F333172

General Info

Members Datasets Scaffolds Average Seq Length
221 126 221 236

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100096692|Ga0068855_1000966923
Length 272
Sequence MGYTSNDVSIPLSLLPPVQRRYTMPMHPFTILLIAACATVATFIGGSLALRLRDKLHLILGFSAGAVIAVAFFDLLPESLELGSAYHSIATMLTYTALGFFAYTVLDRFVTLHTHQDDADDEVHMHGTPKRAVVGAGSLSGHSFLDGFAIGLAFQASAAVGAIVAVAVLTHDFSDGINTVNLVLKNGGTRAQAFRWLIADAFAPLLGAAATLFIHVQGGTLSIILAIFAGFFLYIGASDLLPESHHSHPKALTTILTLCGAAVLYIAIHIAG

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
16 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
23 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
24 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
28 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
40 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
41 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
66 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
67 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
68 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
69 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
70 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
71 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
72 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
73 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
74 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
75 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
76 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
77 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
78 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
79 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
80 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
81 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
82 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
83 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
84 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
85 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
86 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
87 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
88 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
89 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
91 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
92 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
93 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
94 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
95 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
96 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
97 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
98 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
99 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
100 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
101 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
102 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
103 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
104 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
105 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
106 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
107 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
108 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
109 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
118 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
119 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
120 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
121 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
122 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
123 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
124 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
