F333536
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 221 | 172 | 442 | 481 |
Family's Representative Sequence
| Representative Sequence | 3300032002|Ga0307416_100266592|Ga0307416_1002665921 |
| Length | 523 |
| Sequence | VTADLGGEPPEPPDLARLTPVPPTTELPDSADSPAPDEQRISALVAQARRRAVTQLVALRDVLDDLGSRFAAAGHDLALVGGPVRDALLGRPVTDLDLTTDARPDRTVRLLRAWGDAHWEIGREFGTIGARKGDVVVEVTTYRSDTYDPTSRKPEVRFGDTLEGDLSRRDFTVNAMAVRLPGLAFVDPHGGLHDLAAGVLRTPGRPEVSFGDDPLRMMRAARFAAQLGFTVRPDVVAAMTAMAGRIEIVSAERVRTELEKTLLAPRPRAGLELLVDVGLAGHVLPELPALKLEIDEHHRHKDVYQHSLTVLEQAIALEDGPDGPVPGPDLVLRLAALLHDVGKPATRRFEPGGGVSFHHHEIVGAKLAARRLKALRFDGATVKQVARLTELHLRFHGYGEGRWTDSAVRRYVNDAGPLLDRLHKLTRSDCTTRNQGKAARLAKAYDELEARIERLAAEEELAAVRPDLDGDEIMSVLGLRPGPEVGRAYRFLLDLRLEHGPLGPERARAALLDWWREQGREPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 2 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 5 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 9 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 10 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 11 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 12 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 13 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 14 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 15 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 16 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 17 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 18 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 19 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 20 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 21 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 22 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 23 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 24 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 25 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 26 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 27 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 28 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 29 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 31 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 33 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 34 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 36 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 37 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 38 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 39 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 40 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 41 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 42 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 43 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 44 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 45 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 46 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 47 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 48 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 49 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 50 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 51 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 52 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 53 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 54 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 55 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 56 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 57 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 58 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 59 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 60 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 61 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 62 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 63 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 64 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 65 