga0070675_100897229 3300005354 Unclassified 812
29 Ga0070671_100118139 3300005355 Bacteria 2230
30 Ga0070671_100186996 3300005355 Unclassified 1755
31 Ga0070671_100531758 3300005355 Bacteria 1013
32 Ga0070674_100041041 3300005356 Bacteria 3133
33 Ga0070673_100140370 3300005364 Unclassified 2037
34 Ga0070673_100338204 3300005364 Bacteria 1333
35 Ga0070688_100336892 3300005365 Bacteria 1100
36 Ga0070667_100009499 3300005367 Bacteria 8066
37 Ga0070667_100636415 3300005367 Unclassified 984
38 Ga0070709_10103164 3300005434 Bacteria 1903
39 Ga0070714_100001731 3300005435 Bacteria 15910
40 Ga0070713_100382843 3300005436 Unclassified 1311
41 Ga0070711_100141885 3300005439 Unclassified 1802
42 Ga0070705_100172363 3300005440 Unclassified 1457
43 Ga0070705_100254924 3300005440 Bacteria 1234
44 Ga0070678_100331764 3300005456 Bacteria 1302
45 Ga0070662_100074430 3300005457 Bacteria 2512
46 Ga0068867_100258336 3300005459 Unclassified 1419
47 Ga0070706_100005301 3300005467 Bacteria 12290
48 Ga0070698_100005473 3300005471 Bacteria 13862
49 Ga0070698_100034822 3300005471 Bacteria 5209
50 Ga0070698_100077781 3300005471 Bacteria 3316
51 Ga0070698_100303108 3300005471 Bacteria 1528
52 Ga0070699_100158215 3300005518 Bacteria 2005
53 Ga0070697_100793101 3300005536 Bacteria 838
54 Ga0070665_100004697 3300005548 Bacteria 14259
55 Ga0070704_100074958 3300005549 Bacteria 2470
56 Ga0070664_100188769 3300005564 Bacteria 1835
57 Ga0068859_100000063 3300005617 Bacteria 106123
58 Ga0068863_100057053 3300005841 Bacteria 3696
59 Ga0068863_100302287 3300005841 Bacteria 1552
60 Ga0068858_100008653 3300005842 Bacteria 9773
61 Ga0068858_100873101 3300005842 Unclassified 879
62 Ga0068860_100002526 3300005843 Bacteria 19183
63 Ga0068860_100013297 3300005843 Bacteria 8071
64 Ga0068860_100390339 3300005843 Bacteria 1375
65 Ga0068862_100006544 3300005844 Bacteria 9668
66 Ga0081539_10025225 3300005985 Bacteria 3835
67 Ga0070715_10000030 3300006163 Bacteria 88060
68 Ga0070716_100144465 3300006173 Bacteria 1522
69 Ga0070712_100003989 3300006175 Bacteria 9071
70 Ga0070712_100105359 3300006175 Unclassified 2094
71 Ga0097621_100103469 3300006237 Bacteria 2398
72 Ga0068871_100328745 3300006358 Unclassified 1348
73 Ga0075430_100562841 3300006846 Bacteria 940
74 Ga0068865_100132939 3300006881 Bacteria 1866
75 Ga0097620_100000063 3300006931 Bacteria 106123
76 Ga0111539_10048342 3300009094 Bacteria 5079
77 Ga0105245_10385053 3300009098 Bacteria 1397
78 Ga0105247_10004586 3300009101 Bacteria 8806
79 Ga0114129_10155531 3300009147 Bacteria 3127
80 Ga0105243_10513234 3300009148 Bacteria 1138
81 Ga0105241_10015987 3300009174 Bacteria 5499
82 Ga0105241_10094331 3300009174 Bacteria 2366
83 Ga0105241_10663809 3300009174 Bacteria 948
84 Ga0105242_10049477 3300009176 Unclassified 3421
85 Ga0105248_10579909 3300009177 Bacteria 1265
86 Ga0105248_11003461 3300009177 Unclassified 943
87 Ga0105248_11097928 3300009177 Unclassified 899
88 Ga0105237_10017623 3300009545 Bacteria 7400
89 Ga0105238_10209100 3300009551 Bacteria 1927
90 Ga0105238_10698969 3300009551 Unclassified 1026
91 Ga0105238_11129082 3300009551 Bacteria 807
92 Ga0105239_11714327 3300010375 Bacteria 727
93 Ga0105246_10026417 3300011119 Bacteria 3793
94 Ga0157369_10016582 3300013105 Bacteria 8281
95 Ga0157374_10025405 3300013296 Bacteria 5319
96 Ga0157374_10086365 3300013296 Bacteria 2984
97 Ga0157374_10693558 3300013296 Bacteria 1031
98 Ga0157374_10797775 3300013296 Bacteria 960
99 Ga0157378_10835814 3300013297 Bacteria 948
100 Ga0157378_10978252 3300013297 Unclassified 880
101 Ga0163162_10003972 3300013306 Bacteria 14182
102 Ga0163162_10491915 3300013306 Bacteria 1357
