F333536

General Info

Members Datasets Scaffolds Average Seq Length
221 172 442 481

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_100266592|Ga0307416_1002665921
Length 523
Sequence VTADLGGEPPEPPDLARLTPVPPTTELPDSADSPAPDEQRISALVAQARRRAVTQLVALRDVLDDLGSRFAAAGHDLALVGGPVRDALLGRPVTDLDLTTDARPDRTVRLLRAWGDAHWEIGREFGTIGARKGDVVVEVTTYRSDTYDPTSRKPEVRFGDTLEGDLSRRDFTVNAMAVRLPGLAFVDPHGGLHDLAAGVLRTPGRPEVSFGDDPLRMMRAARFAAQLGFTVRPDVVAAMTAMAGRIEIVSAERVRTELEKTLLAPRPRAGLELLVDVGLAGHVLPELPALKLEIDEHHRHKDVYQHSLTVLEQAIALEDGPDGPVPGPDLVLRLAALLHDVGKPATRRFEPGGGVSFHHHEIVGAKLAARRLKALRFDGATVKQVARLTELHLRFHGYGEGRWTDSAVRRYVNDAGPLLDRLHKLTRSDCTTRNQGKAARLAKAYDELEARIERLAAEEELAAVRPDLDGDEIMSVLGLRPGPEVGRAYRFLLDLRLEHGPLGPERARAALLDWWREQGREPA

Samples

Sample ID Description Type Environment
1 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
2 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
3 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
4 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
5 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
6 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
7 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
8 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
9 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
10 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
12 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
13 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
14 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
15 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
16 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
17 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
18 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
19 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
20 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
21 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
22 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
34 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
36 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
37 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
38 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
39 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
40 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
41 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
42 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
43 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
44 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
45 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
46 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
47 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
48 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
49 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
50 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
51 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
52 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
53 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
54 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
55 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
56 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
57 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
58 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
59 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
60 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
61 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
62 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
63 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
64 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
65 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
66 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
67 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
68 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
69 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
70 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
71 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
72 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
73 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
74 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
75 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
76 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
77 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
78 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
79 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
80 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
81 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
82 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
83 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
84 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
85 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
86 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
87 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
88 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
89 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
90 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
91 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
92 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
93 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
94 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
95 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
96 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
97 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
98 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
99 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
100 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
101 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
102 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
103 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
104 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
105 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
106 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
107 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
108 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
109 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
110 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
111 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
112 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
113 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
114 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
115 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
116 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
130 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
132 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
133 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
134 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
135 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
136 2643221561 Nocardioides sp. Root151 Isolate Unclassified
137 2643221613 Oerskovia sp. Root22 Isolate Unclassified
138 2643221641 Nocardioides sp. Root122 Isolate Unclassified
139 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
140 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
141 2643221696 Nocardioides sp. Root140 Isolate Unclassified
142 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
143 2643221721 Oerskovia sp. Root918 Isolate Unclassified
144 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
145 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
146 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
147 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
148 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
149 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
150 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
151 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
152 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
153 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
154 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
155 2808606394 Promicromonospora sp. C35 Isolate Unclassified
156 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
157 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
158 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
159 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
160 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
161 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
162 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
163 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
164 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
165 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
166 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
167 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
168 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
169 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
170 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
171 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
172 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.81
Metatranscriptomes 0.45
Isolates 16.74

