F334309

General Info

Members Datasets Scaffolds Average Seq Length
222 172 444 363

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10005681|Ga0075365_100056816
Length 396
Sequence MEEKRRRNGDGAPAAAASERTLEIDGREIGDHTDCYVIAEIGHNHQGSLKQAIELFEKAADCGVDAVKLQKRDNRSLYTTEYYNRPYDHENSFGATYGEHREVLELGRHEYLELQQVAGDLGITMLATAFDVPSAEFLAELDVPAIKIASADLRNTPLLRRVAELGKPMIISTGAARLEDVHMAHEAVAPINSEFAFLQCTAVYPPTWEELDLRVIETYRREFPNTVIGFSGHDSGIAMATAAYVLGARIVEKHFTLNRAMKGTDHAFSLEPHGLRSLVRDLRRTRVALGDGSKRMYQSETEPAKKMGKKLVAARDLPAGHVLTEEDIAAKSPGDGLPPCELDRLVGRRLGYPVTEELPLTFDLLEDPAVGGPGRLARSGEIDSSPVAAAAGDDES

Samples

Sample ID Description Type Environment
1 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
6 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
7 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
8 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
14 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
19 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
22 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
26 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
42 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
93 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
94 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
95 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
98 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
101 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
102 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
103 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
104 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
105 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
112 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
113 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
114 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
117 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
118 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
119 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
120 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
121 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
122 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
123 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
124 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
125 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
126 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
127 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
128 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
129 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
130 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
131 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
132 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
133 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
134 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
135 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
143 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
146 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
147 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
148 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
153 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
154 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
155 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
156 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
157 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
158 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
159 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
160 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
161 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
162 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
163 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
164 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
165 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
166 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
167 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
