F334078

General Info

Members Datasets Scaffolds Average Seq Length
222 139 222 206

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10069407|Ga0070658_100694072
Length 229
Sequence VSRSAAPRARRSALRTPPGSPLPRAFYDRDTSIVARELLGAVLQCTTPDGVASARIVETEAYVGPDDPACHAAAGLTSRTKYLFGPPGIAYVYLIYGMYWCFNAVTREEGHGSAVLVRAVSPLDGEPLMQRRRPNARSRHDLTNGPGKLCLALGITGDHNGLPLDAPPIRILAGDAVPDRDVVVTPRIGITRAAEWPLRYFIAGDPFVSRTPRSFPRTGWPPALREVDP

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
49 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013874 Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
82 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
83 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
84 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
85 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
86 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
87 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
88 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
89 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
90 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
91 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
92 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
93 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
94 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
95 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
96 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
97 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
98 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
99 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
100 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
101 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
102 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
103 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
104 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
105 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
106 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
107 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
108 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
109 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
110 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
111 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
112 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
113 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
117 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
118 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
119 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
120 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
121 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
122 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
123 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
124 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
125 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
126 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
127 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
128 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
129 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
130 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
131 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
132 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
133 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
134 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
135 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
136 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
137 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
138 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
139 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.46
Rhizosphere 90.54