Biome Distribution

Category Percentage (%)
Aerial Root 0.45
Bulb 0
Endosphere 3.62
Nodule 0.45
Rhizoplane 9.05
Rhizosphere 65.61
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307416_100266592 3300032002 Bacteria 1678
2 Ga0070660_100079184 3300005339 Bacteria 2578
3 Ga0070667_100049945 3300005367 Bacteria 3524
4 Ga0070713_100015024 3300005436 Bacteria 5769
5 Ga0070679_100012086 3300005530 Bacteria 8245
6 Ga0070665_100011541 3300005548 Bacteria 8929
7 Ga0070664_100005071 3300005564 Bacteria 10557
8 Ga0068856_100028673 3300005614 Bacteria 5438
9 Ga0068856_100154174 3300005614 Bacteria 2307
10 Ga0068858_100103417 3300005842 Bacteria 2657
11 Ga0081539_10018908 3300005985 Bacteria 4746
12 Ga0081539_10077593 3300005985 Bacteria 1756
13 Ga0075365_10018052 3300006038 Bacteria 4330
14 Ga0075363_100006080 3300006048 Bacteria 5446
15 Ga0075370_10020545 3300006353 Bacteria 3612
16 Ga0105245_10224096 3300009098 Bacteria 1816
17 Ga0105243_10093811 3300009148 Bacteria 2477
18 Ga0105249_10033739 3300009553 Bacteria 4635
19 Ga0157369_10030527 3300013105 Bacteria 5943
20 Ga0157374_10067948 3300013296 Bacteria 3352
21 Ga0157375_10238682 3300013308 Bacteria 1977
22 Ga0157379_10002837 3300014968 Bacteria 14609
23 Ga0206353_11339395 3300020082 Bacteria 1958
24 Ga0207647_10052162 3300025904 Bacteria 2525
25 Ga0207652_10069440 3300025921 Bacteria 3059
26 Ga0207694_10101155 3300025924 Bacteria 2284
27 Ga0207700_10014043 3300025928 Bacteria 5235
28 Ga0207664_10036744 3300025929 Bacteria 3786
29 Ga0207664_10100786 3300025929 Bacteria 2385
30 Ga0207691_10103938 3300025940 Bacteria 2532
31 Ga0207689_10051149 3300025942 Bacteria 3406
32 Ga0207679_10019259 3300025945 Bacteria 4583
33 Ga0207668_10131832 3300025972 Bacteria 1910
34 Ga0207677_10078369 3300026023 Bacteria 2359
35 Ga0207702_10014281 3300026078 Bacteria 6594
36 Ga0209813_10003893 3300027866 Bacteria 3534
37 Ga0268266_10009094 3300028379 Bacteria 8772
38 Ga0316182_1167031 3300030745 Bacteria 2405
39 Ga0265340_10001184 3300031247 Bacteria 14898
40 Ga0307513_10000175 3300031456 Bacteria 92151
41 Ga0316579_10000286 3300031691 Bacteria 15468
42 Ga0316576_10022045 3300031727 Bacteria 4417
43 Ga0316578_10077620 3300031728 Bacteria 1972
44 Ga0307406_10001414 3300031901 Bacteria 13327
45 Ga0307407_10011123 3300031903 Bacteria 4272
46 Ga0307412_10061916 3300031911 Bacteria 2517
47 Ga0307416_100025342 3300032002 Bacteria 4346
48 Ga0316580_10022344 3300032139 Bacteria 1951
49 Ga0373953_0015214 3300035117 Bacteria 2783
50 Ga0373954_0039759 3300035118 Bacteria 2190
51 Ga0373943_0042612 3300035170 Bacteria 2200
52 Ga0373946_0024258 3300035171 Bacteria 2375
53 Ga0316574_0005458 3300035398 Bacteria 6778
54 Ga0316574_0026992 3300035398 Bacteria 3457
55 Ga0373924_0019252 3300035410 Bacteria 2643
56 Ga0373935_0024612 3300035692 Bacteria 3707
57 Ga0373947_0024732 3300035725 Bacteria 3501
58 Ga0316584_0049645 3300036712 Bacteria 3137
59 Ga0373925_0026057 3300037068 Bacteria 4275
60 Ga0395900_0002847 3300037418 Bacteria 18876