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 66 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 67 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 68 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 69 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 70 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 71 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 72 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 73 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 74 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 75 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 76 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 77 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 78 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 96 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 97 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 98 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 99 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 100 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 101 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 102 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 103 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 104 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 105 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 106 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 107 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 108 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 109 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 110 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 111 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 112 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 113 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 114 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 115 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 116 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 117 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 118 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 119 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 120 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 121 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 122 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 123 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 124 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 125 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 126 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 127 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 128 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 129 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 130 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 131 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 132 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 133 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 134 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 136 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 137 | 2643221613 | Oerskovia sp. Root22 | Isolate | Unclassified |
| 138 | 2643221641 | Nocardioides sp. Root122 | Isolate | Unclassified |
| 139 | 2643221690 | Cellulomonas sp. Root485 | Isolate | Unclassified |
| 140 | 2643221694 | Cellulomonas sp. Root137 | Isolate | Unclassified |
| 141 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 142 | 2643221697 | Aeromicrobium sp. Root495 | Isolate | Unclassified |
| 143 | 2643221721 | Oerskovia sp. Root918 | Isolate | Unclassified |
| 144 | 2643221722 | Cellulomonas sp. Root930 | Isolate | Unclassified |
| 145 | 2731639228 | Motilibacter peucedani DSM 45328 | Isolate | Rhizosphere |
| 146 | 2738541272 | Promicromonospora sp. AC04 | Isolate | Unclassified |
| 147 | 2738543027 | Promicromonospora sp. CF082 | Isolate | Unclassified |
| 148 | 2739367654 | Promicromonospora sp. YR516 | Isolate | Unclassified |