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10069407 3300005327 Bacteria 2883
2 Ga0070658_10335298 3300005327 Bacteria 1293
3 Ga0070683_100082626 3300005329 Bacteria 3008
4 Ga0070670_100114507 3300005331 Bacteria 2325
5 Ga0070680_100145914 3300005336 Unclassified 1985
6 Ga0068868_100746562 3300005338 Bacteria 879
7 Ga0070660_100063595 3300005339 Unclassified 2869
8 Ga0070660_100191894 3300005339 Bacteria 1655
9 Ga0070661_100016393 3300005344 Bacteria 5237
10 Ga0070668_100007138 3300005347 Bacteria 8280
11 Ga0070669_100037054 3300005353 Bacteria 3537
12 Ga0070671_100586609 3300005355 Bacteria 963
13 Ga0070674_100237261 3300005356 Bacteria 1426
14 Ga0070659_100016213 3300005366 Bacteria 5592
15 Ga0070659_100042596 3300005366 Bacteria 3550
16 Ga0070709_10177862 3300005434 Bacteria 1492
17 Ga0070711_100296174 3300005439 Bacteria 1285
18 Ga0070705_100005620 3300005440 Bacteria 6120
19 Ga0070708_100026739 3300005445 Bacteria 4943
20 Ga0070708_100059786 3300005445 Bacteria 3399
21 Ga0070708_100447532 3300005445 Bacteria 1218
22 Ga0070662_100009796 3300005457 Bacteria 6275
23 Ga0070681_10000554 3300005458 Bacteria 30814
24 Ga0070681_10049207 3300005458 Unclassified 4210
25 Ga0070706_100065885 3300005467 Bacteria 3350
26 Ga0070706_100086033 3300005467 Bacteria 2913
27 Ga0070706_100261027 3300005467 Bacteria 1617
28 Ga0070707_100063310 3300005468 Bacteria 3550
29 Ga0070707_100085176 3300005468 Bacteria 3055
30 Ga0070707_100170574 3300005468 Bacteria 2120
31 Ga0070698_100000181 3300005471 Bacteria 59362
32 Ga0070698_100001501 3300005471 Bacteria 25921
33 Ga0070699_100001406 3300005518 Bacteria 22131
34 Ga0070699_100010879 3300005518 Bacteria 7870
35 Ga0070699_100018398 3300005518 Bacteria 6002
36 Ga0070699_100239550 3300005518 Bacteria 1619
37 Ga0070679_100059063 3300005530 Bacteria 3823
38 Ga0070679_100106110 3300005530 Unclassified 2795
39 Ga0070697_100077762 3300005536 Bacteria 2730
40 Ga0070697_100198961 3300005536 Bacteria 1703
41 Ga0070672_100140158 3300005543 Bacteria 1994
42 Ga0070696_100286516 3300005546 Unclassified 1257
43 Ga0070693_100221712 3300005547 Bacteria 1239
44 Ga0070665_100011876 3300005548 Bacteria 8796
45 Ga0070664_100007931 3300005564 Bacteria 8577
46 Ga0070664_100206534 3300005564 Unclassified 1754
47 Ga0068857_100005823 3300005577 Bacteria 10526
48 Ga0068857_100159554 3300005577 Unclassified 2046
49 Ga0070702_100216903 3300005615 Unclassified 1277
50 Ga0068852_100653205 3300005616 Unclassified 1059
51 Ga0068859_100108459 3300005617 Bacteria 2838
52 Ga0068864_100072652 3300005618 Bacteria 2999
53 Ga0068862_100000266 3300005844 Bacteria 58197
54 Ga0081539_10028306 3300005985 Bacteria 3526
55 Ga0070715_10063681 3300006163 Bacteria 1626
56 Ga0070715_10130701 3300006163 Bacteria 1208
57 Ga0070712_100147006 3300006175 Unclassified 1805
58 Ga0070712_100755942 3300006175 Bacteria 832
59 Ga0075430_100035377 3300006846 Bacteria 4237
60 Ga0075431_100202076 3300006847 Unclassified 2033
61 Ga0075431_100482688 3300006847 Bacteria 1232
62 Ga0075431_100823542 3300006847 Bacteria 901
63 Ga0075433_10088061 3300006852 Bacteria 2743
64 Ga0075429_100063008 3300006880 Bacteria 3231
65 Ga0075429_100130421 3300006880 Bacteria 2199
66 Ga0075429_100169794 3300006880 Bacteria 1911
67 Ga0075436_100167613 3300006914 Bacteria 1550
68 Ga0097620_100108459 3300006931 Bacteria 2838
69 Ga0111539_10016514 3300009094 Bacteria 9153
70 Ga0111539_10118252 3300009094 Unclassified 3106
71 Ga0114129_10400094 3300009147 Bacteria 1810
72 Ga0114129_10435089 3300009147 Unclassified 1723
73 Ga0105249_10000199 3300009553 Bacteria 68792
74 Ga0105033_100032 3300009986 Bacteria 10397
75 Ga0105030_101758 3300009987 Bacteria 1912
76 Ga0105246_10427440 3300011119 Unclassified 1107
77 Ga0157369_10202907 3300013105 Bacteria 2081