61 Ga0395900_0052568 3300037418 Bacteria 4193
62 Ga0436364_0093515 3300037853 Bacteria 2940
63 Ga0400485_08319 3300038735 Bacteria 132575
64 Ga0400488_18342 3300038741 Bacteria 12264
65 Ga0400486_10057 3300038742 Bacteria 45646
66 Ga0439465_0024039 3300041413 Bacteria 1919
67 Ga0439431_0003792 3300041997 Bacteria 3339
68 Ga0439446_0018410 3300042156 Bacteria 1956
69 Ga0439434_0005700 3300042435 Bacteria 3636
70 Ga0466965_0054984 3300044683 Bacteria 1980
71 Ga0466970_0016930 3300044765 Bacteria 3762
72 Ga0466970_0028340 3300044765 Bacteria 2941
73 Ga0466970_0041405 3300044765 Bacteria 2448
74 Ga0466970_0043848 3300044765 Bacteria 2381
75 Ga0466957_0075711 3300044842 Bacteria 2089
76 Ga0466960_0023588 3300044901 Bacteria 2764
77 Ga0466967_0069325 3300045976 Bacteria 3151
78 Ga0466967_0193110 3300045976 Bacteria 1925
79 Ga0495627_007200 3300046453 Bacteria 4291
80 Ga0495592_0017239 3300046454 Bacteria 5485
81 Ga0495638_0036343 3300046460 Bacteria 3139
82 Ga0495641_0025634 3300046461 Bacteria 2892
83 Ga0495651_0006769 3300046462 Bacteria 8759
84 Ga0495653_0048410 3300046463 Bacteria 3282
85 Ga0495662_0032695 3300046476 Bacteria 2514
86 Ga0495664_0099726 3300046477 Bacteria 1749
87 Ga0495608_0058519 3300046511 Bacteria 2540
88 Ga0495618_0019014 3300046514 Bacteria 4222
89 Ga0495628_0020231 3300046516 Bacteria 5493
90 Ga0495628_0084080 3300046516 Bacteria 2470
91 Ga0495630_0047224 3300046517 Bacteria 3220
92 Ga0495652_0008343 3300046529 Bacteria 9464
93 Ga0495652_0081146 3300046529 Bacteria 2676
94 Ga0495652_0103152 3300046529 Bacteria 2309
95 Ga0495652_0164114 3300046529 Bacteria 1721
96 Ga0495587_0013903 3300046536 Bacteria 5054
97 Ga0495587_0022143 3300046536 Bacteria 3915
98 Ga0495667_0011572 3300046559 Bacteria 5974
99 Ga0495667_0038478 3300046559 Bacteria 3184
100 Ga0495635_0120308 3300046663 Bacteria 1791
101 Ga0495599_0001899 3300046678 Bacteria 12098
102 Ga0495599_0040398 3300046678 Bacteria 2930
103 Ga0495623_0076981 3300046679 Bacteria 2069
104 Ga0495624_0039234 3300046690 Bacteria 3037
105 Ga0495581_0110449 3300047315 Bacteria 1599
106 Ga0495604_0004922 3300047317 Bacteria 10593
107 Ga0495674_0029898 3300047319 Bacteria 4956
108 Ga0495674_0122882 3300047319 Bacteria 2192
109 Ga0495676_0065807 3300047321 Bacteria 2812
110 Ga0495676_0103630 3300047321 Bacteria 2100
111 Ga0495680_0004693 3300047322 Bacteria 13020
112 Ga0495680_0040412 3300047322 Bacteria 3717
113 Ga0495680_0094346 3300047322 Bacteria 2239
114 Ga0495684_0005174 3300047471 Bacteria 10165
115 Ga0495684_0092472 3300047471 Bacteria 2291
116 Ga0495602_0037500 3300048088 Bacteria 4497
117 Ga0496101_0044673 3300048904 Bacteria 3171
118 Ga0496102_0029377 3300048905 Bacteria 4920
119 Ga0496103_0035142 3300048906 Bacteria 3068
120 Ga0496104_0014836 3300048907 Bacteria 7042
121 Ga0496104_0063339 3300048907 Bacteria 3507
122 Ga0496105_0088875 3300048908 Bacteria 2552
123 Ga0496105_0142156 3300048908 Bacteria 1975
124 Ga0496108_0003650 3300048911 Bacteria 12345
125 Ga0496108_0051969 3300048911 Bacteria 3433
