F334206

General Info

Members Datasets Scaffolds Average Seq Length
222 104 444 349

Family's Representative Sequence

Representative Sequence 3300005457|Ga0070662_100231851|Ga0070662_1002318511
Length 357
Sequence MTKMNVGVLGLSHDHVWGNLSALATGELGRVTAAAEPDPELRARLRGLHGGVEIHETFDALLERRDLDAVLIFSDNRTSAELGVRALDRHLPVMIEKPMAADLDGAETMLSAARQRGVPLMVNWPTVWRPALRYGLTLAVEGVVGDPIQVSHRGGHAGPREFGCSPQFSEWLYDPKRNGGGALVDYCGYGALLCRLVLGQPAAVMAVALPPRKPDLTAEDNAVVVLSYPRALGLLEASWTQIGGEPAFAMIVYGDRGTLLVHQPRMTQEGERVGPGRVQLITQGNNSRTLEPPPLPDDERDGPTYFLSRIRAGLEVTGPCAAGIGRDVQEVIAAALQASATGRRVRLPLGSDRSVSI

Samples

Sample ID Description Type Environment
1 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
8 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
44 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
59 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
61 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
62 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
63 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
64 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
65 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
66 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
67 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
68 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
69 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
70 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
71 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
72 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
73 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
74 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
75 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
76 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
83 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
84 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
85 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
86 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
87 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
88 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
89 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
90 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
91 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
92 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
93 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
94 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
95 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
96 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
97 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
98 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
99 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
100 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
101 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
102 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
103 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
104 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0.45
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.35
Rhizosphere 98.65
Stem 0
Stem Tuber 0
Unclassified 12.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070662_100231851 3300005457 Unclassified 1477
2 Ga0070690_100078495 3300005330 Bacteria 2157
3 Ga0070680_100063470 3300005336 Bacteria 3025
4 Ga0070691_10016090 3300005341 Bacteria 3438
5 Ga0070669_100096726 3300005353 Bacteria 2221
6 Ga0070675_100143321 3300005354 Bacteria 2044
7 Ga0070703_10008253 3300005406 Bacteria 2929
8 Ga0070701_10006905 3300005438 Bacteria 4808
9 Ga0070705_100044809 3300005440 Bacteria 2542
10 Ga0070694_100015690 3300005444 Bacteria 4762
11 Ga0070708_100095412 3300005445 Bacteria 2715
12 Ga0070708_100287228 3300005445 Unclassified 1548
13 Ga0070681_10127288 3300005458 Bacteria 2480
14 Ga0068867_100039333 3300005459 Bacteria 3448