78 Ga0157514_117533 3300013874 Bacteria 1365
79 Ga0163163_10485116 3300014325 Bacteria 1297
80 Ga0157380_10026663 3300014326 Bacteria 4389
81 Ga0157380_10120821 3300014326 Bacteria 2219
82 Ga0157377_10103186 3300014745 Bacteria 1703
83 Ga0207653_10023863 3300025885 Bacteria 1950
84 Ga0207685_10106003 3300025905 Bacteria 1210
85 Ga0207705_10550899 3300025909 Bacteria 896
86 Ga0207684_10080880 3300025910 Bacteria 2764
87 Ga0207684_10381347 3300025910 Bacteria 1212
88 Ga0207707_10001099 3300025912 Bacteria 25790
89 Ga0207707_10035560 3300025912 Unclassified 4355
90 Ga0207660_10051102 3300025917 Unclassified 2938
91 Ga0207649_10006664 3300025920 Bacteria 6276
92 Ga0207652_10047046 3300025921 Bacteria 3684
93 Ga0207652_10598321 3300025921 Unclassified 989
94 Ga0207646_10015713 3300025922 Bacteria 7134
95 Ga0207646_10138384 3300025922 Bacteria 2193
96 Ga0207646_10184102 3300025922 Bacteria 1886
97 Ga0207646_10310251 3300025922 Bacteria 1425
98 Ga0207646_10897063 3300025922 Unclassified 786
99 Ga0207681_10006983 3300025923 Bacteria 6928
100 Ga0207690_10007617 3300025932 Bacteria 6423
101 Ga0207690_10028924 3300025932 Bacteria 3518
102 Ga0207669_10349130 3300025937 Bacteria 1142
103 Ga0207691_10228790 3300025940 Bacteria 1611
104 Ga0207711_10706616 3300025941 Bacteria 940
105 Ga0207661_10578357 3300025944 Unclassified 1030
106 Ga0207679_10012573 3300025945 Bacteria 5522
107 Ga0207679_10493290 3300025945 Bacteria 1092
108 Ga0207712_10003880 3300025961 Bacteria 9448
109 Ga0207678_10154317 3300026067 Bacteria 1961
110 Ga0207648_10528470 3300026089 Bacteria 1081
111 Ga0207676_10084165 3300026095 Bacteria 2592
112 Ga0207676_10358244 3300026095 Bacteria 1351
113 Ga0207676_10563997 3300026095 Bacteria 1089
114 Ga0207674_10000388 3300026116 Bacteria 57168
115 Ga0207674_10154549 3300026116 Unclassified 2250
116 Ga0207698_10620578 3300026142 Unclassified 1068
117 Ga0209966_1056487 3300027695 Bacteria 842
118 Ga0268266_10008533 3300028379 Bacteria 9105
119 Ga0268265_10002510 3300028380 Bacteria 13745
120 Ga0307405_10080383 3300031731 Bacteria 2128
121 Ga0307413_10185363 3300031824 Unclassified 1488
122 Ga0307413_10197287 3300031824 Bacteria 1450
123 Ga0307410_10062756 3300031852 Unclassified 2547
124 Ga0307410_10131517 3300031852 Bacteria 1839
125 Ga0307410_10133043 3300031852 Bacteria 1829
126 Ga0307410_10158460 3300031852 Bacteria 1693
127 Ga0307410_10371902 3300031852 Bacteria 1148
128 Ga0307406_10019852 3300031901 Bacteria 3948
129 Ga0307406_10308879 3300031901 Bacteria 1218
130 Ga0307407_10020792 3300031903 Unclassified 3370
131 Ga0307407_10044542 3300031903 Bacteria 2501
132 Ga0307407_10118456 3300031903 Bacteria 1674
133 Ga0307412_10013570 3300031911 Bacteria 4781
134 Ga0307412_10110775 3300031911 Bacteria 1960
135 Ga0307409_100037754 3300031995 Unclassified 3564
136 Ga0307409_100075188 3300031995 Bacteria 2703
137 Ga0307409_100220778 3300031995 Bacteria 1711
138 Ga0307416_100006664 3300032002 Bacteria 7246
139 Ga0307416_100007989 3300032002 Archaea 6775
140 Ga0307416_100024779 3300032002 Bacteria 4386
141 Ga0307416_100033041 3300032002 Bacteria 3917
142 Ga0307416_100131554 3300032002 Bacteria 2253
143 Ga0307414_10032524 3300032004 Bacteria 3436
144 Ga0307414_10042583 3300032004 Bacteria 3086
145 Ga0307414_10048721 3300032004 Unclassified 2925
146 Ga0307414_10113489 3300032004 Bacteria 2068
147 Ga0307414_10334915 3300032004 Unclassified 1293
148 Ga0307414_10515896 3300032004 Bacteria 1060
149 Ga0307411_10022352 3300032005 Bacteria 3722
150 Ga0307411_10036104 3300032005 Bacteria 3093
151 Ga0307411_10057451 3300032005 Bacteria 2570
152 Ga0307411_10058007 3300032005 Bacteria 2560
153 Ga0307415_100009292 3300032126 Bacteria 5499
154 Ga0307415_100023236 3300032126 Bacteria 3844
155 Ga0307415_100223306 3300032126 Bacteria 1512
156 Ga0307415_100276137 3300032126 Bacteria 1379