103 Ga0157372_10110370 3300013307 Bacteria 3150
104 Ga0157372_10208971 3300013307 Bacteria 2262
105 Ga0163163_10083015 3300014325 Bacteria 3209
106 Ga0163163_10252786 3300014325 Bacteria 1813
107 Ga0157379_10025161 3300014968 Bacteria 5284
108 Ga0157379_10068044 3300014968 Bacteria 3184
109 Ga0157376_10005639 3300014969 Bacteria 8761
110 Ga0207692_10217114 3300025898 Bacteria 1132
111 Ga0207710_10082253 3300025900 Bacteria 1495
112 Ga0207680_10003395 3300025903 Bacteria 7507
113 Ga0207685_10000009 3300025905 Bacteria 242842
114 Ga0207699_10075210 3300025906 Bacteria 2077
115 Ga0207705_10093310 3300025909 Bacteria 2207
116 Ga0207684_10007800 3300025910 Bacteria 9575
117 Ga0207654_10018467 3300025911 Bacteria 3660
118 Ga0207671_10013210 3300025914 Bacteria 6589
119 Ga0207693_10002916 3300025915 Bacteria 14803
120 Ga0207663_10003119 3300025916 Bacteria 8044
121 Ga0207681_10112079 3300025923 Bacteria 1986
122 Ga0207694_10519528 3300025924 Bacteria 998
123 Ga0207650_10095508 3300025925 Bacteria 2279
124 Ga0207659_10048634 3300025926 Unclassified 3005
125 Ga0207659_10135922 3300025926 Bacteria 1903
126 Ga0207644_10160883 3300025931 Unclassified 1745
127 Ga0207644_10671656 3300025931 Bacteria 863
128 Ga0207706_10109298 3300025933 Bacteria 2433
129 Ga0207686_10031279 3300025934 Bacteria 3158
130 Ga0207704_10283341 3300025938 Bacteria 1261
131 Ga0207665_10448013 3300025939 Bacteria 990
132 Ga0207711_10429981 3300025941 Bacteria 1228
133 Ga0207689_10001712 3300025942 Bacteria 20762
134 Ga0207689_10006415 3300025942 Bacteria 10403
135 Ga0207689_10104884 3300025942 Bacteria 2323
136 Ga0207679_10152880 3300025945 Bacteria 1881
137 Ga0207667_10234935 3300025949 Unclassified 1877
138 Ga0207651_10082903 3300025960 Unclassified 2317
139 Ga0207651_10575552 3300025960 Unclassified 982
140 Ga0207651_10631617 3300025960 Bacteria 939
141 Ga0207712_10203116 3300025961 Bacteria 1573
142 Ga0207712_10978762 3300025961 Unclassified 750
143 Ga0207658_10002641 3300025986 Bacteria 12990
144 Ga0207658_10046089 3300025986 Bacteria 3182
145 Ga0207677_10282007 3300026023 Unclassified 1364
146 Ga0207703_10012644 3300026035 Bacteria 6581
147 Ga0207639_10099660 3300026041 Bacteria 2345
148 Ga0207641_10000097 3300026088 Bacteria 123547
149 Ga0207641_10224601 3300026088 Bacteria 1743
150 Ga0207648_10318508 3300026089 Bacteria 1397
151 Ga0207676_10008895 3300026095 Bacteria 7145
152 Ga0207674_10374819 3300026116 Bacteria 1376
153 Ga0207683_10270391 3300026121 Bacteria 1552
154 Ga0268266_10002552 3300028379 Bacteria 19326
155 Ga0268265_10044091 3300028380 Bacteria 3319
156 Ga0268264_10024555 3300028381 Bacteria 4921
157 Ga0265338_10093673 3300028800 Bacteria 2474
158 Ga0307509_10543697 3300031507 Bacteria 840
159 Ga0307408_100055998 3300031548 Bacteria 2858
160 Ga0307413_10356786 3300031824 Bacteria 1130
161 Ga0307410_10006192 3300031852 Bacteria 6430
162 Ga0307409_100107979 3300031995 Unclassified 2326
163 Ga0307409_101142679 3300031995 Bacteria 801
164 Ga0307411_10061060 3300032005 Bacteria 2507
165 Ga0373933_0156026 3300035724 Unclassified 1448
166 Ga0373937_0526081 3300036401 Unclassified 1124
167 Ga0395900_0014242 3300037418 Bacteria 8117
168 Ga0395900_0288419 3300037418 Bacteria 1631
169 Ga0395905_0069711 3300037471 Bacteria 3293
170 Ga0395905_0505339 3300037471 Bacteria 1109
171 Ga0395901_0110287 3300038443 Bacteria 2889
172 Ga0439437_000361 3300042000 Bacteria 4341
173 Ga0450914_013708 3300042118 Bacteria 829
174 Ga0450917_000129 3300042120 Bacteria 4836
175 Ga0450888_000379 3300042126 Bacteria 4234
176 Ga0450891_000218 3300042129 Bacteria 5755
177 Ga0450892_000444 3300042130 Bacteria 4813
178 Ga0450889_000424 3300042144 Bacteria 4690