126 Ga0496108_0063585 3300048911 Bacteria 3108
127 Ga0496109_0054312 3300048912 Bacteria 3654
128 Ga0496109_0165273 3300048912 Bacteria 2074
129 Ga0496109_0175792 3300048912 Bacteria 2010
130 Ga0496110_0060761 3300048913 Bacteria 3334
131 Ga0496111_0062216 3300048914 Bacteria 2706
132 Ga0496112_0006601 3300048915 Bacteria 10210
133 Ga0496113_0001948 3300048916 Bacteria 11820
134 Ga0496114_0008601 3300048917 Bacteria 8089
135 Ga0496114_0012887 3300048917 Bacteria 6697
136 Ga0496114_0069267 3300048917 Bacteria 2962
137 Ga0496117_0100758 3300048920 Bacteria 1828
138 Ga0496118_0037471 3300048921 Bacteria 3901
139 Ga0496119_0000553 3300048922 Bacteria 50775
140 Ga0496121_0000046 3300048924 Bacteria 335942
141 Ga0496121_0110267 3300048924 Bacteria 2100
142 Ga0496122_0000098 3300048925 Bacteria 198547
143 Ga0496122_0002574 3300048925 Bacteria 25478
144 Ga0496123_0000420 3300048926 Bacteria 77105
145 Ga0496124_0000179 3300048927 Bacteria 125772
146 Ga0496125_0000046 3300048928 Bacteria 295288
147 Ga0496125_0000230 3300048928 Bacteria 114490
148 Ga0496125_0000283 3300048928 Bacteria 100594
149 Ga0496126_0002342 3300048929 Bacteria 25941
150 Ga0501031_0043389 3300049568 Bacteria 2935
151 Ga0501032_0002286 3300049569 Bacteria 15040
152 Ga0501032_0016816 3300049569 Bacteria 5140
153 Ga0501032_0042819 3300049569 Bacteria 3070
154 Ga0501033_0027636 3300049570 Bacteria 4266
155 Ga0501034_0041657 3300049571 Bacteria 4647
156 Ga0501034_0059494 3300049571 Bacteria 3837
157 Ga0501036_0015472 3300049572 Bacteria 6373
158 Ga0501037_0005931 3300049573 Bacteria 8920
159 Ga0501037_0006936 3300049573 Bacteria 8274
160 Ga0501037_0022067 3300049573 Bacteria 4712
161 Ga0501038_0019581 3300049574 Bacteria 6098
162 Ga0501038_0069609 3300049574 Bacteria 2989
163 Ga0501039_0018431 3300049575 Bacteria 5358
164 Ga0501039_0033558 3300049575 Bacteria 3958
165 Ga0501042_0010765 3300049578 Bacteria 6150
166 Ga0501043_0005720 3300049579 Bacteria 10015
167 Ga0501043_0051009 3300049579 Bacteria 3252
168 Ga0501046_0065135 3300049580 Bacteria 2843
169 Ga0501047_0013590 3300049581 Bacteria 7721
170 Ga0501047_0083027 3300049581 Bacteria 3079
171 Ga0501047_0112436 3300049581 Bacteria 2605
172 Ga0501048_0006882 3300049582 Bacteria 8641
173 Ga0501048_0030163 3300049582 Bacteria 3925
174 Ga0501074_0001033 3300049590 Bacteria 18071
175 Ga0501035_0001926 3300049822 Bacteria 20795
176 Ga0501044_0022568 3300049823 Bacteria 6706
177 Ga0501044_0052629 3300049823 Bacteria 4194
178 Ga0501044_0102392 3300049823 Bacteria 2879
179 nmdc:mga03n38_19867_c1 3300050490 Bacteria 2678
180 nmdc:mga0yw44_44488_c1 3300050492 Bacteria 2656
181 Ga0495595_0026393 3300053084 Bacteria 2581
182 Ga0495595_0048080 3300053084 Bacteria 1969
183 Ga0500616_0000290 3300053153 Bacteria 72848
184 Ga0500616_0002643 3300053153 Bacteria 14596
185 2643827119 2643221561 Bacteria 4984412
186 2644084470 2643221613 Bacteria 4622396
187 2644231746 2643221641 Bacteria 4490190
188 2644504305 2643221690 Bacteria 4654705
189 2644524173 2643221694 Bacteria 4392972