125 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
126 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.45
Nodule 0
Rhizoplane 0
Rhizosphere 96.38
Stem 0
Stem Tuber 0
Unclassified 3.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100118252 3300005329 Bacteria 2503
2 Ga0070680_100069873 3300005336 Bacteria 2884
3 Ga0070680_100182054 3300005336 Bacteria 1770
4 Ga0070691_10002845 3300005341 Bacteria 7743
5 Ga0070668_100563663 3300005347 Bacteria 993
6 Ga0070671_100006474 3300005355 Bacteria 9363
7 Ga0070709_10001059 3300005434 Bacteria 15182
8 Ga0070713_100000003 3300005436 Bacteria 245840
9 Ga0070711_100037955 3300005439 Bacteria 3235
10 Ga0070711_100075263 3300005439 Bacteria 2390
11 Ga0070694_100322484 3300005444 Unclassified 1189
12 Ga0070681_10131312 3300005458 Bacteria 2437
13 Ga0070707_100000666 3300005468 Bacteria 34121
14 Ga0070707_100047953 3300005468 Bacteria 4091
15 Ga0070707_100468176 3300005468 Bacteria 1221
16 Ga0070699_100785514 3300005518 Bacteria 871
17 Ga0070679_100017395 3300005530 Bacteria 6958
18 Ga0070679_100026778 3300005530 Bacteria 5671
19 Ga0070679_100062060 3300005530 Bacteria 3725
20 Ga0070679_100102961 3300005530 Bacteria 2841
21 Ga0070679_100142461 3300005530 Bacteria 2376
22 Ga0068853_100000937 3300005539 Bacteria 20429
23 Ga0070686_100027840 3300005544 Bacteria 3423
24 Ga0070686_100225171 3300005544 Bacteria 1357
25 Ga0070695_100017033 3300005545 Bacteria 4408
26 Ga0070695_100290467 3300005545 Bacteria 1205
27 Ga0068855_100036754 3300005563 Bacteria 5827
28 Ga0068855_100096692 3300005563 Bacteria 3402
29 Ga0068855_100602584 3300005563 Bacteria 1184
30 Ga0068854_100376872 3300005578 Bacteria 1168
31 Ga0068856_100001293 3300005614 Bacteria 26357
32 Ga0068856_100007470 3300005614 Bacteria 10670
33 Ga0068856_100009477 3300005614 Bacteria 9454
34 Ga0068856_100043950 3300005614 Bacteria 4395
35 Ga0068856_100090198 3300005614 Bacteria 3049
36 Ga0068856_100648474 3300005614 Bacteria 1076
37 Ga0068852_100044831 3300005616 Bacteria 3759
38 Ga0068852_100354409 3300005616 Bacteria 1434
39 Ga0068860_100000180 3300005843 Bacteria 102463
40 Ga0068860_100365283 3300005843 Bacteria 1423
41 Ga0068862_100251424 3300005844 Bacteria 1611
42 Ga0070712_100020009 3300006175 Bacteria 4376
43 Ga0070712_100060176 3300006175 Bacteria 2677
44 Ga0097621_100320889 3300006237 Bacteria 1372
45 Ga0068871_100061632 3300006358 Bacteria 3064
46 Ga0075434_100038444 3300006871 Bacteria 4740
47 Ga0075436_100000023 3300006914 Bacteria 116796
48 Ga0075436_100011485 3300006914 Bacteria 6079
49 Ga0075435_100054716 3300007076 Bacteria 3222
50 Ga0105240_10000017 3300009093 Bacteria 440317
51 Ga0105240_10000287 3300009093 Bacteria 98443
52 Ga0105240_10000874 3300009093 Bacteria 54221
53 Ga0105240_10000890 3300009093 Bacteria 53588
54 Ga0105240_10010987 3300009093 Bacteria 12678
55 Ga0105240_10302017 3300009093 Bacteria 1831
56 Ga0114129_10282648 3300009147 Unclassified 2217
57 Ga0105241_10105611 3300009174 Bacteria 2246
58 Ga0105241_10122853 3300009174 Bacteria 2093
59 Ga0105241_10195056 3300009174 Bacteria 1688
60 Ga0105237_10017704 3300009545 Bacteria 7385
61 Ga0105237_10127144 3300009545 Bacteria 2543
62 Ga0105238_10006836 3300009551 Bacteria 11387
63 Ga0105238_10073241 3300009551 Bacteria 3421
64 Ga0105238_10212342 3300009551 Bacteria 1911
65 Ga0105239_10022349 3300010375 Bacteria 6974
66 Ga0105239_10058284 3300010375 Bacteria 4237
67 Ga0105239_10081216 3300010375 Bacteria 3568
68 Ga0105239_10204230 3300010375 Bacteria 2214
69 Ga0157373_10011891 3300013100 Bacteria 6394
70 Ga0157370_10005670 3300013104 Bacteria 13955
71 Ga0157369_10036941 3300013105 Bacteria 5350
72 Ga0157369_10236555 3300013105 Bacteria 1908