157 Ga0373928_0069925 3300035084 Bacteria 866
158 Ga0373932_0057256 3300035112 Bacteria 1175
159 Ga0373941_0098574 3300035115 Bacteria 1014
160 Ga0373941_0210630 3300035115 Bacteria 743
161 Ga0395905_0022959 3300037471 Bacteria 5896
162 Ga0395905_0277862 3300037471 Bacteria 1561
163 Ga0242420_021233 3300038996 Bacteria 1161
164 Ga0451577_0518997 3300042876 Bacteria 1082
165 Ga0466965_0281133 3300044683 Unclassified 899
166 Ga0466966_0009268 3300044684 Bacteria 6514
167 Ga0466959_0057325 3300045049 Bacteria 2840
168 Ga0496100_0177915 3300048903 Bacteria 1537
169 Ga0496101_0057696 3300048904 Bacteria 2809
170 Ga0496102_0881952 3300048905 Bacteria 816
171 Ga0496104_0025928 3300048907 Bacteria 5406
172 Ga0496104_1035847 3300048907 Bacteria 724
173 Ga0496108_0001506 3300048911 Bacteria 18435
174 Ga0496108_0007967 3300048911 Bacteria 8593
175 Ga0496108_0020601 3300048911 Bacteria 5419
176 Ga0496108_0441194 3300048911 Bacteria 1137
177 Ga0496109_0040172 3300048912 Bacteria 4236
178 Ga0496109_0228177 3300048912 Bacteria 1751
179 Ga0496110_0032844 3300048913 Unclassified 4486
180 Ga0496110_0103391 3300048913 Bacteria 2555
181 Ga0496111_0003464 3300048914 Bacteria 9763
182 Ga0496111_0229038 3300048914 Bacteria 1380
183 Ga0496111_0250185 3300048914 Bacteria 1315
184 Ga0496112_0013930 3300048915 Bacteria 7439
185 Ga0496112_0083855 3300048915 Bacteria 3152
186 Ga0496113_0008668 3300048916 Bacteria 6637
187 Ga0496113_0586888 3300048916 Bacteria 892
188 Ga0496115_0256087 3300048918 Bacteria 1440
189 Ga0501292_036260 3300049515 Unclassified 841
190 Ga0501036_0771260 3300049572 Bacteria 793
191 Ga0501039_0371816 3300049575 Unclassified 1123
192 Ga0501040_0019326 3300049576 Bacteria 4531
193 Ga0501067_0009191 3300049583 Bacteria 5473
194 Ga0501068_0107208 3300049584 Unclassified 1735
195 Ga0501069_0196590 3300049585 Unclassified 1168
196 Ga0501071_0697925 3300049587 Unclassified 781
197 Ga0501075_0322084 3300049591 Bacteria 1178
198 Ga0501076_0078805 3300049592 Bacteria 2644
199 Ga0501217_060765 3300049661 Unclassified 1009
200 Ga0501235_065997 3300049669 Bacteria 852
201 Ga0501259_065193 3300049688 Bacteria 770
202 Ga0501225_0025856 3300049705 Bacteria 1615
203 Ga0501079_0822861 3300049741 Unclassified 731
204 Ga0501080_0271635 3300049742 Unclassified 1543
205 Ga0501045_0159740 3300049824 Unclassified 1677
206 Ga0501045_0642185 3300049824 Bacteria 785
207 nmdc:mga09592_176372_c1 3300050508 Bacteria 1848
208 nmdc:mga09592_455639_c1 3300050508 Bacteria 1103
209 nmdc:mga0qj67_11694_c1 3300050509 Bacteria 6585
210 nmdc:mga0qj67_178537_c1 3300050509 Unclassified 1724
211 nmdc:mga0qj67_570148_c1 3300050509 Unclassified 907
212 nmdc:mga06r32_472698_c1 3300050510 Bacteria 1232
213 nmdc:mga06r32_768727_c1 3300050510 Bacteria 925
214 nmdc:mga08y16_9679_c1 3300050511 Bacteria 10118
215 nmdc:mga0n895_718100_c1 3300050512 Unclassified 994
216 nmdc:mga08x19_596084_c1 3300050514 Bacteria 783
217 nmdc:mga0a205_169238_c1 3300050515 Bacteria 2081
218 Ga0501084_0294357 3300054114 Bacteria 1371
219 Ga0590071_032365 3300059421 Bacteria 1248
220 Ga0501082_0338818 3300060353 Bacteria 1310
221 Ga0501082_0936001 3300060353 Unclassified 758
222 Ga0530510_0188001 3300061734 Unclassified 1533

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049741 Ga0501079_0822861 Ga0501079_0822861_118_660 179
2 3300060353 Ga0501082_0338818 Ga0501082_0338818_79_621 179
3 3300006846 Ga0075430_100035377 Ga0075430_1000353772 181
4 3300006847 Ga0075431_100823542 Ga0075431_1008235422 181
5 3300006880 Ga0075429_100063008 Ga0075429_1000630082 181
6 3300032004 Ga0307414_10048721 Ga0307414_100487211 183
7 3300006847 Ga0075431_100482688 Ga0075431_1004826882 186
8 3300006880 Ga0075429_100169794 Ga0075429_1001697942 186
9 3300049705 Ga0501225_0025856 Ga0501225_0025856_574_1161 186