15 Ga0070706_100083090 3300005467 Bacteria 2966
16 Ga0070707_100099494 3300005468 Bacteria 2817
17 Ga0070707_100107739 3300005468 Bacteria 2703
18 Ga0070698_100090034 3300005471 Bacteria 3052
19 Ga0070699_100154925 3300005518 Bacteria 2027
20 Ga0070686_100041717 3300005544 Bacteria 2870
21 Ga0070695_100141730 3300005545 Bacteria 1667
22 Ga0070696_100046864 3300005546 Bacteria 2998
23 Ga0070696_100149188 3300005546 Bacteria 1715
24 Ga0068859_100113098 3300005617 Bacteria 2778
25 Ga0068859_100224912 3300005617 Bacteria 1965
26 Ga0068864_100293057 3300005618 Bacteria 1521
27 Ga0068860_100035535 3300005843 Bacteria 4779
28 Ga0068862_100047599 3300005844 Bacteria 3660
29 Ga0068862_100129002 3300005844 Unclassified 2235
30 Ga0068862_100170516 3300005844 Unclassified 1948
31 Ga0081539_10000044 3300005985 Bacteria 284021
32 Ga0075432_10046675 3300006058 Bacteria 1521
33 Ga0075428_100000358 3300006844 Bacteria 45303
34 Ga0075428_100000687 3300006844 Bacteria 34838
35 Ga0075428_100003539 3300006844 Bacteria 17105
36 Ga0075428_100011311 3300006844 Bacteria 9929
37 Ga0075428_100049496 3300006844 Bacteria 4610
38 Ga0075428_100184490 3300006844 Bacteria 2258
39 Ga0075428_100520360 3300006844 Bacteria 1272
40 Ga0075430_100000055 3300006846 Bacteria 59692
41 Ga0075430_100000088 3300006846 Bacteria 52573
42 Ga0075430_100034511 3300006846 Bacteria 4293
43 Ga0075431_100000413 3300006847 Bacteria 34753
44 Ga0075431_100000635 3300006847 Bacteria 29710
45 Ga0075431_100001369 3300006847 Bacteria 22350
46 Ga0075431_100001608 3300006847 Bacteria 21079
47 Ga0075431_100002006 3300006847 Bacteria 19423
48 Ga0075431_100007402 3300006847 Bacteria 10931
49 Ga0075431_100055844 3300006847 Bacteria 4073
50 Ga0075431_100135675 3300006847 Bacteria 2537
51 Ga0075431_100257657 3300006847 Bacteria 1771
52 Ga0075431_100396253 3300006847 Unclassified 1382
53 Ga0075433_10002996 3300006852 Bacteria 12975
54 Ga0075433_10050537 3300006852 Bacteria 3620
55 Ga0075433_10079676 3300006852 Bacteria 2886
56 Ga0075433_10149356 3300006852 Bacteria 2078
57 Ga0075434_100038143 3300006871 Bacteria 4759
58 Ga0075434_100207627 3300006871 Bacteria 1979
59 Ga0075429_100001598 3300006880 Bacteria 18676
60 Ga0075429_100003182 3300006880 Bacteria 13956
61 Ga0075429_100016812 3300006880 Bacteria 6331
62 Ga0075429_100027523 3300006880 Bacteria 4935
63 Ga0075429_100088464 3300006880 Bacteria 2700
64 Ga0075429_100239884 3300006880 Unclassified 1588
65 Ga0075429_100253295 3300006880 Bacteria 1542
66 Ga0075436_100027502 3300006914 Bacteria 3913
67 Ga0097620_100113099 3300006931 Bacteria 2778
68 Ga0097620_100224911 3300006931 Bacteria 1965
69 Ga0075435_100065558 3300007076 Bacteria 2953
70 Ga0111539_10000724 3300009094 Bacteria 42942
71 Ga0111539_10040248 3300009094 Bacteria 5628
72 Ga0111539_10074724 3300009094 Bacteria 3993
73 Ga0114129_10000149 3300009147 Bacteria 73883
74 Ga0114129_10002055 3300009147 Bacteria 27645
75 Ga0114129_10003297 3300009147 Bacteria 22665
76 Ga0114129_10010031 3300009147 Bacteria 13502
77 Ga0114129_10084892 3300009147 Bacteria 4394
78 Ga0114129_10097352 3300009147 Bacteria 4073
79 Ga0105243_10171852 3300009148 Bacteria 1878
80 Ga0105248_10078658 3300009177 Bacteria 3707
81 Ga0105249_10064384 3300009553 Bacteria 3370
82 Ga0105249_10074819 3300009553 Bacteria 3136
83 Ga0105249_10199806 3300009553 Bacteria 1956
84 Ga0157378_10046116 3300013297 Bacteria 3875
85 Ga0163162_10103581 3300013306 Bacteria 2940
86 Ga0163161_10210514 3300017792 Bacteria 1502
87 Ga0224712_10052014 3300022467 Bacteria 1598
88 Ga0207653_10011100 3300025885 Bacteria 2813
89 Ga0207645_10105453 3300025907 Unclassified 1821
90 Ga0207684_10020078 3300025910 Bacteria 5708
91 Ga0207684_10158816 3300025910 Bacteria 1946
92 Ga0207707_10087073 3300025912 Bacteria 2729
93 Ga0207660_10060016 3300025917 Bacteria 2732
94 Ga0207646_10028379 3300025922 Bacteria 5095