73 Ga0157374_10330478 3300013296 Bacteria 1512
74 Ga0157379_10005410 3300014968 Bacteria 10965
75 Ga0157379_10271119 3300014968 Unclassified 1543
76 Ga0213872_10157884 3300021361 Bacteria 988
77 Ga0207699_10000126 3300025906 Bacteria 53299
78 Ga0207684_10347823 3300025910 Bacteria 1276
79 Ga0207654_10050416 3300025911 Unclassified 2392
80 Ga0207654_10339220 3300025911 Bacteria 1032
81 Ga0207695_10000079 3300025913 Bacteria 295339
82 Ga0207695_10001118 3300025913 Bacteria 46598
83 Ga0207695_10002816 3300025913 Bacteria 25264
84 Ga0207695_10003980 3300025913 Bacteria 20388
85 Ga0207695_10031331 3300025913 Bacteria 5834
86 Ga0207695_10082248 3300025913 Bacteria 3257
87 Ga0207695_10470569 3300025913 Bacteria 1139
88 Ga0207671_10013360 3300025914 Bacteria 6542
89 Ga0207671_10080851 3300025914 Bacteria 2436
90 Ga0207693_10055546 3300025915 Bacteria 3106
91 Ga0207663_10059544 3300025916 Bacteria 2416
92 Ga0207663_10098022 3300025916 Bacteria 1962
93 Ga0207660_10050550 3300025917 Bacteria 2952
94 Ga0207660_10181126 3300025917 Bacteria 1636
95 Ga0207652_10012094 3300025921 Bacteria 6968
96 Ga0207652_10272496 3300025921 Bacteria 1527
97 Ga0207652_10274533 3300025921 Bacteria 1520
98 Ga0207646_10001010 3300025922 Bacteria 36016
99 Ga0207646_10148753 3300025922 Bacteria 2111
100 Ga0207646_10466848 3300025922 Bacteria 1138
101 Ga0207694_10017261 3300025924 Bacteria 5455
102 Ga0207694_10348623 3300025924 Bacteria 1225
103 Ga0207700_10000010 3300025928 Bacteria 298473
104 Ga0207664_10639320 3300025929 Unclassified 956
105 Ga0207644_10001538 3300025931 Bacteria 14857
106 Ga0207667_10006962 3300025949 Bacteria 13669
107 Ga0207667_10020762 3300025949 Bacteria 7296
108 Ga0207667_10052887 3300025949 Bacteria 4275
109 Ga0207667_10079623 3300025949 Bacteria 3396
110 Ga0207667_10334595 3300025949 Unclassified 1546
111 Ga0207668_10512975 3300025972 Bacteria 1033
112 Ga0207640_10060769 3300025981 Bacteria 2500
113 Ga0207640_10082530 3300025981 Bacteria 2201
114 Ga0207703_10028227 3300026035 Bacteria 4422
115 Ga0207703_10177270 3300026035 Bacteria 1879
116 Ga0207639_10119069 3300026041 Bacteria 2166
117 Ga0207678_10478406 3300026067 Bacteria 1084
118 Ga0207702_10000013 3300026078 Bacteria 257468
119 Ga0207702_10011493 3300026078 Bacteria 7376
120 Ga0207702_10022560 3300026078 Bacteria 5219
121 Ga0207702_10075659 3300026078 Bacteria 2909
122 Ga0207702_10076853 3300026078 Bacteria 2886
123 Ga0207702_10259872 3300026078 Bacteria 1634
124 Ga0207641_10417609 3300026088 Bacteria 1291
125 Ga0207698_10047311 3300026142 Bacteria 3257
126 Ga0207698_10362362 3300026142 Bacteria 1373
127 Ga0268264_10000259 3300028381 Bacteria 95725
128 Ga0268264_10362592 3300028381 Bacteria 1383
129 Ga0265337_1008581 3300028556 Bacteria 3702
130 Ga0265337_1030565 3300028556 Bacteria 1603
131 Ga0265334_10000170 3300028573 Bacteria 39146
132 Ga0265334_10002167 3300028573 Bacteria 9244
133 Ga0265318_10039421 3300028577 Bacteria 1802
134 Ga0265318_10056739 3300028577 Bacteria 1464
135 Ga0265318_10104377 3300028577 Unclassified 1042
136 Ga0265336_10000018 3300028666 Bacteria 221454
137 Ga0265338_10000002 3300028800 Bacteria 856588
138 Ga0265338_10000262 3300028800 Bacteria 95766
139 Ga0265338_10001307 3300028800 Bacteria 40817
140 Ga0265338_10001677 3300028800 Bacteria 35195
141 Ga0265338_10005393 3300028800 Bacteria 16706
142 Ga0265338_10026097 3300028800 Bacteria 5905
143 Ga0265338_10040815 3300028800 Bacteria 4353
144 Ga0265338_10057477 3300028800 Bacteria 3441
145 Ga0265338_10064941 3300028800 Unclassified 3170
146 Ga0265338_10104238 3300028800 Unclassified 2302
147 Ga0265338_10150460 3300028800 Bacteria 1809
148 Ga0265332_10040643 3300031238 Bacteria 2013