190 2644534472 2643221696 Bacteria 5431823
191 2644539380 2643221697 Bacteria 3575694
192 2644667087 2643221721 Bacteria 4486924
193 2644668273 2643221722 Bacteria 4247614
194 2731906307 2731639228 Bacteria 4187555
195 2738694269 2738541272 Bacteria 6848551
196 2739325188 2738543027 Bacteria 6409078
197 2739609435 2739367654 Bacteria 6049412
198 2760305443 2758568522 Bacteria 5953541
199 2760626076 2758568621 Bacteria 5967089
200 2774395464 2773857762 Bacteria 5971770
201 2774397484 2773857763 Bacteria 4180068
202 2799183253 2799112218 Bacteria 4315149
203 2808884318 2808606368 Bacteria 3174172
204 2809031083 2808606394 Bacteria 6248540
205 2809193703 2808606439 Bacteria 5952208
206 2812348431 2811994878 Bacteria 5992952
207 2812363202 2811994880 Bacteria 4147780
208 2835188769 2835188231 Bacteria 3476928
209 2839987366 2839986021 Bacteria 3685650
210 2848554171 2848551377 Bacteria 3720646
211 2884997518 2884994152 Bacteria 4492978
212 2887445220 2887443736 Bacteria 4426037
213 2891973834 2891968417 Bacteria 5821697
214 2932434070 2932431166 Bacteria 4215299
215 2935893616 2935890801 Bacteria 4593001
216 2984592841 2984592036 Bacteria 3670284
217 3003003603 3002998708 Bacteria 11715108
218 8054611830 8054609563 Bacteria 5170090
219 8055068298 8055066027 Bacteria 9479577
220 8056062506 8056060235 Bacteria 7259403
221 8056584467 8056579771 Bacteria 5840325
222 Ga0307416_100266592
223 Ga0070660_100079184
224 Ga0070667_100049945
225 Ga0070713_100015024
226 Ga0070679_100012086
227 Ga0070665_100011541
228 Ga0070664_100005071
229 Ga0068856_100028673
230 Ga0068856_100154174
231 Ga0068858_100103417
232 Ga0081539_10018908
233 Ga0081539_10077593
234 Ga0075365_10018052
235 Ga0075363_100006080
236 Ga0075370_10020545
237 Ga0105245_10224096
238 Ga0105243_10093811
239 Ga0105249_10033739
240 Ga0157369_10030527
241 Ga0157374_10067948
242 Ga0157375_10238682
243 Ga0157379_10002837
244 Ga0206353_11339395
245 Ga0207647_10052162
246 Ga0207652_10069440
247 Ga0207694_10101155
248 Ga0207700_10014043
249 Ga0207664_10036744
250 Ga0207664_10100786
251 Ga0207691_10103938
252 Ga0207689_10051149
253 Ga0207679_10019259
254 Ga0207668_10131832
255 Ga0207677_10078369
256 Ga0207702_10014281
257 Ga0209813_10003893
258 Ga0268266_10009094
259 Ga0316182_1167031
260 Ga0265340_10001184
261 Ga0307513_10000175
262 Ga0316579_10000286
263 Ga0316576_10022045
264 Ga0316578_10077620
265 Ga0307406_10001414
266 Ga0307407_10011123
267 Ga0307412_10061916
268 Ga0307416_100025342
269 Ga0316580_10022344
270 Ga0373953_0015214
271 Ga0373954_0039759
272 Ga0373943_0042612
273 Ga0373946_0024258
274 Ga0316574_0005458
275 Ga0316574_0026992
276 Ga0373924_0019252
277 Ga0373935_0024612
278 Ga0373947_0024732
279 Ga0316584_0049645
280 Ga0373925_0026057
281 Ga0395900_0002847
282 Ga0395900_0052568
283 Ga0436364_0093515
284 Ga0400485_08319
285 Ga0400488_18342
286 Ga0400486_10057
287 Ga0439465_0024039
288 Ga0439431_0003792
289 Ga0439446_0018410
290 Ga0439434_0005700
291 Ga0466965_0054984
292 Ga0466970_0016930
293 Ga0466970_0028340
294 Ga0466970_0041405