| 149 | 2758568522 | Promicromonospora thailandica SAI-039 | Isolate | Unclassified |
| 150 | 2758568621 | Promicromonospora sukumoe SAI-064 | Isolate | Unclassified |
| 151 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 152 | 2773857763 | Microbacterium sp. SAI-030 | Isolate | Unclassified |
| 153 | 2799112218 | Motilibacter rhizosphaerae DSM 45622 | Isolate | Rhizosphere |
| 154 | 2808606368 | Microbacterium sp. SLBN-1 | Isolate | Unclassified |
| 155 | 2808606394 | Promicromonospora sp. C35 | Isolate | Unclassified |
| 156 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 157 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 158 | 2811994880 | Cellulomonas sp. SLBN-39 | Isolate | Unclassified |
| 159 | 2835188231 | Isoptericola variabilis JZ7 | Isolate | Unclassified |
| 160 | 2839986021 | Cellulosimicrobium cellulans JZ5 | Isolate | Unclassified |
| 161 | 2848551377 | Brachybacterium saurashtrense DSM 23186 | Isolate | Unclassified |
| 162 | 2884994152 | Cellulomonas sp. H30R-01 | Isolate | Rhizosphere |
| 163 | 2887443736 | Ruania rhizosphaerae LNNU 22110 | Isolate | Rhizosphere |
| 164 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 165 | 2932431166 | Cellulosimicrobium sp. 4261 | Isolate | Rhizosphere |
| 166 | 2935890801 | Oerskovia enterophila 3230 | Isolate | Rhizosphere |
| 167 | 2984592036 | Aeromicrobium sp. SORGH_AS981 | Isolate | Aerial Root |
| 168 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 169 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
| 170 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 171 | 8056060235 | Nocardiopsis endophytica RSe5-2 | Isolate | Unclassified |
| 172 | 8056579771 | Promicromonospora iranensis UTMC 00792 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.81 |
| Metatranscriptomes | 0.45 |
| Isolates | 16.74 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.45 |
| Bulb | 0 |
| Endosphere | 3.62 |
| Nodule | 0.45 |
| Rhizoplane | 9.05 |
| Rhizosphere | 65.61 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0307416_100266592 | 3300032002 | Bacteria | 1678 |
| 2 | Ga0070660_100079184 | 3300005339 | Bacteria | 2578 |
| 3 | Ga0070667_100049945 | 3300005367 | Bacteria | 3524 |
| 4 | Ga0070713_100015024 | 3300005436 | Bacteria | 5769 |
| 5 | Ga0070679_100012086 | 3300005530 | Bacteria | 8245 |
| 6 | Ga0070665_100011541 | 3300005548 | Bacteria | 8929 |
| 7 | Ga0070664_100005071 | 3300005564 | Bacteria | 10557 |
| 8 | Ga0068856_100028673 | 3300005614 | Bacteria | 5438 |
| 9 | Ga0068856_100154174 | 3300005614 | Bacteria | 2307 |
| 10 | Ga0068858_100103417 | 3300005842 | Bacteria | 2657 |
| 11 | Ga0081539_10018908 | 3300005985 | Bacteria | 4746 |
| 12 | Ga0081539_10077593 | 3300005985 | Bacteria | 1756 |
| 13 | Ga0075365_10018052 | 3300006038 | Bacteria | 4330 |
| 14 | Ga0075363_100006080 | 3300006048 | Bacteria | 5446 |
| 15 | Ga0075370_10020545 | 3300006353 | Bacteria | 3612 |
| 16 | Ga0105245_10224096 | 3300009098 | Bacteria | 1816 |
| 17 | Ga0105243_10093811 | 3300009148 | Bacteria | 2477 |
| 18 | Ga0105249_10033739 | 3300009553 | Bacteria | 4635 |
| 19 | Ga0157369_10030527 | 3300013105 | Bacteria | 5943 |
| 20 | Ga0157374_10067948 | 3300013296 | Bacteria | 3352 |
| 21 | Ga0157375_10238682 | 3300013308 | Bacteria | 1977 |
| 22 | Ga0157379_10002837 | 3300014968 | Bacteria | 14609 |
| 23 | Ga0206353_11339395 | 3300020082 | Bacteria | 1958 |
| 24 | Ga0207647_10052162 | 3300025904 | Bacteria | 2525 |
| 25 | Ga0207652_10069440 | 3300025921 | Bacteria | 3059 |
| 26 | Ga0207694_10101155 | 3300025924 | Bacteria | 2284 |
| 27 | Ga0207700_10014043 | 3300025928 | Bacteria | 5235 |
| 28 | Ga0207664_10036744 | 3300025929 | Bacteria | 3786 |
| 29 | Ga0207664_10100786 | 3300025929 | Bacteria | 2385 |
| 30 | Ga0207691_10103938 | 3300025940 | Bacteria | 2532 |
| 31 | Ga0207689_10051149 | 3300025942 | Bacteria | 3406 |
| 32 | Ga0207679_10019259 | 3300025945 | Bacteria | 4583 |