10 3300050508 nmdc:mga09592_176372_c1 nmdc:mga09592_176372_c1_473_1042 186
11 3300050510 nmdc:mga06r32_472698_c1 nmdc:mga06r32_472698_c1_343_912 186
12 3300009986 Ga0105033_100032 Ga0105033_1000329 187
13 3300048907 Ga0496104_0025928 Ga0496104_0025928_3690_4259 187
14 3300048911 Ga0496108_0007967 Ga0496108_0007967_1214_1783 187
15 3300048913 Ga0496110_0032844 Ga0496110_0032844_1920_2489 187
16 3300048914 Ga0496111_0003464 Ga0496111_0003464_583_1152 187
17 3300044683 Ga0466965_0281133 Ga0466965_0281133_17_592 188
18 3300031852 Ga0307410_10371902 Ga0307410_103719022 189
19 3300005366 Ga0070659_100042596 Ga0070659_1000425962 191
20 3300013105 Ga0157369_10202907 Ga0157369_102029073 191
21 3300048911 Ga0496108_0020601 Ga0496108_0020601_1287_1901 194
22 3300048912 Ga0496109_0228177 Ga0496109_0228177_109_723 194
23 3300048913 Ga0496110_0103391 Ga0496110_0103391_335_949 194
24 3300048914 Ga0496111_0229038 Ga0496111_0229038_59_673 194
25 3300048915 Ga0496112_0083855 Ga0496112_0083855_1435_2049 194
26 3300048916 Ga0496113_0586888 Ga0496113_0586888_49_663 194
27 3300005518 Ga0070699_100018398 Ga0070699_1000183982 195
28 3300025922 Ga0207646_10897063 Ga0207646_108970631 197
29 3300005329 Ga0070683_100082626 Ga0070683_1000826262 198
30 3300005331 Ga0070670_100114507 Ga0070670_1001145072 198
31 3300005336 Ga0070680_100145914 Ga0070680_1001459142 198
32 3300005445 Ga0070708_100059786 Ga0070708_1000597863 198
33 3300005445 Ga0070708_100447532 Ga0070708_1004475321 198
34 3300005458 Ga0070681_10049207 Ga0070681_100492072 198
35 3300005467 Ga0070706_100086033 Ga0070706_1000860333 198
36 3300005467 Ga0070706_100261027 Ga0070706_1002610271 198
37 3300005468 Ga0070707_100063310 Ga0070707_1000633104 198
38 3300005468 Ga0070707_100085176 Ga0070707_1000851763 198
39 3300005471 Ga0070698_100001501 Ga0070698_10000150111 198
40 3300005518 Ga0070699_100001406 Ga0070699_1000014061 198
41 3300005530 Ga0070679_100106110 Ga0070679_1001061102 198
42 3300005546 Ga0070696_100286516 Ga0070696_1002865162 198
43 3300005564 Ga0070664_100206534 Ga0070664_1002065342 198
44 3300005577 Ga0068857_100159554 Ga0068857_1001595543 198
45 3300006175 Ga0070712_100755942 Ga0070712_1007559422 198
46 3300009094 Ga0111539_10118252 Ga0111539_101182522 198
47 3300009987 Ga0105030_101758 Ga0105030_1017582 198
48 3300013874 Ga0157514_117533 Ga0157514_1175332 198
49 3300025910 Ga0207684_10381347 Ga0207684_103813471 198
50 3300025912 Ga0207707_10035560 Ga0207707_100355602 198
51 3300025917 Ga0207660_10051102 Ga0207660_100511021 198
52 3300025921 Ga0207652_10598321 Ga0207652_105983212 198
53 3300025922 Ga0207646_10184102 Ga0207646_101841021 198
54 3300025922 Ga0207646_10310251 Ga0207646_103102512 198
55 3300025944 Ga0207661_10578357 Ga0207661_105783572 198
56 3300026067 Ga0207678_10154317 Ga0207678_101543172 198
57 3300026116 Ga0207674_10154549 Ga0207674_101545492 198
58 3300037471 Ga0395905_0277862 Ga0395905_0277862_526_1125 198
59 3300048911 Ga0496108_0441194 Ga0496108_0441194_347_949 198
60 3300049584 Ga0501068_0107208 Ga0501068_0107208_1002_1601 198
61 3300049585 Ga0501069_0196590 Ga0501069_0196590_50_649 198
62 3300005468 Ga0070707_100170574 Ga0070707_1001705742 199
63 3300014745 Ga0157377_10103186 Ga0157377_101031862 199
64 3300025922 Ga0207646_10138384 Ga0207646_101383842 199
65 3300025941 Ga0207711_10706616 Ga0207711_107066161 199
66 3300026095 Ga0207676_10563997 Ga0207676_105639972 199
67 3300027695 Ga0209966_1056487 Ga0209966_10564871 199
68 3300032004 Ga0307414_10032524 Ga0307414_100325242 199
69 3300032005 Ga0307411_10058007 Ga0307411_100580072 199
70 3300035115 Ga0373941_0098574 Ga0373941_0098574_40_651 199
71 3300006880 Ga0075429_100130421 Ga0075429_1001304212 200
72 3300026089 Ga0207648_10528470 Ga0207648_105284701 200