168 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
169 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
170 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
171 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
172 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.5
Nodule 0
Rhizoplane 8.11
Rhizosphere 86.94
Stem 0
Stem Tuber 0
Unclassified 2.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075365_10005681 3300006038 Bacteria 6761
2 JGI25404J52841_10007511 3300003659 Bacteria 2306
3 Ga0070683_100014752 3300005329 Bacteria 6845
4 Ga0070683_100054712 3300005329 Bacteria 3701
5 Ga0070668_100006032 3300005347 Bacteria 8988
6 Ga0070705_100124686 3300005440 Bacteria 1669
7 Ga0070700_100004666 3300005441 Bacteria 7181
8 Ga0070694_100016258 3300005444 Bacteria 4683
9 Ga0070662_100000344 3300005457 Bacteria 27920
10 Ga0070681_10032691 3300005458 Bacteria 5223
11 Ga0070699_100008072 3300005518 Bacteria 9136
12 Ga0070699_100016954 3300005518 Bacteria 6253
13 Ga0070679_100088282 3300005530 Bacteria 3088
14 Ga0070684_100163671 3300005535 Unclassified 2019
15 Ga0070697_100001922 3300005536 Bacteria 15904
16 Ga0070697_100035793 3300005536 Bacteria 4007
17 Ga0070696_100001123 3300005546 Bacteria 17326
18 Ga0070696_100015361 3300005546 Bacteria 5142
19 Ga0070696_100306808 3300005546 Bacteria 1217
20 Ga0068856_100000133 3300005614 Bacteria 75774
21 Ga0070702_100123440 3300005615 Bacteria 1625
22 Ga0068859_100034565 3300005617 Bacteria 5073
23 Ga0068861_100003946 3300005719 Bacteria 9925
24 Ga0068862_100116052 3300005844 Bacteria 2355
25 Ga0081455_10000448 3300005937 Bacteria 54262
26 Ga0081455_10001427 3300005937 Bacteria 29556
27 Ga0081538_10024397 3300005981 Bacteria 4308
28 Ga0081540_1000003 3300005983 Bacteria 233942
29 Ga0081539_10000032 3300005985 Bacteria 311452
30 Ga0081539_10040174 3300005985 Bacteria 2749
31 Ga0075365_10165667 3300006038 Bacteria 1542
32 Ga0075364_10005883 3300006051 Bacteria 7164
33 Ga0075364_10016493 3300006051 Bacteria 4597
34 Ga0075366_10000749 3300006195 Bacteria 15439
35 Ga0075433_10122988 3300006852 Bacteria 2305
36 Ga0075434_100053664 3300006871 Bacteria 4005
37 Ga0075436_100031362 3300006914 Bacteria 3660
38 Ga0097620_100034565 3300006931 Bacteria 5073
39 Ga0075435_100021851 3300007076 Bacteria 4930
40 Ga0111539_10004557 3300009094 Bacteria 18115
41 Ga0111539_10020992 3300009094 Bacteria 8042
42 Ga0111539_10057591 3300009094 Bacteria 4614
43 Ga0111539_10434644 3300009094 Bacteria 1528
44 Ga0111539_10615936 3300009094 Bacteria 1264
45 Ga0105245_10005643 3300009098 Bacteria 10994
46 Ga0114129_10064424 3300009147 Bacteria 5115
47 Ga0114129_10282741 3300009147 Bacteria 2216
48 Ga0114129_10418711 3300009147 Bacteria 1762
49 Ga0114129_10580530 3300009147 Bacteria 1454
50 Ga0105241_10040067 3300009174 Bacteria 3535
51 Ga0105242_10013380 3300009176 Bacteria 6338
52 Ga0105237_10005858 3300009545 Bacteria 13783
53 Ga0105249_10001059 3300009553 Bacteria 24387
54 Ga0105239_10079412 3300010375 Bacteria 3611
55 Ga0157369_10000641 3300013105 Bacteria 45168
56 Ga0157369_10016163 3300013105 Bacteria 8402
57 Ga0157369_10076963 3300013105 Bacteria 3576
58 Ga0157369_10163666 3300013105 Bacteria 2347
59 Ga0163162_10101457 3300013306 Bacteria 2970
60 Ga0163161_10163802 3300017792 Bacteria 1697
61 Ga0207692_10010541 3300025898 Bacteria 3900
62 Ga0207710_10005908 3300025900 Bacteria 5250
63 Ga0207688_10032000 3300025901 Bacteria 2906
64 Ga0207680_10040447 3300025903 Bacteria 2713
65 Ga0207647_10002865 3300025904 Bacteria 12986
66 Ga0207699_10047463 3300025906 Bacteria 2518
67 Ga0207645_10029366 3300025907 Bacteria 3546
68 Ga0207684_10081594 3300025910 Unclassified 2752
69 Ga0207654_10003605 3300025911 Bacteria 7820
70 Ga0207654_10015202 3300025911 Bacteria 3989
71 Ga0207671_10068480 3300025914 Bacteria 2645
72 Ga0207671_10079360 3300025914 Bacteria 2459
73 Ga0207693_10000404 3300025915 Bacteria 39462
74 Ga0207663_10012328 3300025916 Bacteria 4620
75 Ga0207660_10067277 3300025917 Bacteria 2594
76 Ga0207657_10001543 3300025919 Bacteria 24675