179 Ga0451577_0000046 3300042876 Bacteria 320581
180 Ga0451577_0000281 3300042876 Bacteria 98760
181 Ga0451577_0012459 3300042876 Bacteria 7986
182 Ga0453683_0022922 3300044673 Bacteria 3980
183 Ga0466965_0317131 3300044683 Bacteria 849
184 Ga0453684_0000178 3300044712 Bacteria 282502
185 Ga0453684_0004526 3300044712 Bacteria 29172
186 Ga0453684_0015270 3300044712 Bacteria 12174
187 Ga0453684_0018609 3300044712 Bacteria 10648
188 Ga0453684_0018908 3300044712 Bacteria 10537
189 Ga0451576_0000184 3300045051 Bacteria 157166
190 Ga0451576_0019326 3300045051 Bacteria 7435
191 Ga0451576_0428100 3300045051 Bacteria 1389
192 Ga0495580_0030287 3300046472 Bacteria 3920
193 Ga0495639_0024294 3300046475 Bacteria 2668
194 Ga0495598_0040386 3300046537 Bacteria 1360
195 Ga0495645_0088362 3300046543 Unclassified 2217
196 Ga0495669_0058300 3300046684 Bacteria 1742
197 Ga0495613_0458408 3300046689 Unclassified 863
198 Ga0495581_0007951 3300047315 Bacteria 6143
199 Ga0495674_0005449 3300047319 Bacteria 12227
200 Ga0495684_0004363 3300047471 Bacteria 11049
201 Ga0495684_0060991 3300047471 Unclassified 2870
202 Ga0496100_0178047 3300048903 Bacteria 1536
203 Ga0496101_0212510 3300048904 Bacteria 1499
204 Ga0496102_0638429 3300048905 Unclassified 988
205 Ga0496106_0152392 3300048909 Bacteria 1824
206 Ga0496108_0260147 3300048911 Bacteria 1510
207 Ga0501032_0100728 3300049569 Bacteria 1914
208 Ga0501034_0593027 3300049571 Bacteria 1014
209 Ga0501037_0007184 3300049573 Bacteria 8138
210 Ga0501047_0017280 3300049581 Bacteria 6908
211 Ga0501070_0051303 3300049586 Bacteria 3425
212 Ga0501070_0169764 3300049586 Unclassified 1797
213 Ga0501222_005174 3300049662 Bacteria 1763
214 Ga0501242_014370 3300049674 Unclassified 980
215 Ga0501080_0094742 3300049742 Unclassified 2772
216 Ga0501044_0003018 3300049823 Bacteria 19044
217 nmdc:mga05p37_13205_c1 3300050507 Bacteria 9886
218 nmdc:mga0qj67_409607_c1 3300050509 Archaea 1094
219 nmdc:mga0qj67_498284_c1 3300050509 Bacteria 979
220 nmdc:mga06r32_10550_c1 3300050510 Bacteria 8331
221 nmdc:mga0n895_561716_c1 3300050512 Unclassified 1146
222 nmdc:mga0a205_760847_c1 3300050515 Bacteria 817
223 Ga0207649_10269579
224 SwRhRL3b_contig_3262875
225 SwRhRL2b_contig_497106
226 rootH1_10019609
227 rootL2_10009642
228 rootL2_10013254
229 rootL2_10038413
230 rootL2_10203124
231 rootH1_10015045
232 rootH1_10027255
233 Ga0065704_10009620
234 Ga0065715_10093059
235 Ga0065707_10005087
236 Ga0070658_10048961
237 Ga0070690_100150312
238 Ga0070670_100073867
239 Ga0068869_100012413
240 Ga0068869_100078402
241 Ga0068869_100570894
242 Ga0070666_10000465
243 Ga0070689_100323011
244 Ga0070661_100084296
245 Ga0070661_100321770
246 Ga0070668_100632872
247 Ga0070669_100085505
248 Ga0070675_100079522
249 Ga0070675_100394692
250 Ga0070675_100897229
251 Ga0070671_100118139
252 Ga0070671_100186996
253 Ga0070671_100531758
254 Ga0070674_100041041
255 Ga0070673_100140370
256 Ga0070673_100338204
257 Ga0070688_100336892
258 Ga0070667_100009499
259 Ga0070667_100636415
260 Ga0070709_10103164
261 Ga0070714_100001731
262 Ga0070713_100382843
263 Ga0070711_100141885
264 Ga0070705_100172363
265 Ga0070705_100254924
266 Ga0070678_100331764
267 Ga0070662_100074430
268 Ga0068867_100258336
269 Ga0070706_100005301
270 Ga0070698_100005473
271 Ga0070698_100034822
272 Ga0070698_100077781
273 Ga0070698_100303108
274 Ga0070699_100158215
275 Ga0070697_100793101
276 Ga0070665_100004697
277 Ga0070704_100074958
278 Ga0070664_100188769
279 Ga0068859_100000063
280 Ga0068863_100057053
281 Ga0068863_100302287
282 Ga0068858_100008653
283 Ga0068858_100873101
284 Ga0068860_100002526
285 Ga0068860_100013297
286 Ga0068860_100390339