73 3300031852 Ga0307410_10131517 Ga0307410_101315171 200
74 3300032004 Ga0307414_10334915 Ga0307414_103349151 200
75 3300005434 Ga0070709_10177862 Ga0070709_101778622 201
76 3300005471 Ga0070698_100000181 Ga0070698_10000018144 201
77 3300005536 Ga0070697_100198961 Ga0070697_1001989612 201
78 3300006914 Ga0075436_100167613 Ga0075436_1001676132 201
79 3300009147 Ga0114129_10435089 Ga0114129_104350892 201
80 3300031901 Ga0307406_10308879 Ga0307406_103088791 201
81 3300032004 Ga0307414_10515896 Ga0307414_105158962 201
82 3300032126 Ga0307415_100223306 Ga0307415_1002233062 201
83 3300037471 Ga0395905_0022959 Ga0395905_0022959_1302_1913 201
84 3300049583 Ga0501067_0009191 Ga0501067_0009191_28_639 201
85 3300049688 Ga0501259_065193 Ga0501259_065193_136_747 201
86 3300050509 nmdc:mga0qj67_570148_c1 nmdc:mga0qj67_570148_c1_61_681 201
87 3300050514 nmdc:mga08x19_596084_c1 nmdc:mga08x19_596084_c1_55_666 201
88 3300005439 Ga0070711_100296174 Ga0070711_1002961742 202
89 3300005547 Ga0070693_100221712 Ga0070693_1002217122 202
90 3300006163 Ga0070715_10130701 Ga0070715_101307012 202
91 3300006175 Ga0070712_100147006 Ga0070712_1001470061 202
92 3300048903 Ga0496100_0177915 Ga0496100_0177915_17_631 202
93 3300048904 Ga0496101_0057696 Ga0496101_0057696_22_636 202
94 3300048916 Ga0496113_0008668 Ga0496113_0008668_3938_4552 202
95 3300048918 Ga0496115_0256087 Ga0496115_0256087_38_652 202
96 3300006847 Ga0075431_100202076 Ga0075431_1002020762 203
97 3300031731 Ga0307405_10080383 Ga0307405_100803831 203
98 3300031824 Ga0307413_10185363 Ga0307413_101853632 203
99 3300031852 Ga0307410_10062756 Ga0307410_100627562 203
100 3300031852 Ga0307410_10133043 Ga0307410_101330431 203
101 3300031903 Ga0307407_10118456 Ga0307407_101184561 203
102 3300031911 Ga0307412_10013570 Ga0307412_100135702 203
103 3300031995 Ga0307409_100037754 Ga0307409_1000377543 203
104 3300032002 Ga0307416_100006664 Ga0307416_1000066642 203
105 3300032002 Ga0307416_100131554 Ga0307416_1001315542 203
106 3300032005 Ga0307411_10022352 Ga0307411_100223523 203
107 3300032005 Ga0307411_10057451 Ga0307411_100574512 203
108 3300032126 Ga0307415_100009292 Ga0307415_1000092921 203
109 3300032126 Ga0307415_100023236 Ga0307415_1000232362 203
110 3300049515 Ga0501292_036260 Ga0501292_036260_107_724 203
111 3300049572 Ga0501036_0771260 Ga0501036_0771260_65_682 203
112 3300049591 Ga0501075_0322084 Ga0501075_0322084_410_1027 203
113 3300049661 Ga0501217_060765 Ga0501217_060765_351_968 203
114 3300049669 Ga0501235_065997 Ga0501235_065997_164_781 203
115 3300049824 Ga0501045_0642185 Ga0501045_0642185_53_670 203
116 3300050509 nmdc:mga0qj67_178537_c1 nmdc:mga0qj67_178537_c1_186_803 203
117 3300005618 Ga0068864_100072652 Ga0068864_1000726522 204
118 3300014325 Ga0163163_10485116 Ga0163163_104851161 204
119 3300026095 Ga0207676_10084165 Ga0207676_100841652 204
120 3300035084 Ga0373928_0069925 Ga0373928_0069925_206_826 204
121 3300035112 Ga0373932_0057256 Ga0373932_0057256_407_1027 204
122 3300048905 Ga0496102_0881952 Ga0496102_0881952_89_709 204
123 3300048907 Ga0496104_1035847 Ga0496104_1035847_35_655 204
124 3300048911 Ga0496108_0001506 Ga0496108_0001506_17750_18370 204
125 3300048912 Ga0496109_0040172 Ga0496109_0040172_3585_4205 204
126 3300048914 Ga0496111_0250185 Ga0496111_0250185_637_1257 204
127 3300048915 Ga0496112_0013930 Ga0496112_0013930_75_695 204
128 3300006852 Ga0075433_10088061 Ga0075433_100880611 205
129 3300050515 nmdc:mga0a205_169238_c1 nmdc:mga0a205_169238_c1_182_838 205
130 3300005339 Ga0070660_100191894 Ga0070660_1001918942 206
131 3300005344 Ga0070661_100016393 Ga0070661_1000163935 206
132 3300005347 Ga0070668_100007138 Ga0070668_1000071382 206
133 3300005353 Ga0070669_100037054 Ga0070669_1000370542 206
134 3300005457 Ga0070662_100009796 Ga0070662_1000097965 206