77 Ga0207649_10116039 3300025920 Bacteria 1797
78 Ga0207681_10014530 3300025923 Bacteria 4895
79 Ga0207650_10018649 3300025925 Bacteria 4871
80 Ga0207687_10053571 3300025927 Bacteria 2819
81 Ga0207687_10058765 3300025927 Bacteria 2707
82 Ga0207700_10061985 3300025928 Bacteria 2839
83 Ga0207664_10042491 3300025929 Bacteria 3548
84 Ga0207664_10046294 3300025929 Bacteria 3414
85 Ga0207644_10173175 3300025931 Bacteria 1686
86 Ga0207690_10062379 3300025932 Bacteria 2537
87 Ga0207706_10000630 3300025933 Bacteria 37440
88 Ga0207706_10001189 3300025933 Bacteria 26270
89 Ga0207686_10008290 3300025934 Bacteria 5606
90 Ga0207709_10005688 3300025935 Bacteria 7040
91 Ga0207670_10006151 3300025936 Bacteria 6640
92 Ga0207704_10059332 3300025938 Bacteria 2361
93 Ga0207665_10001635 3300025939 Bacteria 15070
94 Ga0207691_10024679 3300025940 Bacteria 5654
95 Ga0207711_10266258 3300025941 Bacteria 1576
96 Ga0207661_10028564 3300025944 Bacteria 4273
97 Ga0207667_10013475 3300025949 Bacteria 9355
98 Ga0207651_10017814 3300025960 Bacteria 4207
99 Ga0207712_10004045 3300025961 Bacteria 9264
100 Ga0207712_10047432 3300025961 Bacteria 2983
101 Ga0207668_10003300 3300025972 Bacteria 9460
102 Ga0207668_10011246 3300025972 Bacteria 5432
103 Ga0207640_10003206 3300025981 Bacteria 8812
104 Ga0207658_10207588 3300025986 Bacteria 1639
105 Ga0207678_10000987 3300026067 Bacteria 25938
106 Ga0207708_10000758 3300026075 Bacteria 24232
107 Ga0207708_10006876 3300026075 Bacteria 8416
108 Ga0207708_10185197 3300026075 Bacteria 1654
109 Ga0207702_10000519 3300026078 Bacteria 43279
110 Ga0207702_10029740 3300026078 Bacteria 4547
111 Ga0207641_10038069 3300026088 Bacteria 4020
112 Ga0207676_10133493 3300026095 Bacteria 2114
113 Ga0207674_10005874 3300026116 Bacteria 14552
114 Ga0207675_100001214 3300026118 Bacteria 25698
115 Ga0207675_100005696 3300026118 Bacteria 11921
116 Ga0207683_10000157 3300026121 Bacteria 57316
117 Ga0207698_10345738 3300026142 Unclassified 1403
118 Ga0207428_10004647 3300027907 Bacteria 13007
119 Ga0207428_10011203 3300027907 Bacteria 7950
120 Ga0268266_10194658 3300028379 Bacteria 1852
121 Ga0268265_10015246 3300028380 Bacteria 5255
122 Ga0268265_10152135 3300028380 Bacteria 1953
123 Ga0268264_10078976 3300028381 Bacteria 2806
124 Ga0265334_10033886 3300028573 Bacteria 2030
125 Ga0265338_10124529 3300028800 Unclassified 2048
126 Ga0265320_10011694 3300031240 Bacteria 5152
127 Ga0265316_10171348 3300031344 Unclassified 1619
128 Ga0307408_100102500 3300031548 Bacteria 2183
129 Ga0307413_10055501 3300031824 Bacteria 2411
130 Ga0307412_10325699 3300031911 Bacteria 1224
131 Ga0307409_100058882 3300031995 Bacteria 2986
132 Ga0307409_100094441 3300031995 Bacteria 2461
133 Ga0307414_10250035 3300032004 Bacteria 1473
134 Ga0373948_0010121 3300034817 Bacteria 1641
135 Ga0373951_0021607 3300035091 Bacteria 1479
136 Ga0373960_0004587 3300035121 Bacteria 3170
137 Ga0373931_0001688 3300035691 Bacteria 9565
138 Ga0373937_0138678 3300036401 Bacteria 2275
139 Ga0373925_0036331 3300037068 Bacteria 3636
140 Ga0395900_0008068 3300037418 Bacteria 10837
141 Ga0395900_0091806 3300037418 Bacteria 3120
142 Ga0395900_0170079 3300037418 Bacteria 2219
143 Ga0395898_0002689 3300037466 Bacteria 20565
144 Ga0395898_0011783 3300037466 Bacteria 9064
145 Ga0395898_0062966 3300037466 Bacteria 3601
146 Ga0395898_0340590 3300037466 Bacteria 1430
147 Ga0395905_0007048 3300037471 Bacteria 11236
148 Ga0395905_0035815 3300037471 Bacteria 4661
149 Ga0395901_0014271 3300038443 Bacteria 8088
150 Ga0395901_0036415 3300038443 Bacteria 5086
151 Ga0395901_0099141 3300038443 Bacteria 3055
152 Ga0400489_13688 3300039093 Bacteria 36440
153 Ga0453683_0018073 3300044673 Bacteria 4529
154 Ga0453684_0002632 3300044712 Bacteria 42894
155 Ga0451576_0005964 3300045051 Bacteria 15089
156 Ga0466967_0006887 3300045976 Bacteria 8116
157 Ga0495603_0019234 3300046455 Bacteria 4135
158 Ga0495629_0004941 3300046459 Bacteria 10000
159 Ga0495580_0063229 3300046472 Bacteria 2596
160 Ga0495582_0015947 3300046473 Bacteria 4119
161 Ga0495639_0020291 3300046475 Bacteria 2904