| 33 | Ga0207668_10131832 | 3300025972 | Bacteria | 1910 |
| 34 | Ga0207677_10078369 | 3300026023 | Bacteria | 2359 |
| 35 | Ga0207702_10014281 | 3300026078 | Bacteria | 6594 |
| 36 | Ga0209813_10003893 | 3300027866 | Bacteria | 3534 |
| 37 | Ga0268266_10009094 | 3300028379 | Bacteria | 8772 |
| 38 | Ga0316182_1167031 | 3300030745 | Bacteria | 2405 |
| 39 | Ga0265340_10001184 | 3300031247 | Bacteria | 14898 |
| 40 | Ga0307513_10000175 | 3300031456 | Bacteria | 92151 |
| 41 | Ga0316579_10000286 | 3300031691 | Bacteria | 15468 |
| 42 | Ga0316576_10022045 | 3300031727 | Bacteria | 4417 |
| 43 | Ga0316578_10077620 | 3300031728 | Bacteria | 1972 |
| 44 | Ga0307406_10001414 | 3300031901 | Bacteria | 13327 |
| 45 | Ga0307407_10011123 | 3300031903 | Bacteria | 4272 |
| 46 | Ga0307412_10061916 | 3300031911 | Bacteria | 2517 |
| 47 | Ga0307416_100025342 | 3300032002 | Bacteria | 4346 |
| 48 | Ga0316580_10022344 | 3300032139 | Bacteria | 1951 |
| 49 | Ga0373953_0015214 | 3300035117 | Bacteria | 2783 |
| 50 | Ga0373954_0039759 | 3300035118 | Bacteria | 2190 |
| 51 | Ga0373943_0042612 | 3300035170 | Bacteria | 2200 |
| 52 | Ga0373946_0024258 | 3300035171 | Bacteria | 2375 |
| 53 | Ga0316574_0005458 | 3300035398 | Bacteria | 6778 |
| 54 | Ga0316574_0026992 | 3300035398 | Bacteria | 3457 |
| 55 | Ga0373924_0019252 | 3300035410 | Bacteria | 2643 |
| 56 | Ga0373935_0024612 | 3300035692 | Bacteria | 3707 |
| 57 | Ga0373947_0024732 | 3300035725 | Bacteria | 3501 |
| 58 | Ga0316584_0049645 | 3300036712 | Bacteria | 3137 |
| 59 | Ga0373925_0026057 | 3300037068 | Bacteria | 4275 |
| 60 | Ga0395900_0002847 | 3300037418 | Bacteria | 18876 |
| 61 | Ga0395900_0052568 | 3300037418 | Bacteria | 4193 |
| 62 | Ga0436364_0093515 | 3300037853 | Bacteria | 2940 |
| 63 | Ga0400485_08319 | 3300038735 | Bacteria | 132575 |
| 64 | Ga0400488_18342 | 3300038741 | Bacteria | 12264 |
| 65 | Ga0400486_10057 | 3300038742 | Bacteria | 45646 |
| 66 | Ga0439465_0024039 | 3300041413 | Bacteria | 1919 |
| 67 | Ga0439431_0003792 | 3300041997 | Bacteria | 3339 |
| 68 | Ga0439446_0018410 | 3300042156 | Bacteria | 1956 |
| 69 | Ga0439434_0005700 | 3300042435 | Bacteria | 3636 |
| 70 | Ga0466965_0054984 | 3300044683 | Bacteria | 1980 |
| 71 | Ga0466970_0016930 | 3300044765 | Bacteria | 3762 |
| 72 | Ga0466970_0028340 | 3300044765 | Bacteria | 2941 |
| 73 | Ga0466970_0041405 | 3300044765 | Bacteria | 2448 |
| 74 | Ga0466970_0043848 | 3300044765 | Bacteria | 2381 |
| 75 | Ga0466957_0075711 | 3300044842 | Bacteria | 2089 |
| 76 | Ga0466960_0023588 | 3300044901 | Bacteria | 2764 |
| 77 | Ga0466967_0069325 | 3300045976 | Bacteria | 3151 |
| 78 | Ga0466967_0193110 | 3300045976 | Bacteria | 1925 |
| 79 | Ga0495627_007200 | 3300046453 | Bacteria | 4291 |
| 80 | Ga0495592_0017239 | 3300046454 | Bacteria | 5485 |
| 81 | Ga0495638_0036343 | 3300046460 | Bacteria | 3139 |
| 82 | Ga0495641_0025634 | 3300046461 | Bacteria | 2892 |
| 83 | Ga0495651_0006769 | 3300046462 | Bacteria | 8759 |
| 84 | Ga0495653_0048410 | 3300046463 | Bacteria | 3282 |
| 85 | Ga0495662_0032695 | 3300046476 | Bacteria | 2514 |
| 86 | Ga0495664_0099726 | 3300046477 | Bacteria | 1749 |
| 87 | Ga0495608_0058519 | 3300046511 | Bacteria | 2540 |
| 88 | Ga0495618_0019014 | 3300046514 | Bacteria | 4222 |
| 89 | Ga0495628_0020231 | 3300046516 | Bacteria | 5493 |
| 90 | Ga0495628_0084080 | 3300046516 | Bacteria | 2470 |
| 91 | Ga0495630_0047224 | 3300046517 | Bacteria | 3220 |
| 92 | Ga0495652_0008343 | 3300046529 | Bacteria | 9464 |
| 93 | Ga0495652_0081146 | 3300046529 | Bacteria | 2676 |
| 94 | Ga0495652_0103152 | 3300046529 | Bacteria | 2309 |
| 95 | Ga0495652_0164114 | 3300046529 | Bacteria | 1721 |
| 96 | Ga0495587_0013903 | 3300046536 | Bacteria | 5054 |
| 97 | Ga0495587_0022143 | 3300046536 | Bacteria | 3915 |
| 98 | Ga0495667_0011572 | 3300046559 | Bacteria | 5974 |
| 99 | Ga0495667_0038478 | 3300046559 | Bacteria | 3184 |
| 100 | Ga0495635_0120308 | 3300046663 | Bacteria | 1791 |