135 3300005458 Ga0070681_10000554 Ga0070681_1000055415 206
136 3300005530 Ga0070679_100059063 Ga0070679_1000590633 206
137 3300005543 Ga0070672_100140158 Ga0070672_1001401582 206
138 3300005564 Ga0070664_100007931 Ga0070664_10000793110 206
139 3300005577 Ga0068857_100005823 Ga0068857_1000058232 206
140 3300005617 Ga0068859_100108459 Ga0068859_1001084592 206
141 3300005844 Ga0068862_100000266 Ga0068862_10000026616 206
142 3300006931 Ga0097620_100108459 Ga0097620_1001084592 206
143 3300009094 Ga0111539_10016514 Ga0111539_100165145 206
144 3300009553 Ga0105249_10000199 Ga0105249_1000019950 206
145 3300011119 Ga0105246_10427440 Ga0105246_104274402 206
146 3300014326 Ga0157380_10026663 Ga0157380_100266634 206
147 3300025885 Ga0207653_10023863 Ga0207653_100238632 206
148 3300025912 Ga0207707_10001099 Ga0207707_100010996 206
149 3300025920 Ga0207649_10006664 Ga0207649_100066642 206
150 3300025921 Ga0207652_10047046 Ga0207652_100470462 206
151 3300025923 Ga0207681_10006983 Ga0207681_100069833 206
152 3300025932 Ga0207690_10028924 Ga0207690_100289242 206
153 3300025940 Ga0207691_10228790 Ga0207691_102287902 206
154 3300025945 Ga0207679_10012573 Ga0207679_100125732 206
155 3300025961 Ga0207712_10003880 Ga0207712_100038801 206
156 3300026095 Ga0207676_10358244 Ga0207676_103582441 206
157 3300026116 Ga0207674_10000388 Ga0207674_1000038816 206
158 3300028380 Ga0268265_10002510 Ga0268265_100025105 206
159 3300050511 nmdc:mga08y16_9679_c1 nmdc:mga08y16_9679_c1_4621_5244 206
160 3300031995 Ga0307409_100220778 Ga0307409_1002207781 208
161 3300035115 Ga0373941_0210630 Ga0373941_0210630_42_704 208
162 3300038996 Ga0242420_021233 Ga0242420_021233_366_1028 208
163 3300050510 nmdc:mga06r32_768727_c1 nmdc:mga06r32_768727_c1_29_658 208
164 3300005356 Ga0070674_100237261 Ga0070674_1002372612 209
165 3300025945 Ga0207679_10493290 Ga0207679_104932902 209
166 3300031824 Ga0307413_10197287 Ga0307413_101972872 209
167 3300031852 Ga0307410_10158460 Ga0307410_101584602 209
168 3300031901 Ga0307406_10019852 Ga0307406_100198523 209
169 3300031903 Ga0307407_10020792 Ga0307407_100207923 209
170 3300031995 Ga0307409_100075188 Ga0307409_1000751884 209
171 3300032002 Ga0307416_100007989 Ga0307416_1000079895 209
172 3300032002 Ga0307416_100024779 Ga0307416_1000247794 209
173 3300032004 Ga0307414_10042583 Ga0307414_100425832 209
174 3300032005 Ga0307411_10036104 Ga0307411_100361042 209
175 3300032126 Ga0307415_100276137 Ga0307415_1002761371 209
176 3300050512 nmdc:mga0n895_718100_c1 nmdc:mga0n895_718100_c1_49_681 209
177 3300005355 Ga0070671_100586609 Ga0070671_1005866091 210
178 3300005548 Ga0070665_100011876 Ga0070665_1000118762 210
179 3300028379 Ga0268266_10008533 Ga0268266_100085338 210
180 3300044684 Ga0466966_0009268 Ga0466966_0009268_2347_2979 210
181 3300045049 Ga0466959_0057325 Ga0466959_0057325_1324_1956 210
182 3300005440 Ga0070705_100005620 Ga0070705_1000056204 211
183 3300005445 Ga0070708_100026739 Ga0070708_1000267394 211
184 3300005467 Ga0070706_100065885 Ga0070706_1000658853 211
185 3300005518 Ga0070699_100010879 Ga0070699_1000108795 211
186 3300005518 Ga0070699_100239550 Ga0070699_1002395502 211
187 3300005536 Ga0070697_100077762 Ga0070697_1000777623 211
188 3300005615 Ga0070702_100216903 Ga0070702_1002169032 211
189 3300025910 Ga0207684_10080880 Ga0207684_100808803 211
190 3300025922 Ga0207646_10015713 Ga0207646_100157132 211
191 3300042876 Ga0451577_0518997 Ga0451577_0518997_211_855 211
192 3300006163 Ga0070715_10063681 Ga0070715_100636812 212
193 3300025905 Ga0207685_10106003 Ga0207685_101060032 212
194 3300009147 Ga0114129_10400094 Ga0114129_104000942 213
195 3300050508 nmdc:mga09592_455639_c1 nmdc:mga09592_455639_c1_252_896 213
196 3300050509 nmdc:mga0qj67_11694_c1 nmdc:mga0qj67_11694_c1_1192_1836 213
197 3300059421 Ga0590071_032365 Ga0590071_032365_360_1007 213
