F332908

General Info

Members Datasets Scaffolds Average Seq Length
221 168 442 229

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10176459|rootH1_101764592
Length 261
Sequence MGAAGAPDARLAGLSSMATRAILAELAQKYEGATGQQVSFLSVGGVDAARRVREGESFDVVVLARDSIDALVAAGHLAGESVTDLARSGVAVAVPAGAARPDVGSEAALKDAVLQARSIGYSTGPSGVALAKLFEAWGLGEVLKGRTVIALPGVPVADLVARAEVALGFQQLSEMMNVDGIDVVGPLPPSLDIVTTFSGAVGVRSGRPAAAGELLRFLASPAADEAKRRRGMEPARPPDAGHEETRPGARPERDRSGHDGA

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
48 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
77 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
78 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
79 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
80 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
81 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
82 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
83 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
84 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
85 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
86 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
87 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
88 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
89 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
90 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
91 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
94 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
95 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
101 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
102 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
103 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
104 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
105 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
106 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
107 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
108 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
109 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
110 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
111 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
112 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
113 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
114 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
115 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
116 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
117 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
118 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
119 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
120 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
121 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
122 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
123 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
124 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
125 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
126 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
127 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
128 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
129 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
130 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
131 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
132 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
133 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
134 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
135 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
136 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
137 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
138 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
139 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
140 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
141 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
142 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
143 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
146 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
147 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
148 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
150 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
151 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
152 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
153 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
154 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
155 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
156 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
157 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
158 2547132374 Acidovorax radicis N35 Isolate Unclassified
159 2643221570 Acidovorax sp. Root568 Isolate Unclassified
160 2643221596 Acidovorax sp. Root70 Isolate Unclassified
161 2643221611 Acidovorax sp. Root219 Isolate Unclassified