287 Ga0068862_100006544
288 Ga0081539_10025225
289 Ga0070715_10000030
290 Ga0070716_100144465
291 Ga0070712_100003989
292 Ga0070712_100105359
293 Ga0097621_100103469
294 Ga0068871_100328745
295 Ga0075430_100562841
296 Ga0068865_100132939
297 Ga0097620_100000063
298 Ga0111539_10048342
299 Ga0105245_10385053
300 Ga0105247_10004586
301 Ga0114129_10155531
302 Ga0105243_10513234
303 Ga0105241_10015987
304 Ga0105241_10094331
305 Ga0105241_10663809
306 Ga0105242_10049477
307 Ga0105248_10579909
308 Ga0105248_11003461
309 Ga0105248_11097928
310 Ga0105237_10017623
311 Ga0105238_10209100
312 Ga0105238_10698969
313 Ga0105238_11129082
314 Ga0105239_11714327
315 Ga0105246_10026417
316 Ga0157369_10016582
317 Ga0157374_10025405
318 Ga0157374_10086365
319 Ga0157374_10693558
320 Ga0157374_10797775
321 Ga0157378_10835814
322 Ga0157378_10978252
323 Ga0163162_10003972
324 Ga0163162_10491915
325 Ga0157372_10110370
326 Ga0157372_10208971
327 Ga0163163_10083015
328 Ga0163163_10252786
329 Ga0157379_10025161
330 Ga0157379_10068044
331 Ga0157376_10005639
332 Ga0207692_10217114
333 Ga0207710_10082253
334 Ga0207680_10003395
335 Ga0207685_10000009
336 Ga0207699_10075210
337 Ga0207705_10093310
338 Ga0207684_10007800
339 Ga0207654_10018467
340 Ga0207671_10013210
341 Ga0207693_10002916
342 Ga0207663_10003119
343 Ga0207681_10112079
344 Ga0207694_10519528
345 Ga0207650_10095508
346 Ga0207659_10048634
347 Ga0207659_10135922
348 Ga0207644_10160883
349 Ga0207644_10671656
350 Ga0207706_10109298
351 Ga0207686_10031279
352 Ga0207704_10283341
353 Ga0207665_10448013
354 Ga0207711_10429981
355 Ga0207689_10001712
356 Ga0207689_10006415
357 Ga0207689_10104884
358 Ga0207679_10152880
359 Ga0207667_10234935
360 Ga0207651_10082903
361 Ga0207651_10575552
362 Ga0207651_10631617
363 Ga0207712_10203116
364 Ga0207712_10978762
365 Ga0207658_10002641
366 Ga0207658_10046089
367 Ga0207677_10282007
368 Ga0207703_10012644
369 Ga0207639_10099660
370 Ga0207641_10000097
371 Ga0207641_10224601
372 Ga0207648_10318508
373 Ga0207676_10008895
374 Ga0207674_10374819
375 Ga0207683_10270391
376 Ga0268266_10002552
377 Ga0268265_10044091
378 Ga0268264_10024555
379 Ga0265338_10093673
380 Ga0307509_10543697
381 Ga0307408_100055998
382 Ga0307413_10356786
383 Ga0307410_10006192
384 Ga0307409_100107979
385 Ga0307409_101142679
386 Ga0307411_10061060
387 Ga0373933_0156026
388 Ga0373937_0526081
389 Ga0395900_0014242
390 Ga0395900_0288419
391 Ga0395905_0069711
392 Ga0395905_0505339
393 Ga0395901_0110287
394 Ga0439437_000361
395 Ga0450914_013708
396 Ga0450917_000129
397 Ga0450888_000379
398 Ga0450891_000218
399 Ga0450892_000444
400 Ga0450889_000424
401 Ga0451577_0000046
402 Ga0451577_0000281
403 Ga0451577_0012459
404 Ga0453683_0022922
405 Ga0466965_0317131
406 Ga0453684_0000178
407 Ga0453684_0004526
408 Ga0453684_0015270
409 Ga0453684_0018609
410 Ga0453684_0018908
411 Ga0451576_0000184
412 Ga0451576_0019326
413 Ga0451576_0428100
414 Ga0495580_0030287
415 Ga0495639_0024294
416 Ga0495598_0040386
417 Ga0495645_0088362
418 Ga0495669_0058300
419 Ga0495613_0458408
420 Ga0495581_0007951
421 Ga0495674_0005449
422 Ga0495684_0004363
423 Ga0495684_0060991
424 Ga0496100_0178047
425 Ga0496101_0212510
426 Ga0496102_0638429
427 Ga0496106_0152392
428 Ga0496108_0260147
429 Ga0501032_0100728
430 Ga0501034_0593027
431 Ga0501037_0007184
432 Ga0501047_0017280
433 Ga0501070_0051303
434 Ga0501070_0169764
435 Ga0501222_005174
436 Ga0501242_014370
437 Ga0501080_0094742
438 Ga0501044_0003018
439 nmdc:mga05p37_13205_c1
440 nmdc:mga0qj67_409607_c1
441 nmdc:mga0qj67_498284_c1
442 nmdc:mga06r32_10550_c1
443 nmdc:mga0n895_561716_c1
444 nmdc:mga0a205_760847_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