149 Ga0265320_10000217 3300031240 Bacteria 46656
150 Ga0265320_10126402 3300031240 Unclassified 1163
151 Ga0265320_10176911 3300031240 Bacteria 957
152 Ga0265325_10005000 3300031241 Bacteria 8254
153 Ga0265340_10000444 3300031247 Bacteria 22306
154 Ga0265339_10145934 3300031249 Unclassified 1200
155 Ga0265331_10021102 3300031250 Bacteria 3337
156 Ga0265327_10006011 3300031251 Bacteria 9870
157 Ga0265327_10023045 3300031251 Bacteria 3700
158 Ga0265316_10047646 3300031344 Bacteria 3389
159 Ga0307513_10120891 3300031456 Bacteria 2587
160 Ga0265313_10002986 3300031595 Bacteria 14106
161 Ga0265313_10011066 3300031595 Bacteria 5628
162 Ga0265313_10035408 3300031595 Bacteria 2515
163 Ga0265313_10050662 3300031595 Bacteria 1990
164 Ga0265314_10005228 3300031711 Bacteria 11765
165 Ga0265314_10025001 3300031711 Bacteria 4515
166 Ga0265342_10019801 3300031712 Bacteria 4329
167 Ga0265342_10030676 3300031712 Bacteria 3330
168 Ga0265342_10182576 3300031712 Unclassified 1148
169 Ga0373940_0086807 3300035088 Bacteria 932
170 Ga0373953_0082762 3300035117 Bacteria 1336
171 Ga0373956_0250236 3300035119 Bacteria 842
172 Ga0373931_0019678 3300035691 Bacteria 3372
173 Ga0373935_0070151 3300035692 Bacteria 2258
174 Ga0373935_0328355 3300035692 Bacteria 1087
175 Ga0373935_0495023 3300035692 Bacteria 887
176 Ga0373927_0327510 3300035695 Unclassified 1009
177 Ga0373933_0060198 3300035724 Unclassified 2289
178 Ga0373937_0085861 3300036401 Bacteria 2912
179 Ga0373925_0211720 3300037068 Bacteria 1544
180 Ga0436364_1079611 3300037853 Unclassified 957
181 Ga0436365_0312840 3300039437 Bacteria 2582
182 Ga0436365_1126912 3300039437 Bacteria 1490
183 Ga0436361_0816739 3300039447 Bacteria 5165
184 Ga0436363_0899190 3300039450 Bacteria 6877
185 Ga0451577_0075987 3300042876 Bacteria 2995
186 Ga0466966_0178015 3300044684 Bacteria 1291
187 Ga0453684_0000030 3300044712 Bacteria 752725
188 Ga0453684_0104035 3300044712 Bacteria 3467
189 Ga0451576_0000595 3300045051 Bacteria 76200
190 Ga0451576_0008077 3300045051 Bacteria 12408
191 Ga0451576_0426103 3300045051 Bacteria 1392
192 Ga0495629_0185148 3300046459 Bacteria 1442
193 Ga0495653_0432773 3300046463 Bacteria 831
194 Ga0495580_0231398 3300046472 Bacteria 1269
195 Ga0495582_0046794 3300046473 Bacteria 2383
196 Ga0495628_0251727 3300046516 Bacteria 1319
197 Ga0495657_0229369 3300046675 Bacteria 1124
198 Ga0495658_0019496 3300046683 Bacteria 3541
199 Ga0495680_0036999 3300047322 Bacteria 3912
200 Ga0495684_0050012 3300047471 Bacteria 3193
201 Ga0496126_0086991 3300048929 Unclassified 2754
202 Ga0496126_0198627 3300048929 Unclassified 1695
203 Ga0501032_0003601 3300049569 Bacteria 11798
204 Ga0501033_0049015 3300049570 Bacteria 3136
205 Ga0501034_0133566 3300049571 Unclassified 2464
206 Ga0501037_0000097 3300049573 Bacteria 81627
207 Ga0501039_0001173 3300049575 Bacteria 19206
208 Ga0501040_0000953 3300049576 Bacteria 18278
209 Ga0501043_0000001 3300049579 Bacteria 479879
210 Ga0501047_0211866 3300049581 Bacteria 1796
211 Ga0501068_0193959 3300049584 Bacteria 1287
212 Ga0501074_0014556 3300049590 Bacteria 5723
213 Ga0501080_0006418 3300049742 Bacteria 10553
214 Ga0501045_0009269 3300049824 Bacteria 6884
215 nmdc:mga0n895_35821_c1 3300050512 Bacteria 4788
216 nmdc:mga0rr50_210718_c1 3300050513 Bacteria 1601
217 nmdc:mga08x19_50_c1 3300050514 Bacteria 129410
218 nmdc:mga08x19_66985_c1 3300050514 Unclassified 2335
219 Ga0495595_0008101 3300053084 Bacteria 4309
220 Ga0500556_0000641 3300053104 Bacteria 21900
221 Ga0501084_0380938 3300054114 Bacteria 1192

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035119 Ga0373956_0250236 Ga0373956_0250236_231_830 184
2 3300031250 Ga0265331_10021102 Ga0265331_100211022 196
3 3300031595 Ga0265313_10035408 Ga0265313_100354083 196