295 Ga0466970_0043848
296 Ga0466957_0075711
297 Ga0466960_0023588
298 Ga0466967_0069325
299 Ga0466967_0193110
300 Ga0495627_007200
301 Ga0495592_0017239
302 Ga0495638_0036343
303 Ga0495641_0025634
304 Ga0495651_0006769
305 Ga0495653_0048410
306 Ga0495662_0032695
307 Ga0495664_0099726
308 Ga0495608_0058519
309 Ga0495618_0019014
310 Ga0495628_0020231
311 Ga0495628_0084080
312 Ga0495630_0047224
313 Ga0495652_0008343
314 Ga0495652_0081146
315 Ga0495652_0103152
316 Ga0495652_0164114
317 Ga0495587_0013903
318 Ga0495587_0022143
319 Ga0495667_0011572
320 Ga0495667_0038478
321 Ga0495635_0120308
322 Ga0495599_0001899
323 Ga0495599_0040398
324 Ga0495623_0076981
325 Ga0495624_0039234
326 Ga0495581_0110449
327 Ga0495604_0004922
328 Ga0495674_0029898
329 Ga0495674_0122882
330 Ga0495676_0065807
331 Ga0495676_0103630
332 Ga0495680_0004693
333 Ga0495680_0040412
334 Ga0495680_0094346
335 Ga0495684_0005174
336 Ga0495684_0092472
337 Ga0495602_0037500
338 Ga0496101_0044673
339 Ga0496102_0029377
340 Ga0496103_0035142
341 Ga0496104_0014836
342 Ga0496104_0063339
343 Ga0496105_0088875
344 Ga0496105_0142156
345 Ga0496108_0003650
346 Ga0496108_0051969
347 Ga0496108_0063585
348 Ga0496109_0054312
349 Ga0496109_0165273
350 Ga0496109_0175792
351 Ga0496110_0060761
352 Ga0496111_0062216
353 Ga0496112_0006601
354 Ga0496113_0001948
355 Ga0496114_0008601
356 Ga0496114_0012887
357 Ga0496114_0069267
358 Ga0496117_0100758
359 Ga0496118_0037471
360 Ga0496119_0000553
361 Ga0496121_0000046
362 Ga0496121_0110267
363 Ga0496122_0000098
364 Ga0496122_0002574
365 Ga0496123_0000420
366 Ga0496124_0000179
367 Ga0496125_0000046
368 Ga0496125_0000230
369 Ga0496125_0000283
370 Ga0496126_0002342
371 Ga0501031_0043389
372 Ga0501032_0002286
373 Ga0501032_0016816
374 Ga0501032_0042819
375 Ga0501033_0027636
376 Ga0501034_0041657
377 Ga0501034_0059494
378 Ga0501036_0015472
379 Ga0501037_0005931
380 Ga0501037_0006936
381 Ga0501037_0022067
382 Ga0501038_0019581
383 Ga0501038_0069609
384 Ga0501039_0018431
385 Ga0501039_0033558
386 Ga0501042_0010765
387 Ga0501043_0005720
388 Ga0501043_0051009
389 Ga0501046_0065135
390 Ga0501047_0013590
391 Ga0501047_0083027
392 Ga0501047_0112436
393 Ga0501048_0006882
394 Ga0501048_0030163
395 Ga0501074_0001033
396 Ga0501035_0001926
397 Ga0501044_0022568
398 Ga0501044_0052629
399 Ga0501044_0102392
400 nmdc:mga03n38_19867_c1
401 nmdc:mga0yw44_44488_c1
402 Ga0495595_0026393
403 Ga0495595_0048080
404 Ga0500616_0000290
405 Ga0500616_0002643
406 2643827119
407 2644084470
408 2644231746
409 2644504305
410 2644524173
411 2644534472
412 2644539380
413 2644667087
414 2644668273
415 2731906307
416 2738694269
417 2739325188
418 2739609435
419 2760305443
420 2760626076
421 2774395464
422 2774397484
423 2799183253
424 2808884318
425 2809031083
426 2809193703
427 2812348431
428 2812363202
429 2835188769
430 2839987366
431 2848554171
432 2884997518
433 2887445220
434 2891973834
435 2932434070
436 2935893616
437 2984592841
438 3003003603
439 8054611830
440 8055068298
441 8056062506
442 8056584467