| 101 | Ga0495599_0001899 | 3300046678 | Bacteria | 12098 |
| 102 | Ga0495599_0040398 | 3300046678 | Bacteria | 2930 |
| 103 | Ga0495623_0076981 | 3300046679 | Bacteria | 2069 |
| 104 | Ga0495624_0039234 | 3300046690 | Bacteria | 3037 |
| 105 | Ga0495581_0110449 | 3300047315 | Bacteria | 1599 |
| 106 | Ga0495604_0004922 | 3300047317 | Bacteria | 10593 |
| 107 | Ga0495674_0029898 | 3300047319 | Bacteria | 4956 |
| 108 | Ga0495674_0122882 | 3300047319 | Bacteria | 2192 |
| 109 | Ga0495676_0065807 | 3300047321 | Bacteria | 2812 |
| 110 | Ga0495676_0103630 | 3300047321 | Bacteria | 2100 |
| 111 | Ga0495680_0004693 | 3300047322 | Bacteria | 13020 |
| 112 | Ga0495680_0040412 | 3300047322 | Bacteria | 3717 |
| 113 | Ga0495680_0094346 | 3300047322 | Bacteria | 2239 |
| 114 | Ga0495684_0005174 | 3300047471 | Bacteria | 10165 |
| 115 | Ga0495684_0092472 | 3300047471 | Bacteria | 2291 |
| 116 | Ga0495602_0037500 | 3300048088 | Bacteria | 4497 |
| 117 | Ga0496101_0044673 | 3300048904 | Bacteria | 3171 |
| 118 | Ga0496102_0029377 | 3300048905 | Bacteria | 4920 |
| 119 | Ga0496103_0035142 | 3300048906 | Bacteria | 3068 |
| 120 | Ga0496104_0014836 | 3300048907 | Bacteria | 7042 |
| 121 | Ga0496104_0063339 | 3300048907 | Bacteria | 3507 |
| 122 | Ga0496105_0088875 | 3300048908 | Bacteria | 2552 |
| 123 | Ga0496105_0142156 | 3300048908 | Bacteria | 1975 |
| 124 | Ga0496108_0003650 | 3300048911 | Bacteria | 12345 |
| 125 | Ga0496108_0051969 | 3300048911 | Bacteria | 3433 |
| 126 | Ga0496108_0063585 | 3300048911 | Bacteria | 3108 |
| 127 | Ga0496109_0054312 | 3300048912 | Bacteria | 3654 |
| 128 | Ga0496109_0165273 | 3300048912 | Bacteria | 2074 |
| 129 | Ga0496109_0175792 | 3300048912 | Bacteria | 2010 |
| 130 | Ga0496110_0060761 | 3300048913 | Bacteria | 3334 |
| 131 | Ga0496111_0062216 | 3300048914 | Bacteria | 2706 |
| 132 | Ga0496112_0006601 | 3300048915 | Bacteria | 10210 |
| 133 | Ga0496113_0001948 | 3300048916 | Bacteria | 11820 |
| 134 | Ga0496114_0008601 | 3300048917 | Bacteria | 8089 |
| 135 | Ga0496114_0012887 | 3300048917 | Bacteria | 6697 |
| 136 | Ga0496114_0069267 | 3300048917 | Bacteria | 2962 |
| 137 | Ga0496117_0100758 | 3300048920 | Bacteria | 1828 |
| 138 | Ga0496118_0037471 | 3300048921 | Bacteria | 3901 |
| 139 | Ga0496119_0000553 | 3300048922 | Bacteria | 50775 |
| 140 | Ga0496121_0000046 | 3300048924 | Bacteria | 335942 |
| 141 | Ga0496121_0110267 | 3300048924 | Bacteria | 2100 |
| 142 | Ga0496122_0000098 | 3300048925 | Bacteria | 198547 |
| 143 | Ga0496122_0002574 | 3300048925 | Bacteria | 25478 |
| 144 | Ga0496123_0000420 | 3300048926 | Bacteria | 77105 |
| 145 | Ga0496124_0000179 | 3300048927 | Bacteria | 125772 |
| 146 | Ga0496125_0000046 | 3300048928 | Bacteria | 295288 |
| 147 | Ga0496125_0000230 | 3300048928 | Bacteria | 114490 |
| 148 | Ga0496125_0000283 | 3300048928 | Bacteria | 100594 |
| 149 | Ga0496126_0002342 | 3300048929 | Bacteria | 25941 |
| 150 | Ga0501031_0043389 | 3300049568 | Bacteria | 2935 |
| 151 | Ga0501032_0002286 | 3300049569 | Bacteria | 15040 |
| 152 | Ga0501032_0016816 | 3300049569 | Bacteria | 5140 |
| 153 | Ga0501032_0042819 | 3300049569 | Bacteria | 3070 |
| 154 | Ga0501033_0027636 | 3300049570 | Bacteria | 4266 |
| 155 | Ga0501034_0041657 | 3300049571 | Bacteria | 4647 |
| 156 | Ga0501034_0059494 | 3300049571 | Bacteria | 3837 |
| 157 | Ga0501036_0015472 | 3300049572 | Bacteria | 6373 |
| 158 | Ga0501037_0005931 | 3300049573 | Bacteria | 8920 |
| 159 | Ga0501037_0006936 | 3300049573 | Bacteria | 8274 |
| 160 | Ga0501037_0022067 | 3300049573 | Bacteria | 4712 |
| 161 | Ga0501038_0019581 | 3300049574 | Bacteria | 6098 |
| 162 | Ga0501038_0069609 | 3300049574 | Bacteria | 2989 |
| 163 | Ga0501039_0018431 | 3300049575 | Bacteria | 5358 |
| 164 | Ga0501039_0033558 | 3300049575 | Bacteria | 3958 |
| 165 | Ga0501042_0010765 | 3300049578 | Bacteria | 6150 |
| 166 | Ga0501043_0005720 | 3300049579 | Bacteria | 10015 |