95 Ga0207646_10225174 3300025922 Bacteria 1694
96 Ga0207681_10241033 3300025923 Bacteria 1407
97 Ga0207706_10187612 3300025933 Bacteria 1815
98 Ga0207689_10219064 3300025942 Bacteria 1572
99 Ga0207712_10160194 3300025961 Unclassified 1748
100 Ga0207712_10204463 3300025961 Unclassified 1568
101 Ga0207712_10225821 3300025961 Bacteria 1500
102 Ga0207708_10048108 3300026075 Bacteria 3246
103 Ga0207648_10020288 3300026089 Bacteria 5988
104 Ga0207648_10179507 3300026089 Bacteria 1874
105 Ga0207674_10020143 3300026116 Bacteria 7214
106 Ga0207428_10000367 3300027907 Bacteria 57765
107 Ga0268265_10069890 3300028380 Bacteria 2728
108 Ga0268265_10144593 3300028380 Bacteria 1996
109 Ga0268265_10298013 3300028380 Bacteria 1450
110 Ga0307408_100008626 3300031548 Bacteria 6731
111 Ga0307416_100009620 3300032002 Bacteria 6339
112 Ga0307416_100141452 3300032002 Bacteria 2188
113 Ga0307416_100216242 3300032002 Bacteria 1833
114 Ga0373948_0019715 3300034817 Bacteria 1278
115 Ga0373932_0059390 3300035112 Unclassified 1158
116 Ga0373941_0053327 3300035115 Unclassified 1292
117 Ga0373931_0003021 3300035691 Bacteria 7514
118 Ga0395899_0124613 3300037312 Unclassified 1843
119 Ga0395900_0012393 3300037418 Bacteria 8720
120 Ga0395905_0242077 3300037471 Unclassified 1686
121 Ga0395901_0003530 3300038443 Bacteria 15756
122 Ga0395901_0570169 3300038443 Unclassified 1145
123 Ga0451577_0005607 3300042876 Bacteria 12766
124 Ga0451577_0263045 3300042876 Unclassified 1562
125 Ga0453684_0008076 3300044712 Bacteria 19024
126 Ga0451576_0012177 3300045051 Bacteria 9694
127 Ga0495669_0022731 3300046684 Bacteria 2725
128 Ga0495669_0082611 3300046684 Bacteria 1476
129 Ga0496102_0006111 3300048905 Bacteria 10263
130 Ga0496102_0166740 3300048905 Unclassified 2073
131 Ga0496115_0003268 3300048918 Bacteria 11628
132 Ga0501038_0012089 3300049574 Bacteria 7883
133 Ga0501040_0217271 3300049576 Bacteria 1360
134 Ga0501041_0217412 3300049577 Unclassified 1199
135 Ga0501042_0097653 3300049578 Unclassified 2111
136 Ga0501046_0036167 3300049580 Bacteria 3976
137 Ga0501046_0130972 3300049580 Bacteria 1903
138 Ga0501046_0310859 3300049580 Unclassified 1149
139 Ga0501048_0018209 3300049582 Bacteria 5168
140 Ga0501048_0089912 3300049582 Bacteria 2166
141 Ga0501048_0101496 3300049582 Unclassified 2030
142 Ga0501067_0008491 3300049583 Bacteria 5694
143 Ga0501069_0020856 3300049585 Bacteria 3553
144 Ga0501071_0015592 3300049587 Bacteria 5218
145 Ga0501072_0071597 3300049588 Unclassified 2739
146 Ga0501072_0097313 3300049588 Bacteria 2339
147 Ga0501074_0189187 3300049590 Unclassified 1468
148 Ga0501075_0000206 3300049591 Bacteria 31439
149 Ga0501075_0027581 3300049591 Bacteria 4186
150 Ga0501075_0027671 3300049591 Bacteria 4180
151 Ga0501075_0064736 3300049591 Bacteria 2757
152 Ga0501075_0201787 3300049591 Unclassified 1517
153 Ga0501075_0220861 3300049591 Unclassified 1445
154 Ga0501076_0000221 3300049592 Bacteria 34467
155 Ga0501076_0006546 3300049592 Bacteria 8453
156 Ga0501076_0056116 3300049592 Bacteria 3125
157 Ga0501076_0095431 3300049592 Bacteria 2395
158 Ga0501077_0002006 3300049593 Bacteria 12292
159 Ga0501077_0002088 3300049593 Bacteria 12047
160 Ga0501077_0050583 3300049593 Bacteria 2641
161 Ga0501077_0060397 3300049593 Bacteria 2406
162 Ga0501079_0003818 3300049741 Bacteria 11132
163 Ga0501079_0058990 3300049741 Bacteria 2961
164 Ga0501079_0076498 3300049741 Unclassified 2589
165 Ga0501079_0172165 3300049741 Unclassified 1688
166 Ga0501081_0005250 3300049743 Bacteria 8348
167 Ga0501081_0038094 3300049743 Bacteria 3283
168 Ga0501081_0043595 3300049743 Bacteria 3078
169 Ga0501081_0097540 3300049743 Bacteria 2074
170 Ga0501081_0115403 3300049743 Bacteria 1909
171 Ga0501081_0157973 3300049743 Bacteria 1632
172 Ga0501045_0028893 3300049824 Unclassified 4003
173 Ga0501045_0106064 3300049824 Bacteria 2082
174 nmdc:mga05p37_121980_c1 3300050507 Bacteria 3201