162 Ga0495664_0020250 3300046477 Bacteria 3835
163 Ga0495594_0006852 3300046499 Bacteria 5857
164 Ga0495618_0039601 3300046514 Bacteria 2963
165 Ga0495640_0212408 3300046533 Bacteria 1223
166 Ga0495634_0022754 3300046642 Bacteria 4415
167 Ga0495658_0029160 3300046683 Bacteria 2984
168 Ga0495613_0079198 3300046689 Bacteria 2389
169 Ga0495581_0029878 3300047315 Bacteria 3159
170 Ga0495680_0120219 3300047322 Bacteria 1940
171 Ga0495684_0023886 3300047471 Bacteria 4701
172 Ga0495614_0079543 3300048089 Bacteria 1419
173 Ga0496100_0200046 3300048903 Bacteria 1455
174 Ga0496101_0003487 3300048904 Bacteria 9811
175 Ga0496102_0197894 3300048905 Unclassified 1894
176 Ga0496102_0234860 3300048905 Bacteria 1728
177 Ga0496103_0128125 3300048906 Bacteria 1619
178 Ga0496104_0038048 3300048907 Bacteria 4499
179 Ga0496105_0013585 3300048908 Bacteria 6467
180 Ga0496106_0002201 3300048909 Bacteria 14554
181 Ga0496107_0133628 3300048910 Bacteria 1832
182 Ga0496108_0033825 3300048911 Bacteria 4245
183 Ga0496109_0044719 3300048912 Bacteria 4017
184 Ga0496110_0079914 3300048913 Bacteria 2912
185 Ga0496111_0139143 3300048914 Bacteria 1798
186 Ga0496112_0052057 3300048915 Bacteria 4017
187 Ga0496112_0056409 3300048915 Bacteria 3866
188 Ga0496113_0196953 3300048916 Bacteria 1600
189 Ga0496114_0000513 3300048917 Bacteria 28429
190 Ga0496115_0034503 3300048918 Bacteria 3998
191 Ga0501040_0086140 3300049576 Bacteria 2181
192 Ga0501041_0061702 3300049577 Bacteria 2295
193 Ga0501042_0047737 3300049578 Bacteria 3053
194 Ga0501048_0174413 3300049582 Bacteria 1524
195 Ga0501072_0048977 3300049588 Bacteria 3326
196 Ga0501076_0086974 3300049592 Bacteria 2512
197 Ga0501077_0026614 3300049593 Bacteria 3671
198 Ga0501079_0051127 3300049741 Bacteria 3190
199 Ga0501081_0036471 3300049743 Bacteria 3353
200 nmdc:mga00v17_7004_c1 3300050491 Bacteria 6001
201 nmdc:mga0yw44_92981_c1 3300050492 Bacteria 1909
202 nmdc:mga0yw44_9338_c1 3300050492 Bacteria 4951
203 nmdc:mga0k408_528_c1 3300050493 Bacteria 18175
204 nmdc:mga05p37_106221_c1 3300050507 Bacteria 3454
205 nmdc:mga05p37_168139_c1 3300050507 Bacteria 2675
206 nmdc:mga05p37_214307_c1 3300050507 Bacteria 2326
207 nmdc:mga06r32_54258_c1 3300050510 Bacteria 3843
208 nmdc:mga08y16_16826_c1 3300050511 Bacteria 7697
209 nmdc:mga08y16_2731_c1 3300050511 Bacteria 18099
210 nmdc:mga08y16_70703_c1 3300050511 Bacteria 3638
211 nmdc:mga0n895_10485_c1 3300050512 Bacteria 8193
212 nmdc:mga0rr50_70378_c1 3300050513 Bacteria 2666
213 nmdc:mga0a205_47792_c1 3300050515 Bacteria 4129
214 nmdc:mga0a205_51262_c1 3300050515 Bacteria 3984
215 Ga0495612_0032183 3300053078 Bacteria 2118
216 Ga0495619_0003430 3300053085 Bacteria 10231
217 Ga0495619_0012105 3300053085 Bacteria 5435
218 Ga0500645_007449 3300053730 Bacteria 3809
219 Ga0501084_0224927 3300054114 Bacteria 1584
220 Ga0590071_002396 3300059421 Bacteria 4712
221 Ga0590074_002552 3300059423 Bacteria 2992
222 Ga0530510_0001370 3300061734 Bacteria 16306
223 Ga0075365_10005681
224 JGI25404J52841_10007511
225 Ga0070683_100014752
226 Ga0070683_100054712
227 Ga0070668_100006032
228 Ga0070705_100124686
229 Ga0070700_100004666
230 Ga0070694_100016258
231 Ga0070662_100000344
232 Ga0070681_10032691
233 Ga0070699_100008072
234 Ga0070699_100016954
235 Ga0070679_100088282
236 Ga0070684_100163671
237 Ga0070697_100001922
238 Ga0070697_100035793
239 Ga0070696_100001123
240 Ga0070696_100015361
241 Ga0070696_100306808
242 Ga0068856_100000133
243 Ga0070702_100123440
244 Ga0068859_100034565
245 Ga0068861_100003946
246 Ga0068862_100116052
247 Ga0081455_10000448
248 Ga0081455_10001427
249 Ga0081538_10024397
250 Ga0081540_1000003
251 Ga0081539_10000032
252 Ga0081539_10040174
253 Ga0075365_10165667
254 Ga0075364_10005883
255 Ga0075364_10016493
256 Ga0075366_10000749
257 Ga0075433_10122988
258 Ga0075434_100053664
259 Ga0075436_100031362
260 Ga0097620_100034565
261 Ga0075435_100021851
262 Ga0111539_10004557
263 Ga0111539_10020992
264 Ga0111539_10057591
265 Ga0111539_10434644
266 Ga0111539_10615936
267 Ga0105245_10005643
268 Ga0114129_10064424