| 167 | Ga0501043_0051009 | 3300049579 | Bacteria | 3252 |
| 168 | Ga0501046_0065135 | 3300049580 | Bacteria | 2843 |
| 169 | Ga0501047_0013590 | 3300049581 | Bacteria | 7721 |
| 170 | Ga0501047_0083027 | 3300049581 | Bacteria | 3079 |
| 171 | Ga0501047_0112436 | 3300049581 | Bacteria | 2605 |
| 172 | Ga0501048_0006882 | 3300049582 | Bacteria | 8641 |
| 173 | Ga0501048_0030163 | 3300049582 | Bacteria | 3925 |
| 174 | Ga0501074_0001033 | 3300049590 | Bacteria | 18071 |
| 175 | Ga0501035_0001926 | 3300049822 | Bacteria | 20795 |
| 176 | Ga0501044_0022568 | 3300049823 | Bacteria | 6706 |
| 177 | Ga0501044_0052629 | 3300049823 | Bacteria | 4194 |
| 178 | Ga0501044_0102392 | 3300049823 | Bacteria | 2879 |
| 179 | nmdc:mga03n38_19867_c1 | 3300050490 | Bacteria | 2678 |
| 180 | nmdc:mga0yw44_44488_c1 | 3300050492 | Bacteria | 2656 |
| 181 | Ga0495595_0026393 | 3300053084 | Bacteria | 2581 |
| 182 | Ga0495595_0048080 | 3300053084 | Bacteria | 1969 |
| 183 | Ga0500616_0000290 | 3300053153 | Bacteria | 72848 |
| 184 | Ga0500616_0002643 | 3300053153 | Bacteria | 14596 |
| 185 | 2643827119 | 2643221561 | Bacteria | 4984412 |
| 186 | 2644084470 | 2643221613 | Bacteria | 4622396 |
| 187 | 2644231746 | 2643221641 | Bacteria | 4490190 |
| 188 | 2644504305 | 2643221690 | Bacteria | 4654705 |
| 189 | 2644524173 | 2643221694 | Bacteria | 4392972 |
| 190 | 2644534472 | 2643221696 | Bacteria | 5431823 |
| 191 | 2644539380 | 2643221697 | Bacteria | 3575694 |
| 192 | 2644667087 | 2643221721 | Bacteria | 4486924 |
| 193 | 2644668273 | 2643221722 | Bacteria | 4247614 |
| 194 | 2731906307 | 2731639228 | Bacteria | 4187555 |
| 195 | 2738694269 | 2738541272 | Bacteria | 6848551 |
| 196 | 2739325188 | 2738543027 | Bacteria | 6409078 |
| 197 | 2739609435 | 2739367654 | Bacteria | 6049412 |
| 198 | 2760305443 | 2758568522 | Bacteria | 5953541 |
| 199 | 2760626076 | 2758568621 | Bacteria | 5967089 |
| 200 | 2774395464 | 2773857762 | Bacteria | 5971770 |
| 201 | 2774397484 | 2773857763 | Bacteria | 4180068 |
| 202 | 2799183253 | 2799112218 | Bacteria | 4315149 |
| 203 | 2808884318 | 2808606368 | Bacteria | 3174172 |
| 204 | 2809031083 | 2808606394 | Bacteria | 6248540 |
| 205 | 2809193703 | 2808606439 | Bacteria | 5952208 |
| 206 | 2812348431 | 2811994878 | Bacteria | 5992952 |
| 207 | 2812363202 | 2811994880 | Bacteria | 4147780 |
| 208 | 2835188769 | 2835188231 | Bacteria | 3476928 |
| 209 | 2839987366 | 2839986021 | Bacteria | 3685650 |
| 210 | 2848554171 | 2848551377 | Bacteria | 3720646 |
| 211 | 2884997518 | 2884994152 | Bacteria | 4492978 |
| 212 | 2887445220 | 2887443736 | Bacteria | 4426037 |
| 213 | 2891973834 | 2891968417 | Bacteria | 5821697 |
| 214 | 2932434070 | 2932431166 | Bacteria | 4215299 |
| 215 | 2935893616 | 2935890801 | Bacteria | 4593001 |
| 216 | 2984592841 | 2984592036 | Bacteria | 3670284 |
| 217 | 3003003603 | 3002998708 | Bacteria | 11715108 |
| 218 | 8054611830 | 8054609563 | Bacteria | 5170090 |
| 219 | 8055068298 | 8055066027 | Bacteria | 9479577 |
| 220 | 8056062506 | 8056060235 | Bacteria | 7259403 |
| 221 | 8056584467 | 8056579771 | Bacteria | 5840325 |
| 222 | Ga0307416_100266592 | |||
| 223 | Ga0070660_100079184 | |||
| 224 | Ga0070667_100049945 | |||
| 225 | Ga0070713_100015024 | |||
| 226 | Ga0070679_100012086 | |||
| 227 | Ga0070665_100011541 | |||
| 228 | Ga0070664_100005071 | |||
| 229 | Ga0068856_100028673 | |||
| 230 | Ga0068856_100154174 | |||
| 231 | Ga0068858_100103417 | |||
| 232 | Ga0081539_10018908 | |||
| 233 | Ga0081539_10077593 | |||
| 234 | Ga0075365_10018052 | |||
| 235 | Ga0075363_100006080 | |||
| 236 | Ga0075370_10020545 | |||
| 237 | Ga0105245_10224096 | |||
| 238 | Ga0105243_10093811 | |||
| 239 | Ga0105249_10033739 | |||
| 240 | Ga0157369_10030527 | |||
| 241 | Ga0157374_10067948 | |||
| 242 | Ga0157375_10238682 | |||
| 243 | Ga0157379_10002837 | |||
| 244 | Ga0206353_11339395 | |||
| 245 | Ga0207647_10052162 | |||
| 246 | Ga0207652_10069440 | |||