175 nmdc:mga05p37_1308_c1 3300050507 Bacteria 28963
176 nmdc:mga05p37_14110_c1 3300050507 Bacteria 9589
177 nmdc:mga05p37_1960_c1 3300050507 Bacteria 24001
178 nmdc:mga05p37_2078_c1 3300050507 Bacteria 23367
179 nmdc:mga05p37_25039_c1 3300050507 Bacteria 7255
180 nmdc:mga05p37_36639_c1 3300050507 Bacteria 6016
181 nmdc:mga05p37_395119_c1 3300050507 Unclassified 1616
182 nmdc:mga05p37_497133_c1 3300050507 Bacteria 1401
183 nmdc:mga05p37_572063_c1 3300050507 Bacteria 1282
184 nmdc:mga09592_124434_c1 3300050508 Bacteria 2216
185 nmdc:mga09592_12865_c1 3300050508 Bacteria 6822
186 nmdc:mga09592_15963_c1 3300050508 Bacteria 6136
187 nmdc:mga09592_3499_c1 3300050508 Bacteria 12676
188 nmdc:mga09592_81_c1 3300050508 Bacteria 55948
189 nmdc:mga09592_828_c1 3300050508 Bacteria 23962
190 nmdc:mga0qj67_1136_c1 3300050509 Bacteria 18432
191 nmdc:mga0qj67_3381_c1 3300050509 Bacteria 11504
192 nmdc:mga0qj67_65883_c1 3300050509 Bacteria 2884
193 nmdc:mga06r32_1035_c1 3300050510 Bacteria 25088
194 nmdc:mga06r32_16577_c1 3300050510 Bacteria 6717
195 nmdc:mga06r32_211129_c1 3300050510 Bacteria 1929
196 nmdc:mga06r32_247165_c1 3300050510 Bacteria 1771
197 nmdc:mga06r32_249237_c1 3300050510 Bacteria 1763
198 nmdc:mga06r32_390416_c1 3300050510 Bacteria 1374
199 nmdc:mga06r32_48411_c1 3300050510 Bacteria 4063
200 nmdc:mga06r32_6120_c1 3300050510 Bacteria 10806
201 nmdc:mga06r32_826_c1 3300050510 Bacteria 27445
202 nmdc:mga08y16_182118_c1 3300050511 Bacteria 2181
203 nmdc:mga08y16_6845_c1 3300050511 Bacteria 11951
204 nmdc:mga0n895_10609_c1 3300050512 Bacteria 8155
205 nmdc:mga0n895_51271_c1 3300050512 Bacteria 4048
206 nmdc:mga0n895_62199_c1 3300050512 Bacteria 3689
207 nmdc:mga0rr50_120773_c1 3300050513 Bacteria 2085
208 nmdc:mga08x19_8896_c1 3300050514 Bacteria 5991
209 nmdc:mga0a205_10939_c1 3300050515 Bacteria 8348
210 nmdc:mga0a205_14427_c1 3300050515 Bacteria 7369
211 nmdc:mga0a205_202751_c1 3300050515 Bacteria 1874
212 nmdc:mga0a205_24858_c1 3300050515 Bacteria 5700
213 Ga0501084_0005538 3300054114 Bacteria 10365
214 Ga0501084_0093382 3300054114 Bacteria 2526
215 Ga0501082_0002253 3300060353 Bacteria 16888
216 Ga0501082_0024184 3300060353 Bacteria 5239
217 Ga0501082_0033517 3300060353 Bacteria 4432
218 Ga0501082_0109674 3300060353 Bacteria 2389
219 Ga0501082_0136251 3300060353 Bacteria 2130
220 Ga0530510_0001530 3300061734 Bacteria 15586
221 Ga0530510_0040892 3300061734 Bacteria 3347
222 Ga0530510_0085767 3300061734 Bacteria 2294
223 Ga0070662_100231851
224 Ga0070690_100078495
225 Ga0070680_100063470
226 Ga0070691_10016090
227 Ga0070669_100096726
228 Ga0070675_100143321
229 Ga0070703_10008253
230 Ga0070701_10006905
231 Ga0070705_100044809
232 Ga0070694_100015690
233 Ga0070708_100095412
234 Ga0070708_100287228
235 Ga0070681_10127288
236 Ga0068867_100039333
237 Ga0070706_100083090
238 Ga0070707_100099494
239 Ga0070707_100107739
240 Ga0070698_100090034
241 Ga0070699_100154925
242 Ga0070686_100041717
243 Ga0070695_100141730
244 Ga0070696_100046864
245 Ga0070696_100149188
246 Ga0068859_100113098
247 Ga0068859_100224912
248 Ga0068864_100293057
249 Ga0068860_100035535
250 Ga0068862_100047599
251 Ga0068862_100129002
252 Ga0068862_100170516
253 Ga0081539_10000044
254 Ga0075432_10046675
255 Ga0075428_100000358
256 Ga0075428_100000687
257 Ga0075428_100003539
258 Ga0075428_100011311
259 Ga0075428_100049496
260 Ga0075428_100184490
261 Ga0075428_100520360
262 Ga0075430_100000055
263 Ga0075430_100000088
264 Ga0075430_100034511
265 Ga0075431_100000413
266 Ga0075431_100000635
267 Ga0075431_100001369
268 Ga0075431_100001608
269 Ga0075431_100002006
270 Ga0075431_100007402
271 Ga0075431_100055844
272 Ga0075431_100135675
273 Ga0075431_100257657
274 Ga0075431_100396253
275 Ga0075433_10002996
276 Ga0075433_10050537
277 Ga0075433_10079676
278 Ga0075433_10149356
279 Ga0075434_100038143
280 Ga0075434_100207627