269 Ga0114129_10282741
270 Ga0114129_10418711
271 Ga0114129_10580530
272 Ga0105241_10040067
273 Ga0105242_10013380
274 Ga0105237_10005858
275 Ga0105249_10001059
276 Ga0105239_10079412
277 Ga0157369_10000641
278 Ga0157369_10016163
279 Ga0157369_10076963
280 Ga0157369_10163666
281 Ga0163162_10101457
282 Ga0163161_10163802
283 Ga0207692_10010541
284 Ga0207710_10005908
285 Ga0207688_10032000
286 Ga0207680_10040447
287 Ga0207647_10002865
288 Ga0207699_10047463
289 Ga0207645_10029366
290 Ga0207684_10081594
291 Ga0207654_10003605
292 Ga0207654_10015202
293 Ga0207671_10068480
294 Ga0207671_10079360
295 Ga0207693_10000404
296 Ga0207663_10012328
297 Ga0207660_10067277
298 Ga0207657_10001543
299 Ga0207649_10116039
300 Ga0207681_10014530
301 Ga0207650_10018649
302 Ga0207687_10053571
303 Ga0207687_10058765
304 Ga0207700_10061985
305 Ga0207664_10042491
306 Ga0207664_10046294
307 Ga0207644_10173175
308 Ga0207690_10062379
309 Ga0207706_10000630
310 Ga0207706_10001189
311 Ga0207686_10008290
312 Ga0207709_10005688
313 Ga0207670_10006151
314 Ga0207704_10059332
315 Ga0207665_10001635
316 Ga0207691_10024679
317 Ga0207711_10266258
318 Ga0207661_10028564
319 Ga0207667_10013475
320 Ga0207651_10017814
321 Ga0207712_10004045
322 Ga0207712_10047432
323 Ga0207668_10003300
324 Ga0207668_10011246
325 Ga0207640_10003206
326 Ga0207658_10207588
327 Ga0207678_10000987
328 Ga0207708_10000758
329 Ga0207708_10006876
330 Ga0207708_10185197
331 Ga0207702_10000519
332 Ga0207702_10029740
333 Ga0207641_10038069
334 Ga0207676_10133493
335 Ga0207674_10005874
336 Ga0207675_100001214
337 Ga0207675_100005696
338 Ga0207683_10000157
339 Ga0207698_10345738
340 Ga0207428_10004647
341 Ga0207428_10011203
342 Ga0268266_10194658
343 Ga0268265_10015246
344 Ga0268265_10152135
345 Ga0268264_10078976
346 Ga0265334_10033886
347 Ga0265338_10124529
348 Ga0265320_10011694
349 Ga0265316_10171348
350 Ga0307408_100102500
351 Ga0307413_10055501
352 Ga0307412_10325699
353 Ga0307409_100058882
354 Ga0307409_100094441
355 Ga0307414_10250035
356 Ga0373948_0010121
357 Ga0373951_0021607
358 Ga0373960_0004587
359 Ga0373931_0001688
360 Ga0373937_0138678
361 Ga0373925_0036331
362 Ga0395900_0008068
363 Ga0395900_0091806
364 Ga0395900_0170079
365 Ga0395898_0002689
366 Ga0395898_0011783
367 Ga0395898_0062966
368 Ga0395898_0340590
369 Ga0395905_0007048
370 Ga0395905_0035815
371 Ga0395901_0014271
372 Ga0395901_0036415
373 Ga0395901_0099141
374 Ga0400489_13688
375 Ga0453683_0018073
376 Ga0453684_0002632
377 Ga0451576_0005964
378 Ga0466967_0006887
379 Ga0495603_0019234
380 Ga0495629_0004941
381 Ga0495580_0063229
382 Ga0495582_0015947
383 Ga0495639_0020291
384 Ga0495664_0020250
385 Ga0495594_0006852
386 Ga0495618_0039601
387 Ga0495640_0212408
388 Ga0495634_0022754
389 Ga0495658_0029160
390 Ga0495613_0079198
391 Ga0495581_0029878
392 Ga0495680_0120219
393 Ga0495684_0023886
394 Ga0495614_0079543
395 Ga0496100_0200046
396 Ga0496101_0003487
397 Ga0496102_0197894
398 Ga0496102_0234860
399 Ga0496103_0128125
400 Ga0496104_0038048
401 Ga0496105_0013585
402 Ga0496106_0002201
403 Ga0496107_0133628
404 Ga0496108_0033825
405 Ga0496109_0044719
406 Ga0496110_0079914
407 Ga0496111_0139143
408 Ga0496112_0052057
409 Ga0496112_0056409
410 Ga0496113_0196953
411 Ga0496114_0000513
412 Ga0496115_0034503
413 Ga0501040_0086140
414 Ga0501041_0061702
415 Ga0501042_0047737
416 Ga0501048_0174413
417 Ga0501072_0048977
418 Ga0501076_0086974
419 Ga0501077_0026614
420 Ga0501079_0051127
421 Ga0501081_0036471
422 nmdc:mga00v17_7004_c1
423 nmdc:mga0yw44_92981_c1
424 nmdc:mga0yw44_9338_c1
425 nmdc:mga0k408_528_c1
426 nmdc:mga05p37_106221_c1
427 nmdc:mga05p37_168139_c1
428 nmdc:mga05p37_214307_c1
429 nmdc:mga06r32_54258_c1
430 nmdc:mga08y16_16826_c1
431 nmdc:mga08y16_2731_c1
432 nmdc:mga08y16_70703_c1
433 nmdc:mga0n895_10485_c1
434 nmdc:mga0rr50_70378_c1
435 nmdc:mga0a205_47792_c1
436 nmdc:mga0a205_51262_c1
437 Ga0495612_0032183
438 Ga0495619_0003430
439 Ga0495619_0012105
440 Ga0500645_007449
441 Ga0501084_0224927
442 Ga0590071_002396
443 Ga0590074_002552
444 Ga0530510_0001370