4 3300005614 Ga0068856_100090198 Ga0068856_1000901982 205
5 3300026078 Ga0207702_10022560 Ga0207702_100225606 205
6 3300006175 Ga0070712_100060176 Ga0070712_1000601762 208
7 3300005355 Ga0070671_100006474 Ga0070671_10000647415 209
8 3300025931 Ga0207644_10001538 Ga0207644_1000153822 209
9 3300031240 Ga0265320_10000217 Ga0265320_1000021730 209
10 3300031241 Ga0265325_10005000 Ga0265325_100050008 209
11 3300028577 Ga0265318_10056739 Ga0265318_100567391 210
12 3300009551 Ga0105238_10212342 Ga0105238_102123421 211
13 3300049584 Ga0501068_0193959 Ga0501068_0193959_497_1228 211
14 3300021361 Ga0213872_10157884 Ga0213872_101578842 212
15 3300035724 Ga0373933_0060198 Ga0373933_0060198_1593_2279 213
16 3300035692 Ga0373935_0328355 Ga0373935_0328355_119_856 215
17 3300037068 Ga0373925_0211720 Ga0373925_0211720_194_931 215
18 3300046459 Ga0495629_0185148 Ga0495629_0185148_102_839 215
19 3300046473 Ga0495582_0046794 Ga0495582_0046794_81_818 215
20 3300046683 Ga0495658_0019496 Ga0495658_0019496_767_1504 215
21 3300047471 Ga0495684_0050012 Ga0495684_0050012_1222_1959 215
22 3300035692 Ga0373935_0495023 Ga0373935_0495023_54_740 216
23 3300005468 Ga0070707_100047953 Ga0070707_1000479534 218
24 3300025922 Ga0207646_10148753 Ga0207646_101487532 218
25 3300031595 Ga0265313_10011066 Ga0265313_100110668 218
26 3300048929 Ga0496126_0198627 Ga0496126_0198627_593_1327 218
27 3300049581 Ga0501047_0211866 Ga0501047_0211866_1002_1772 219
28 3300053104 Ga0500556_0000641 Ga0500556_0000641_16856_17626 219
29 3300025910 Ga0207684_10347823 Ga0207684_103478232 220
30 3300005544 Ga0070686_100027840 Ga0070686_1000278402 221
31 3300025915 Ga0207693_10055546 Ga0207693_100555462 221
32 3300039437 Ga0436365_0312840 Ga0436365_0312840_790_1476 223
33 3300005336 Ga0070680_100182054 Ga0070680_1001820542 224
34 3300005341 Ga0070691_10002845 Ga0070691_100028459 224
35 3300005518 Ga0070699_100785514 Ga0070699_1007855141 224
36 3300005545 Ga0070695_100017033 Ga0070695_1000170333 224
37 3300005616 Ga0068852_100044831 Ga0068852_1000448313 224
38 3300009093 Ga0105240_10010987 Ga0105240_100109877 224
39 3300009174 Ga0105241_10105611 Ga0105241_101056112 224
40 3300009545 Ga0105237_10017704 Ga0105237_100177042 224
41 3300009551 Ga0105238_10006836 Ga0105238_100068365 224
42 3300010375 Ga0105239_10058284 Ga0105239_100582844 224
43 3300013104 Ga0157370_10005670 Ga0157370_100056709 224
44 3300013296 Ga0157374_10330478 Ga0157374_103304782 224
45 3300025911 Ga0207654_10050416 Ga0207654_100504163 224
46 3300025913 Ga0207695_10031331 Ga0207695_100313315 224
47 3300025914 Ga0207671_10013360 Ga0207671_100133605 224
48 3300025917 Ga0207660_10181126 Ga0207660_101811262 224
49 3300025924 Ga0207694_10348623 Ga0207694_103486232 224
50 3300025949 Ga0207667_10006962 Ga0207667_100069628 224
51 3300025981 Ga0207640_10082530 Ga0207640_100825302 224
52 3300026035 Ga0207703_10177270 Ga0207703_101772702 224
53 3300026041 Ga0207639_10119069 Ga0207639_101190692 224
54 3300026142 Ga0207698_10047311 Ga0207698_100473112 224
55 3300028800 Ga0265338_10026097 Ga0265338_100260975 224
56 3300031240 Ga0265320_10126402 Ga0265320_101264021 224
57 3300031711 Ga0265314_10025001 Ga0265314_100250016 224
58 3300005539 Ga0068853_100000937 Ga0068853_10000093716 225
59 3300005614 Ga0068856_100001293 Ga0068856_10000129327 225
60 3300013105 Ga0157369_10236555 Ga0157369_102365552 225
61 3300014968 Ga0157379_10271119 Ga0157379_102711191 225
62 3300025913 Ga0207695_10470569 Ga0207695_104705692 225
63 3300026078 Ga0207702_10011493 Ga0207702_100114935 225
64 3300028800 Ga0265338_10057477 Ga0265338_100574771 225
65 3300028800 Ga0265338_10064941 Ga0265338_100649415 225
66 3300039450 Ga0436363_0899190 Ga0436363_0899190_4071_4787 225