198 3300014326 Ga0157380_10120821 Ga0157380_101208212 214
199 3300025937 Ga0207669_10349130 Ga0207669_103491302 214
200 3300031903 Ga0307407_10044542 Ga0307407_100445423 217
201 3300032002 Ga0307416_100033041 Ga0307416_1000330412 217
202 3300032004 Ga0307414_10113489 Ga0307414_101134892 217
203 3300031911 Ga0307412_10110775 Ga0307412_101107752 218
204 3300049575 Ga0501039_0371816 Ga0501039_0371816_73_747 219
205 3300049576 Ga0501040_0019326 Ga0501040_0019326_871_1545 219
206 3300049587 Ga0501071_0697925 Ga0501071_0697925_73_747 219
207 3300049592 Ga0501076_0078805 Ga0501076_0078805_82_756 219
208 3300049742 Ga0501080_0271635 Ga0501080_0271635_803_1477 219
209 3300049824 Ga0501045_0159740 Ga0501045_0159740_717_1391 219
210 3300054114 Ga0501084_0294357 Ga0501084_0294357_55_729 219
211 3300060353 Ga0501082_0936001 Ga0501082_0936001_15_689 219
212 3300061734 Ga0530510_0188001 Ga0530510_0188001_21_695 219
213 3300005338 Ga0068868_100746562 Ga0068868_1007465621 222
214 3300005985 Ga0081539_10028306 Ga0081539_100283063 222
215 3300005327 Ga0070658_10069407 Ga0070658_100694072 229
216 3300005327 Ga0070658_10335298 Ga0070658_103352981 229
217 3300005339 Ga0070660_100063595 Ga0070660_1000635953 229
218 3300005366 Ga0070659_100016213 Ga0070659_1000162135 229
219 3300005616 Ga0068852_100653205 Ga0068852_1006532052 229
220 3300025909 Ga0207705_10550899 Ga0207705_105508992 229
221 3300025932 Ga0207690_10007617 Ga0207690_100076172 229
222 3300026142 Ga0207698_10620578 Ga0207698_106205782 229

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02245

Pur_DNA_glyco

Methylpurine-DNA glycosylase (MPG)

25

206

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3uby-assembly1.cif.gz_A crystal structure of human alklyadenine dna glycosylase in a lower and higher-affinity complex with dna 0.9405 20 213
3qi5-assembly1.cif.gz_A crystal structure of human alkyladenine dna glycosylase in complex with 3,n4-ethenocystosine containing duplex dna 0.9382 20 213
3qi5-assembly2.cif.gz_B crystal structure of human alkyladenine dna glycosylase in complex with 3,n4-ethenocystosine containing duplex dna 0.9373 20 213
1f6o-assembly1.cif.gz_A crystal structure of the human aag dna repair glycosylase complexed with dna 0.9198 20 213
1bnk-assembly1.cif.gz_A human 3-methyladenine dna glycosylase complexed to dna 0.9163 20 213
ID Description Score Start End Superfamily
af_Q0DX49_88_284_3.10.300.10 Alpha Beta;Roll;3-methyladenine DNA Glycosylase; Chain A;Methylpurine-DNA glycosylase (MPG) 0.9263 19 216 3.10.300.10
af_Q2FVS1_1_195_3.10.300.10 Alpha Beta;Roll;3-methyladenine DNA Glycosylase; Chain A;Methylpurine-DNA glycosylase (MPG) 0.9199 26 214 3.10.300.10
af_Q0DX49_88_284_3.10.300.10 Alpha Beta;Roll;3-methyladenine DNA Glycosylase; Chain A;Methylpurine-DNA glycosylase (MPG) 0.9172 19 216 3.10.300.10
1f4rA00 Alpha Beta;Roll;3-methyladenine DNA Glycosylase; Chain A;Methylpurine-DNA glycosylase (MPG) 0.9105 20 213 3.10.300.10
af_Q8IKG6_109_302_3.10.300.10 Alpha Beta;Roll;3-methyladenine DNA Glycosylase; Chain A;Methylpurine-DNA glycosylase (MPG) 0.9066 39 160 3.10.300.10
ID Description Score Start End GO Terms
AF-A0A1E4B460-F1-model_v4 Putative 3-methyladenine DNA glycosylase (EC 3.2.2.-) 0.991 35 218 GO:0003677
GO:0003905
GO:0006284
AF-A0A7W1E5Z7-F1-model_v4 Putative 3-methyladenine DNA glycosylase (EC 3.2.2.-) 0.9879 22 212 GO:0003677
GO:0003905
GO:0006284
AF-A0A2W6CFF0-F1-model_v4 Putative 3-methyladenine DNA glycosylase (EC 3.2.2.-) 0.9791 22 210 GO:0003677
GO:0003905
GO:0006284
AF-A0A7W1E5Z7-F1-model_v4 Putative 3-methyladenine DNA glycosylase (EC 3.2.2.-) 0.9778 22 212 GO:0003677
GO:0003905
GO:0006284
AF-A0A7X6H448-F1-model_v4 deleted 0.9761 24 131

Feature Viewer

pLDDT pTM Quality
90.14 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map