| 247 | Ga0207694_10101155 | |||
| 248 | Ga0207700_10014043 | |||
| 249 | Ga0207664_10036744 | |||
| 250 | Ga0207664_10100786 | |||
| 251 | Ga0207691_10103938 | |||
| 252 | Ga0207689_10051149 | |||
| 253 | Ga0207679_10019259 | |||
| 254 | Ga0207668_10131832 | |||
| 255 | Ga0207677_10078369 | |||
| 256 | Ga0207702_10014281 | |||
| 257 | Ga0209813_10003893 | |||
| 258 | Ga0268266_10009094 | |||
| 259 | Ga0316182_1167031 | |||
| 260 | Ga0265340_10001184 | |||
| 261 | Ga0307513_10000175 | |||
| 262 | Ga0316579_10000286 | |||
| 263 | Ga0316576_10022045 | |||
| 264 | Ga0316578_10077620 | |||
| 265 | Ga0307406_10001414 | |||
| 266 | Ga0307407_10011123 | |||
| 267 | Ga0307412_10061916 | |||
| 268 | Ga0307416_100025342 | |||
| 269 | Ga0316580_10022344 | |||
| 270 | Ga0373953_0015214 | |||
| 271 | Ga0373954_0039759 | |||
| 272 | Ga0373943_0042612 | |||
| 273 | Ga0373946_0024258 | |||
| 274 | Ga0316574_0005458 | |||
| 275 | Ga0316574_0026992 | |||
| 276 | Ga0373924_0019252 | |||
| 277 | Ga0373935_0024612 | |||
| 278 | Ga0373947_0024732 | |||
| 279 | Ga0316584_0049645 | |||
| 280 | Ga0373925_0026057 | |||
| 281 | Ga0395900_0002847 | |||
| 282 | Ga0395900_0052568 | |||
| 283 | Ga0436364_0093515 | |||
| 284 | Ga0400485_08319 | |||
| 285 | Ga0400488_18342 | |||
| 286 | Ga0400486_10057 | |||
| 287 | Ga0439465_0024039 | |||
| 288 | Ga0439431_0003792 | |||
| 289 | Ga0439446_0018410 | |||
| 290 | Ga0439434_0005700 | |||
| 291 | Ga0466965_0054984 | |||
| 292 | Ga0466970_0016930 | |||
| 293 | Ga0466970_0028340 | |||
| 294 | Ga0466970_0041405 | |||
| 295 | Ga0466970_0043848 | |||
| 296 | Ga0466957_0075711 | |||
| 297 | Ga0466960_0023588 | |||
| 298 | Ga0466967_0069325 | |||
| 299 | Ga0466967_0193110 | |||
| 300 | Ga0495627_007200 | |||
| 301 | Ga0495592_0017239 | |||
| 302 | Ga0495638_0036343 | |||
| 303 | Ga0495641_0025634 | |||
| 304 | Ga0495651_0006769 | |||
| 305 | Ga0495653_0048410 | |||
| 306 | Ga0495662_0032695 | |||
| 307 | Ga0495664_0099726 | |||
| 308 | Ga0495608_0058519 | |||
| 309 | Ga0495618_0019014 | |||
| 310 | Ga0495628_0020231 | |||
| 311 | Ga0495628_0084080 | |||
| 312 | Ga0495630_0047224 | |||
| 313 | Ga0495652_0008343 | |||
| 314 | Ga0495652_0081146 | |||
| 315 | Ga0495652_0103152 | |||
| 316 | Ga0495652_0164114 | |||
| 317 | Ga0495587_0013903 | |||
| 318 | Ga0495587_0022143 | |||
| 319 | Ga0495667_0011572 | |||
| 320 | Ga0495667_0038478 | |||
| 321 | Ga0495635_0120308 | |||
| 322 | Ga0495599_0001899 | |||
| 323 | Ga0495599_0040398 | |||
| 324 | Ga0495623_0076981 | |||
| 325 | Ga0495624_0039234 | |||
| 326 | Ga0495581_0110449 | |||
| 327 | Ga0495604_0004922 | |||
| 328 | Ga0495674_0029898 | |||
| 329 | Ga0495674_0122882 | |||
| 330 | Ga0495676_0065807 | |||
| 331 | Ga0495676_0103630 | |||
| 332 | Ga0495680_0004693 | |||
| 333 | Ga0495680_0040412 | |||
| 334 | Ga0495680_0094346 | |||
| 335 | Ga0495684_0005174 | |||
| 336 | Ga0495684_0092472 | |||
| 337 | Ga0495602_0037500 | |||
| 338 | Ga0496101_0044673 | |||
| 339 | Ga0496102_0029377 | |||
| 340 | Ga0496103_0035142 | |||
| 341 | Ga0496104_0014836 | |||
| 342 | Ga0496104_0063339 | |||
| 343 | Ga0496105_0088875 | |||
| 344 | Ga0496105_0142156 | |||
| 345 | Ga0496108_0003650 | |||
| 346 | Ga0496108_0051969 | |||
| 347 | Ga0496108_0063585 | |||
| 348 | Ga0496109_0054312 | |||
| 349 | Ga0496109_0165273 | |||
| 350 | Ga0496109_0175792 | |||
| 351 | Ga0496110_0060761 | |||
| 352 | Ga0496111_0062216 | |||
| 353 | Ga0496112_0006601 | |||
| 354 | Ga0496113_0001948 | |||
| 355 | Ga0496114_0008601 | |||
| 356 | Ga0496114_0012887 | |||
| 357 | Ga0496114_0069267 | |||
| 358 | Ga0496117_0100758 | |||
| 359 | Ga0496118_0037471 | |||
| 360 | Ga0496119_0000553 | |||
| 361 | Ga0496121_0000046 | |||
| 362 | Ga0496121_0110267 | |||
| 363 | Ga0496122_0000098 | |||
| 364 | Ga0496122_0002574 | |||
| 365 | Ga0496123_0000420 | |||
| 366 | Ga0496124_0000179 | |||
| 367 | Ga0496125_0000046 | |||
| 368 | Ga0496125_0000230 | |||
| 369 | Ga0496125_0000283 | |||