67 3300005563 Ga0068855_100036754 Ga0068855_1000367543 226
68 3300009093 Ga0105240_10000287 Ga0105240_100002872 226
69 3300009093 Ga0105240_10000874 Ga0105240_1000087437 226
70 3300025913 Ga0207695_10001118 Ga0207695_1000111840 226
71 3300025913 Ga0207695_10002816 Ga0207695_1000281617 226
72 3300025949 Ga0207667_10334595 Ga0207667_103345952 226
73 3300005434 Ga0070709_10001059 Ga0070709_100010594 227
74 3300005436 Ga0070713_100000003 Ga0070713_100000003233 227
75 3300005439 Ga0070711_100037955 Ga0070711_1000379552 227
76 3300005444 Ga0070694_100322484 Ga0070694_1003224842 227
77 3300005530 Ga0070679_100142461 Ga0070679_1001424611 227
78 3300005614 Ga0068856_100007470 Ga0068856_1000074702 227
79 3300006175 Ga0070712_100020009 Ga0070712_1000200094 227
80 3300006871 Ga0075434_100038444 Ga0075434_1000384444 227
81 3300006914 Ga0075436_100000023 Ga0075436_10000002386 227
82 3300006914 Ga0075436_100011485 Ga0075436_1000114855 227
83 3300007076 Ga0075435_100054716 Ga0075435_1000547162 227
84 3300025906 Ga0207699_10000126 Ga0207699_1000012637 227
85 3300025916 Ga0207663_10098022 Ga0207663_100980222 227
86 3300025928 Ga0207700_10000010 Ga0207700_10000010106 227
87 3300026078 Ga0207702_10000013 Ga0207702_10000013181 227
88 3300026088 Ga0207641_10417609 Ga0207641_104176091 227
89 3300028577 Ga0265318_10104377 Ga0265318_101043772 227
90 3300028800 Ga0265338_10040815 Ga0265338_100408152 227
91 3300031712 Ga0265342_10182576 Ga0265342_101825762 227
92 3300035088 Ga0373940_0086807 Ga0373940_0086807_22_756 227
93 3300035691 Ga0373931_0019678 Ga0373931_0019678_86_820 227
94 3300035692 Ga0373935_0070151 Ga0373935_0070151_188_922 227
95 3300035695 Ga0373927_0327510 Ga0373927_0327510_102_836 227
96 3300036401 Ga0373937_0085861 Ga0373937_0085861_101_835 227
97 3300044684 Ga0466966_0178015 Ga0466966_0178015_61_786 227
98 3300044712 Ga0453684_0000030 Ga0453684_0000030_694457_695185 227
99 3300050512 nmdc:mga0n895_35821_c1 nmdc:mga0n895_35821_c1_683_1417 227
100 3300050513 nmdc:mga0rr50_210718_c1 nmdc:mga0rr50_210718_c1_628_1362 227
101 3300050514 nmdc:mga08x19_50_c1 nmdc:mga08x19_50_c1_43281_44015 227
102 3300050514 nmdc:mga08x19_66985_c1 nmdc:mga08x19_66985_c1_92_826 227
103 3300009093 Ga0105240_10000890 Ga0105240_1000089028 228
104 3300009545 Ga0105237_10127144 Ga0105237_101271442 228
105 3300010375 Ga0105239_10081216 Ga0105239_100812163 228
106 3300010375 Ga0105239_10204230 Ga0105239_102042303 228
107 3300025913 Ga0207695_10003980 Ga0207695_100039805 228
108 3300025914 Ga0207671_10080851 Ga0207671_100808512 228
109 3300025929 Ga0207664_10639320 Ga0207664_106393202 228
110 3300028556 Ga0265337_1008581 Ga0265337_10085812 228
111 3300028666 Ga0265336_10000018 Ga0265336_10000018146 228
112 3300028800 Ga0265338_10001307 Ga0265338_100013072 228
113 3300028800 Ga0265338_10001677 Ga0265338_1000167729 228
114 3300031595 Ga0265313_10050662 Ga0265313_100506623 228
115 3300031712 Ga0265342_10030676 Ga0265342_100306765 228
116 3300042876 Ga0451577_0075987 Ga0451577_0075987_1642_2361 228
117 3300044712 Ga0453684_0104035 Ga0453684_0104035_942_1661 228
118 3300046472 Ga0495580_0231398 Ga0495580_0231398_22_747 228
119 3300048929 Ga0496126_0086991 Ga0496126_0086991_1262_1993 228
120 3300049571 Ga0501034_0133566 Ga0501034_0133566_1175_1894 228
121 3300005336 Ga0070680_100069873 Ga0070680_1000698733 229
122 3300005439 Ga0070711_100075263 Ga0070711_1000752632 229
123 3300005458 Ga0070681_10131312 Ga0070681_101313123 229
124 3300005468 Ga0070707_100468176 Ga0070707_1004681762 229
125 3300005530 Ga0070679_100017395 Ga0070679_1000173957 229
126 3300005544 Ga0070686_100225171 Ga0070686_1002251712 229
127 3300005545 Ga0070695_100290467 Ga0070695_1002904672 229