281 Ga0075429_100001598
282 Ga0075429_100003182
283 Ga0075429_100016812
284 Ga0075429_100027523
285 Ga0075429_100088464
286 Ga0075429_100239884
287 Ga0075429_100253295
288 Ga0075436_100027502
289 Ga0097620_100113099
290 Ga0097620_100224911
291 Ga0075435_100065558
292 Ga0111539_10000724
293 Ga0111539_10040248
294 Ga0111539_10074724
295 Ga0114129_10000149
296 Ga0114129_10002055
297 Ga0114129_10003297
298 Ga0114129_10010031
299 Ga0114129_10084892
300 Ga0114129_10097352
301 Ga0105243_10171852
302 Ga0105248_10078658
303 Ga0105249_10064384
304 Ga0105249_10074819
305 Ga0105249_10199806
306 Ga0157378_10046116
307 Ga0163162_10103581
308 Ga0163161_10210514
309 Ga0224712_10052014
310 Ga0207653_10011100
311 Ga0207645_10105453
312 Ga0207684_10020078
313 Ga0207684_10158816
314 Ga0207707_10087073
315 Ga0207660_10060016
316 Ga0207646_10028379
317 Ga0207646_10225174
318 Ga0207681_10241033
319 Ga0207706_10187612
320 Ga0207689_10219064
321 Ga0207712_10160194
322 Ga0207712_10204463
323 Ga0207712_10225821
324 Ga0207708_10048108
325 Ga0207648_10020288
326 Ga0207648_10179507
327 Ga0207674_10020143
328 Ga0207428_10000367
329 Ga0268265_10069890
330 Ga0268265_10144593
331 Ga0268265_10298013
332 Ga0307408_100008626
333 Ga0307416_100009620
334 Ga0307416_100141452
335 Ga0307416_100216242
336 Ga0373948_0019715
337 Ga0373932_0059390
338 Ga0373941_0053327
339 Ga0373931_0003021
340 Ga0395899_0124613
341 Ga0395900_0012393
342 Ga0395905_0242077
343 Ga0395901_0003530
344 Ga0395901_0570169
345 Ga0451577_0005607
346 Ga0451577_0263045
347 Ga0453684_0008076
348 Ga0451576_0012177
349 Ga0495669_0022731
350 Ga0495669_0082611
351 Ga0496102_0006111
352 Ga0496102_0166740
353 Ga0496115_0003268
354 Ga0501038_0012089
355 Ga0501040_0217271
356 Ga0501041_0217412
357 Ga0501042_0097653
358 Ga0501046_0036167
359 Ga0501046_0130972
360 Ga0501046_0310859
361 Ga0501048_0018209
362 Ga0501048_0089912
363 Ga0501048_0101496
364 Ga0501067_0008491
365 Ga0501069_0020856
366 Ga0501071_0015592
367 Ga0501072_0071597
368 Ga0501072_0097313
369 Ga0501074_0189187
370 Ga0501075_0000206
371 Ga0501075_0027581
372 Ga0501075_0027671
373 Ga0501075_0064736
374 Ga0501075_0201787
375 Ga0501075_0220861
376 Ga0501076_0000221
377 Ga0501076_0006546
378 Ga0501076_0056116
379 Ga0501076_0095431
380 Ga0501077_0002006
381 Ga0501077_0002088
382 Ga0501077_0050583
383 Ga0501077_0060397
384 Ga0501079_0003818
385 Ga0501079_0058990
386 Ga0501079_0076498
387 Ga0501079_0172165
388 Ga0501081_0005250
389 Ga0501081_0038094
390 Ga0501081_0043595
391 Ga0501081_0097540
392 Ga0501081_0115403
393 Ga0501081_0157973
394 Ga0501045_0028893
395 Ga0501045_0106064
396 nmdc:mga05p37_121980_c1
397 nmdc:mga05p37_1308_c1
398 nmdc:mga05p37_14110_c1
399 nmdc:mga05p37_1960_c1
400 nmdc:mga05p37_2078_c1
401 nmdc:mga05p37_25039_c1
402 nmdc:mga05p37_36639_c1
403 nmdc:mga05p37_395119_c1
404 nmdc:mga05p37_497133_c1
405 nmdc:mga05p37_572063_c1
406 nmdc:mga09592_124434_c1
407 nmdc:mga09592_12865_c1
408 nmdc:mga09592_15963_c1
409 nmdc:mga09592_3499_c1
410 nmdc:mga09592_81_c1
411 nmdc:mga09592_828_c1
412 nmdc:mga0qj67_1136_c1
413 nmdc:mga0qj67_3381_c1
414 nmdc:mga0qj67_65883_c1
415 nmdc:mga06r32_1035_c1
416 nmdc:mga06r32_16577_c1
417 nmdc:mga06r32_211129_c1
418 nmdc:mga06r32_247165_c1
419 nmdc:mga06r32_249237_c1
420 nmdc:mga06r32_390416_c1
421 nmdc:mga06r32_48411_c1
422 nmdc:mga06r32_6120_c1
423 nmdc:mga06r32_826_c1
424 nmdc:mga08y16_182118_c1
425 nmdc:mga08y16_6845_c1
426 nmdc:mga0n895_10609_c1
427 nmdc:mga0n895_51271_c1
428 nmdc:mga0n895_62199_c1
429 nmdc:mga0rr50_120773_c1
430 nmdc:mga08x19_8896_c1
431 nmdc:mga0a205_10939_c1
432 nmdc:mga0a205_14427_c1
433 nmdc:mga0a205_202751_c1
434 nmdc:mga0a205_24858_c1
435 Ga0501084_0005538
436 Ga0501084_0093382
437 Ga0501082_0002253
438 Ga0501082_0024184
439 Ga0501082_0033517
440 Ga0501082_0109674
441 Ga0501082_0136251
442 Ga0530510_0001530
443 Ga0530510_0040892
444 Ga0530510_0085767