| 370 | Ga0496126_0002342 | |||
| 371 | Ga0501031_0043389 | |||
| 372 | Ga0501032_0002286 | |||
| 373 | Ga0501032_0016816 | |||
| 374 | Ga0501032_0042819 | |||
| 375 | Ga0501033_0027636 | |||
| 376 | Ga0501034_0041657 | |||
| 377 | Ga0501034_0059494 | |||
| 378 | Ga0501036_0015472 | |||
| 379 | Ga0501037_0005931 | |||
| 380 | Ga0501037_0006936 | |||
| 381 | Ga0501037_0022067 | |||
| 382 | Ga0501038_0019581 | |||
| 383 | Ga0501038_0069609 | |||
| 384 | Ga0501039_0018431 | |||
| 385 | Ga0501039_0033558 | |||
| 386 | Ga0501042_0010765 | |||
| 387 | Ga0501043_0005720 | |||
| 388 | Ga0501043_0051009 | |||
| 389 | Ga0501046_0065135 | |||
| 390 | Ga0501047_0013590 | |||
| 391 | Ga0501047_0083027 | |||
| 392 | Ga0501047_0112436 | |||
| 393 | Ga0501048_0006882 | |||
| 394 | Ga0501048_0030163 | |||
| 395 | Ga0501074_0001033 | |||
| 396 | Ga0501035_0001926 | |||
| 397 | Ga0501044_0022568 | |||
| 398 | Ga0501044_0052629 | |||
| 399 | Ga0501044_0102392 | |||
| 400 | nmdc:mga03n38_19867_c1 | |||
| 401 | nmdc:mga0yw44_44488_c1 | |||
| 402 | Ga0495595_0026393 | |||
| 403 | Ga0495595_0048080 | |||
| 404 | Ga0500616_0000290 | |||
| 405 | Ga0500616_0002643 | |||
| 406 | 2643827119 | |||
| 407 | 2644084470 | |||
| 408 | 2644231746 | |||
| 409 | 2644504305 | |||
| 410 | 2644524173 | |||
| 411 | 2644534472 | |||
| 412 | 2644539380 | |||
| 413 | 2644667087 | |||
| 414 | 2644668273 | |||
| 415 | 2731906307 | |||
| 416 | 2738694269 | |||
| 417 | 2739325188 | |||
| 418 | 2739609435 | |||
| 419 | 2760305443 | |||
| 420 | 2760626076 | |||
| 421 | 2774395464 | |||
| 422 | 2774397484 | |||
| 423 | 2799183253 | |||
| 424 | 2808884318 | |||
| 425 | 2809031083 | |||
| 426 | 2809193703 | |||
| 427 | 2812348431 | |||
| 428 | 2812363202 | |||
| 429 | 2835188769 | |||
| 430 | 2839987366 | |||
| 431 | 2848554171 | |||
| 432 | 2884997518 | |||
| 433 | 2887445220 | |||
| 434 | 2891973834 | |||
| 435 | 2932434070 | |||
| 436 | 2935893616 | |||
| 437 | 2984592841 | |||
| 438 | 3003003603 | |||
| 439 | 8054611830 | |||
| 440 | 8055068298 | |||
| 441 | 8056062506 | |||
| 442 | 8056584467 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3wfq-assembly2.cif.gz_F | trna processing enzyme complex 1 | 0.7343 | 26 | 393 |
| 3wfs-assembly2.cif.gz_D | trna processing enzyme complex 3 | 0.7303 | 26 | 393 |
| 1vfg-assembly1.cif.gz_A | crystal structure of trna nucleotidyltransferase complexed with a primer trna and an incoming atp analog | 0.7303 | 22 | 393 |
| 3wfo-assembly3.cif.gz_C | trna processing enzyme (apo form 1) | 0.7288 | 26 | 393 |
| 3wfp-assembly9.cif.gz_A | trna processing enzyme (apo form 2) | 0.7283 | 26 | 393 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1miyB02 | Mainly Alpha;Orthogonal Bundle;Hydrophobic Seed Protein; | 0.9713 | 163 | 233 | 1.10.110.30 |
| af_Q2G256_1_109_3.30.460.10 | Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 | 0.855 | 49 | 160 | 3.30.460.10 |
| af_L7N672_11_161_3.30.460.10 | Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 | 0.8518 | 16 | 154 | 3.30.460.10 |
| af_L7N672_164_416_1.10.3090.10 | Mainly Alpha;Orthogonal Bundle;cca-adding enzyme, domain 2;cca-adding enzyme, domain 2 | 0.8496 | 159 | 399 | 1.10.3090.10 |
| af_Q2G256_1_109_3.30.460.10 | Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 | 0.8408 | 49 | 160 | 3.30.460.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6J6S3A9-F1-model_v4 | Unannotated protein | 0.955 | 304 | 460 |
|
| AF-T0YJW9-F1-model_v4 | tRNA nucleotidyltransferase | 0.9389 | 91 | 233 |
GO:0000049
GO:0000166 GO:0008033 GO:0016779 |
| AF-A0A6C9EIU9-F1-model_v4 | CCA tRNA nucleotidyltransferase | 0.9296 | 25 | 233 |
GO:0000049
GO:0000166 GO:0008033 GO:0016779 |
| AF-A0A379FIU2-F1-model_v4 | Poly(A) polymerase I (EC 2.7.7.19) | 0.9168 | 116 | 206 |
GO:0003723
GO:0006396 GO:1990817 |
| AF-A0A1V4R8V1-F1-model_v4 | Poly A polymerase head domain-containing protein | 0.9162 | 35 | 233 |
GO:0000166
GO:0001680 GO:0003723 GO:0016779 |