46

158

0.97

PF00196

GerE

Bacterial regulatory proteins, luxR family

192

248

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3p7n-assembly2.cif.gz_B crystal structure of light activated transcription factor el222 from erythrobacter litoralis 0.954 155 214
1xhf-assembly1.cif.gz_A crystal structure of the bef3-activated receiver domain of redox response regulator arca 0.9423 7 128
2zwm-assembly1.cif.gz_B crystal structure of yycf receiver domain from bacillus subtilis 0.9405 8 127
4d6x-assembly1.cif.gz_A crystal structure of the receiver domain of ntrx from brucella abortus 0.94 11 128
6ekh-assembly1.cif.gz_Y crystal structure of activated chey from methanoccocus maripaludis 0.9384 7 126
ID Description Score Start End Superfamily
3c3wB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9644 9 88 3.40.50.2300
3kloB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9575 155 215 1.10.10.10
3p7nB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.954 155 214 1.10.10.10
2o8xA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9514 156 201 1.10.10.10
3kloA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9513 154 215 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A3N5V2C4-F1-model_v4 DNA-binding response regulator 0.96 8 135 GO:0000160
GO:0003677
AF-A0A2H6F7T1-F1-model_v4 Oxygen regulatory protein NreC 0.9595 8 221 GO:0000160
GO:0003677
GO:0006355
AF-A0A3A0AXL9-F1-model_v4 Response regulatory domain-containing protein 0.9527 7 145 GO:0000160
AF-A0A848WQD7-F1-model_v4 Response regulator transcription factor 0.9521 6 220 GO:0000160
GO:0003677
GO:0006355
AF-A0A7V6FDJ7-F1-model_v4 Response regulator transcription factor 0.9502 7 132 GO:0000160

Map