128 3300005614 Ga0068856_100009477 Ga0068856_1000094772 229
129 3300005614 Ga0068856_100043950 Ga0068856_1000439503 229
130 3300009093 Ga0105240_10000017 Ga0105240_10000017406 229
131 3300009174 Ga0105241_10195056 Ga0105241_101950562 229
132 3300009551 Ga0105238_10073241 Ga0105238_100732412 229
133 3300014968 Ga0157379_10005410 Ga0157379_100054105 229
134 3300025913 Ga0207695_10000079 Ga0207695_10000079160 229
135 3300025916 Ga0207663_10059544 Ga0207663_100595442 229
136 3300025917 Ga0207660_10050550 Ga0207660_100505503 229
137 3300025921 Ga0207652_10012094 Ga0207652_100120946 229
138 3300025924 Ga0207694_10017261 Ga0207694_100172612 229
139 3300025949 Ga0207667_10020762 Ga0207667_100207626 229
140 3300026035 Ga0207703_10028227 Ga0207703_100282275 229
141 3300026078 Ga0207702_10075659 Ga0207702_100756593 229
142 3300026078 Ga0207702_10076853 Ga0207702_100768532 229
143 3300028573 Ga0265334_10002167 Ga0265334_100021673 229
144 3300028577 Ga0265318_10039421 Ga0265318_100394212 229
145 3300028800 Ga0265338_10000002 Ga0265338_10000002398 229
146 3300028800 Ga0265338_10005393 Ga0265338_1000539318 229
147 3300028800 Ga0265338_10150460 Ga0265338_101504602 229
148 3300031238 Ga0265332_10040643 Ga0265332_100406431 229
149 3300031247 Ga0265340_10000444 Ga0265340_1000044432 229
150 3300031249 Ga0265339_10145934 Ga0265339_101459342 229
151 3300031251 Ga0265327_10006011 Ga0265327_100060119 229
152 3300031344 Ga0265316_10047646 Ga0265316_100476467 229
153 3300031595 Ga0265313_10002986 Ga0265313_100029863 229
154 3300031711 Ga0265314_10005228 Ga0265314_100052282 229
155 3300031712 Ga0265342_10019801 Ga0265342_100198013 229
156 3300045051 Ga0451576_0000595 Ga0451576_0000595_33076_33798 229
157 3300045051 Ga0451576_0008077 Ga0451576_0008077_5245_5973 229
158 3300049569 Ga0501032_0003601 Ga0501032_0003601_3958_4680 229
159 3300049573 Ga0501037_0000097 Ga0501037_0000097_67246_67968 229
160 3300049575 Ga0501039_0001173 Ga0501039_0001173_6081_6803 229
161 3300049576 Ga0501040_0000953 Ga0501040_0000953_10656_11378 229
162 3300049579 Ga0501043_0000001 Ga0501043_0000001_78462_79184 229
163 3300049824 Ga0501045_0009269 Ga0501045_0009269_3131_3853 229
164 3300005347 Ga0070668_100563663 Ga0070668_1005636631 230
165 3300005843 Ga0068860_100000180 Ga0068860_100000180121 230
166 3300005843 Ga0068860_100365283 Ga0068860_1003652832 230
167 3300005844 Ga0068862_100251424 Ga0068862_1002514243 230
168 3300025972 Ga0207668_10512975 Ga0207668_105129752 230
169 3300026067 Ga0207678_10478406 Ga0207678_104784061 230
170 3300028381 Ga0268264_10000259 Ga0268264_1000025953 230
171 3300028381 Ga0268264_10362592 Ga0268264_103625922 230
172 3300028556 Ga0265337_1030565 Ga0265337_10305652 230
173 3300028800 Ga0265338_10104238 Ga0265338_101042383 230
174 3300031240 Ga0265320_10176911 Ga0265320_101769112 230
175 3300039447 Ga0436361_0816739 Ga0436361_0816739_1885_2622 230
176 3300045051 Ga0451576_0426103 Ga0451576_0426103_139_852 230
177 3300049590 Ga0501074_0014556 Ga0501074_0014556_2918_3646 230
178 3300049742 Ga0501080_0006418 Ga0501080_0006418_1026_1754 230
179 3300054114 Ga0501084_0380938 Ga0501084_0380938_261_998 230
180 3300028800 Ga0265338_10000262 Ga0265338_1000026268 231
181 3300049570 Ga0501033_0049015 Ga0501033_0049015_1201_1926 231
182 3300005468 Ga0070707_100000666 Ga0070707_10000066623 232
183 3300005530 Ga0070679_100102961 Ga0070679_1001029611 232
184 3300005563 Ga0068855_100096692 Ga0068855_1000966923 232
185 3300006237 Ga0097621_100320889 Ga0097621_1003208892 232
186 3300006358 Ga0068871_100061632 Ga0068871_1000616322 232
187 3300025922 Ga0207646_10001010 Ga0207646_1000101023 232
188 3300025949 Ga0207667_10052887 Ga0207667_100528877 232