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03102

NeuB

NeuB family

55

294

0.97

PF08666

SAF

SAF domain

311

366

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wvo-assembly1.cif.gz_A solution structure of rsgi ruh-029, an antifreeze protein like domain in human n-acetylneuraminic acid phosphate synthase gene. 0.9168 297 359
6ncs-assembly1.cif.gz_B crystal structure of n-acetylneuraminic acid (sialic acid) synthetase from leptospira borgpetersenii serovar hardjo-bovis in complex with citrate 0.9136 10 295
4ur4-assembly1.cif.gz_A structure of the type iii fish antifreeze protein from zoarces viviparus zvafp13 0.9128 298 358
1ucs-assembly1.cif.gz_A type iii antifreeze protein rd1 from an antarctic eel pout 0.9079 299 357
4ipj-assembly1.cif.gz_A-2 crystal structure of r314k n-acetyl neuraminic acid synthase from neiserria meningitidis with malate bound 0.902 11 357
ID Description Score Start End Superfamily
af_Q99J77_9_276_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9877 17 282 3.20.20.70
af_Q99J77_9_276_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9768 17 282 3.20.20.70
af_Q58465_3_262_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9625 13 284 3.20.20.70
af_Q58465_3_262_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9553 13 284 3.20.20.70
af_Q9VG74_5_288_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9352 25 294 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A6L9ZCE6-F1-model_v4 N-acetylneuraminate synthase 0.9979 10 278 GO:0016051
GO:0047444
GO:0070085
AF-A0A382S4M5-F1-model_v4 N-acetylneuraminic acid synthase N-terminal domain-containing protein 0.9968 10 191 GO:0016051
GO:0047444
GO:0070085
AF-A0A3D1IHC8-F1-model_v4 N-acetylneuraminate synthase 0.9906 10 295 GO:0016051
GO:0047444
GO:0070085
AF-K2CQ37-F1-model_v4 N-acetylneuraminic acid synthase 0.9887 11 169 GO:0016051
GO:0047444
GO:0070085
AF-A0A2D7S2U7-F1-model_v4 N-acetylneuraminate synthase 0.9871 10 357 GO:0016051
GO:0047444
GO:0070085

Map