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22725

GFO_IDH_MocA_C3

GFO/IDH/MocA C-terminal domain

137

260

0.95

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

4

124

0.81

PF02894

GFO_IDH_MocA_C

Oxidoreductase family, C-terminal alpha/beta domain

139

347

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
2glx-assembly1.cif.gz_A crystal structure analysis of bacterial 1,5-af reductase 0.8749 6 348
2glx-assembly1.cif.gz_A crystal structure analysis of bacterial 1,5-af reductase 0.8627 6 348
4koa-assembly1.cif.gz_A-2 crystal structure analysis of 1,5-anhydro-d-fructose reductase from sinorhizobium meliloti 0.862 5 348
3q2k-assembly2.cif.gz_P crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca 0.8591 3 350
4had-assembly1.cif.gz_C crystal structure of probable oxidoreductase protein from rhizobium etli cfn 42 0.8581 3 347
ID Description Score Start End Superfamily
3ezyC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9416 5 123 3.40.50.720
3ezyC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9264 5 123 3.40.50.720
af_P39353_1_125_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9215 5 123 3.40.50.720
3e82A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9189 5 123 3.40.50.720
4hktB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.915 5 123 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A535DBZ8-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9429 5 143 GO:0000166
GO:0003824
AF-A0A3L7WP20-F1-model_v4 Inositol 2-dehydrogenase 0.9343 1 146 GO:0000166
AF-A0A836SQT7-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9301 2 143 GO:0000166
AF-A0A6M0Q8N4-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9295 21 146 GO:0000166
AF-A0A3L7WP20-F1-model_v4 Inositol 2-dehydrogenase 0.9283 1 146 GO:0000166

Map