189 3300005530 Ga0070679_100062060 Ga0070679_1000620602 233
190 3300025921 Ga0207652_10272496 Ga0207652_102724962 233
191 3300031251 Ga0265327_10023045 Ga0265327_100230452 233
192 3300035117 Ga0373953_0082762 Ga0373953_0082762_345_1064 234
193 3300037853 Ga0436364_1079611 Ga0436364_1079611_101_820 234
194 3300039437 Ga0436365_1126912 Ga0436365_1126912_257_976 234
195 3300046463 Ga0495653_0432773 Ga0495653_0432773_11_730 234
196 3300046516 Ga0495628_0251727 Ga0495628_0251727_466_1185 234
197 3300046675 Ga0495657_0229369 Ga0495657_0229369_336_1055 234
198 3300047322 Ga0495680_0036999 Ga0495680_0036999_143_862 234
199 3300053084 Ga0495595_0008101 Ga0495595_0008101_2957_3676 234
200 3300005329 Ga0070683_100118252 Ga0070683_1001182522 235
201 3300005530 Ga0070679_100026778 Ga0070679_1000267785 235
202 3300005563 Ga0068855_100602584 Ga0068855_1006025841 235
203 3300005578 Ga0068854_100376872 Ga0068854_1003768721 235
204 3300005614 Ga0068856_100648474 Ga0068856_1006484742 235
205 3300005616 Ga0068852_100354409 Ga0068852_1003544092 235
206 3300009093 Ga0105240_10302017 Ga0105240_103020171 235
207 3300009147 Ga0114129_10282648 Ga0114129_102826482 235
208 3300009174 Ga0105241_10122853 Ga0105241_101228532 235
209 3300010375 Ga0105239_10022349 Ga0105239_100223497 235
210 3300013100 Ga0157373_10011891 Ga0157373_100118915 235
211 3300013105 Ga0157369_10036941 Ga0157369_100369414 235
212 3300025911 Ga0207654_10339220 Ga0207654_103392201 235
213 3300025913 Ga0207695_10082248 Ga0207695_100822484 235
214 3300025921 Ga0207652_10274533 Ga0207652_102745332 235
215 3300025922 Ga0207646_10466848 Ga0207646_104668481 235
216 3300025949 Ga0207667_10079623 Ga0207667_100796233 235
217 3300025981 Ga0207640_10060769 Ga0207640_100607692 235
218 3300026078 Ga0207702_10259872 Ga0207702_102598722 235
219 3300026142 Ga0207698_10362362 Ga0207698_103623621 235
220 3300028573 Ga0265334_10000170 Ga0265334_1000017023 235
221 3300031456 Ga0307513_10120891 Ga0307513_101208914 235

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02535

Zip

ZIP Zinc transporter

112

267

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5tsa-assembly1.cif.gz_A crystal structure of the zrt-/irt-like protein from bordetella bronchiseptica with bound zn2+ 0.7715 3 234
7z6n-assembly1.cif.gz_A crystal structure of zn2+-transporter bbzip in a metal-stripped state 0.7649 3 234
7z6m-assembly1.cif.gz_A-2 crystal structure of zn2+-transporter bbzip in a cadmium bound state 0.7642 3 234
7z6n-assembly1.cif.gz_A crystal structure of zn2+-transporter bbzip in a metal-stripped state 0.7541 3 234
7z6m-assembly1.cif.gz_A-2 crystal structure of zn2+-transporter bbzip in a cadmium bound state 0.7499 3 234
ID Description Score Start End Superfamily
af_A0A1D6LG81_81_254_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4282 30 234 1.20.1250.20
af_O00624_273_439_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.416 30 179 1.20.1250.20
af_Q9C7Z2_46_177_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.4112 46 180 1.20.140.40
af_P21145_18_145_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.3979 27 149 1.20.140.150
af_Q8I4F6_299_497_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3905 28 206 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A2A4HU81-F1-model_v4 Permease 0.9601 3 234 GO:0005385
GO:0012505
GO:0016020
AF-A0A7W1N6P8-F1-model_v4 ZIP family metal transporter 0.9502 2 234 GO:0005385
GO:0016020
AF-A0A511Q011-F1-model_v4 deleted 0.9482 2 234
AF-A0A7W1N6P8-F1-model_v4 ZIP family metal transporter 0.9345 2 234 GO:0005385
GO:0016020
AF-A0A536Q2J1-F1-model_v4 Permease 0.9337 2 234 GO:0016020
GO:0046873

Feature Viewer

pLDDT pTM Quality
86.94 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map