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12627

PolyA_pol_RNAbd

Probable RNA and SrmB- binding site of polymerase A

228

290

0.97

PF01743

PolyA_pol

Poly A polymerase head domain

77

201

0.96

PF01966

HD

HD domain

303

452

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wfq-assembly2.cif.gz_F trna processing enzyme complex 1 0.7343 26 393
3wfs-assembly2.cif.gz_D trna processing enzyme complex 3 0.7303 26 393
1vfg-assembly1.cif.gz_A crystal structure of trna nucleotidyltransferase complexed with a primer trna and an incoming atp analog 0.7303 22 393
3wfo-assembly3.cif.gz_C trna processing enzyme (apo form 1) 0.7288 26 393
3wfp-assembly9.cif.gz_A trna processing enzyme (apo form 2) 0.7283 26 393
ID Description Score Start End Superfamily
1miyB02 Mainly Alpha;Orthogonal Bundle;Hydrophobic Seed Protein; 0.9713 163 233 1.10.110.30
af_Q2G256_1_109_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.855 49 160 3.30.460.10
af_L7N672_11_161_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.8518 16 154 3.30.460.10
af_L7N672_164_416_1.10.3090.10 Mainly Alpha;Orthogonal Bundle;cca-adding enzyme, domain 2;cca-adding enzyme, domain 2 0.8496 159 399 1.10.3090.10
af_Q2G256_1_109_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.8408 49 160 3.30.460.10
ID Description Score Start End GO Terms
AF-A0A6J6S3A9-F1-model_v4 Unannotated protein 0.955 304 460
AF-T0YJW9-F1-model_v4 tRNA nucleotidyltransferase 0.9389 91 233 GO:0000049
GO:0000166
GO:0008033
GO:0016779
AF-A0A6C9EIU9-F1-model_v4 CCA tRNA nucleotidyltransferase 0.9296 25 233 GO:0000049
GO:0000166
GO:0008033
GO:0016779
AF-A0A379FIU2-F1-model_v4 Poly(A) polymerase I (EC 2.7.7.19) 0.9168 116 206 GO:0003723
GO:0006396
GO:1990817
AF-A0A1V4R8V1-F1-model_v4 Poly A polymerase head domain-containing protein 0.9162 35 233 GO:0000166
GO:0001680
GO:0003723
GO:0016779

Map