162 2643221652 Acidovorax sp. Root402 Isolate Unclassified
163 2643221717 Acidovorax sp. Root267 Isolate Unclassified
164 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
165 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
166 2816332133 Acidovorax radicis 2721A Isolate Unclassified
167 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
168 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.12
Metatranscriptomes 0
Isolates 5.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.07
Nodule 1.36
Rhizoplane 0.9
Rhizosphere 83.71
Stem 0
Stem Tuber 0
Unclassified 1.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10176459 3300003323 Bacteria 2667
2 Ga0065165_1006811 3300005262 Bacteria 5830
3 Ga0070658_10000534 3300005327 Bacteria 33047
4 Ga0070658_10024424 3300005327 Bacteria 4848
5 Ga0070658_10037808 3300005327 Bacteria 3892
6 Ga0070683_100004088 3300005329 Bacteria 11961
7 Ga0070683_100005863 3300005329 Bacteria 10279
8 Ga0070683_100819452 3300005329 Unclassified 892
9 Ga0070666_10297873 3300005335 Bacteria 1148
10 Ga0070682_100044738 3300005337 Bacteria 2742
11 Ga0068868_100082529 3300005338 Bacteria 2578
12 Ga0068868_100100831 3300005338 Bacteria 2336
13 Ga0070692_10131916 3300005345 Bacteria 1405
14 Ga0070675_100227139 3300005354 Bacteria 1627
15 Ga0070675_100408561 3300005354 Bacteria 1212
16 Ga0070674_100012896 3300005356 Bacteria 5147
17 Ga0070674_100133379 3300005356 Bacteria 1855
18 Ga0070674_100585552 3300005356 Bacteria 941
19 Ga0070673_100016264 3300005364 Bacteria 5254
20 Ga0070673_100128664 3300005364 Bacteria 2122
21 Ga0070688_100037010 3300005365 Bacteria 2971
22 Ga0070688_100056573 3300005365 Bacteria 2463
23 Ga0070659_100168522 3300005366 Bacteria 1793
24 Ga0070659_100255556 3300005366 Bacteria 1453
25 Ga0070662_100103186 3300005457 Bacteria 2162
26 Ga0068867_100339698 3300005459 Bacteria 1250
27 Ga0070685_10034171 3300005466 Bacteria 2862
28 Ga0070684_100000578 3300005535 Bacteria 25373
29 Ga0070684_100004669 3300005535 Bacteria 10461
30 Ga0068853_100076004 3300005539 Bacteria 2932
31 Ga0070672_100011272 3300005543 Bacteria 6234
32 Ga0070665_100226155 3300005548 Bacteria 1871
33 Ga0068855_100010543 3300005563 Bacteria 11146
34 Ga0070664_100077578 3300005564 Bacteria 2856
35 Ga0068856_100252952 3300005614 Bacteria 1777
36 Ga0068852_100009549 3300005616 Bacteria 7208
37 Ga0068851_10032262 3300005834 Unclassified 2606
38 Ga0068858_100426477 3300005842 Bacteria 1276
39 Ga0068862_100633260 3300005844 Bacteria 1030
40 Ga0081539_10033135 3300005985 Bacteria 3152
41 Ga0075362_10024387 3300006177 Bacteria 2566
42 Ga0075366_10119640 3300006195 Bacteria 1587
43 Ga0068871_100652336 3300006358 Bacteria 961
44 Ga0075429_100026775 3300006880 Bacteria 5006
45 Ga0105240_10000369 3300009093 Bacteria 84513
46 Ga0105240_10011173 3300009093 Bacteria 12533
47 Ga0111539_10514869 3300009094 Bacteria 1394
48 Ga0105243_10792584 3300009148 Bacteria 933
49 Ga0105242_10034172 3300009176 Bacteria 4075
50 Ga0105237_10082720 3300009545 Bacteria 3201
51 Ga0105238_10001847 3300009551 Bacteria 21225
52 Ga0105238_10005281 3300009551 Bacteria 12773
53 Ga0105238_10008333 3300009551 Bacteria 10369
54 Ga0157371_10331773 3300013102 Bacteria 1105
55 Ga0157369_10000908 3300013105 Bacteria 37806
56 Ga0157374_10241084 3300013296 Bacteria 1778
57 Ga0157372_10001580 3300013307 Bacteria 24846
58 Ga0157375_10017978 3300013308 Bacteria 6401
59 Ga0163163_10064050 3300014325 Bacteria 3647
60 Ga0157377_10265745 3300014745 Bacteria 1118
61 Ga0157377_10480645 3300014745 Bacteria 864
62 Ga0157376_10027198 3300014969 Bacteria 4531
63 Ga0157376_10128942 3300014969 Bacteria 2254
64 Ga0183362_10002 3300015683 Bacteria 1432711
65 Ga0207656_10029269 3300025321 Bacteria 2267
66 Ga0207705_10019376 3300025909 Bacteria 4865
67 Ga0207705_10026384 3300025909 Bacteria 4143
68 Ga0207705_10069924 3300025909 Bacteria 2543
69 Ga0207695_10000923 3300025913 Bacteria 52620
70 Ga0207695_10260991 3300025913 Bacteria 1630
71 Ga0207671_10006455 3300025914 Bacteria 10440
72 Ga0207662_10045145 3300025918 Bacteria 2604
73 Ga0207652_10032624 3300025921 Bacteria 4380
74 Ga0207694_10031689 3300025924 Bacteria 4040
75 Ga0207694_10040984 3300025924 Bacteria 3568
76 Ga0207650_10243087 3300025925 Bacteria 1455
77 Ga0207690_10217865 3300025932 Bacteria 1459
78 Ga0207686_10006318 3300025934 Bacteria 6374
79 Ga0207669_10080708 3300025937 Bacteria 2081
80 Ga0207691_10005602 3300025940 Bacteria 12139
81 Ga0207691_10035421 3300025940 Bacteria 4633
82 Ga0207711_10218836 3300025941 Bacteria 1741
83 Ga0207661_10000444 3300025944 Bacteria 26690
84 Ga0207661_10003085 3300025944 Bacteria 11542
85 Ga0207661_10670717 3300025944 Unclassified 953
86 Ga0207667_10025544 3300025949 Bacteria 6465
87 Ga0207667_10214994 3300025949 Bacteria 1970
88 Ga0207651_10372208 3300025960 Bacteria 1209
89 Ga0207668_10613482 3300025972 Bacteria 949
90 Ga0207658_10082650 3300025986 Bacteria 2467
91 Ga0207658_10131634 3300025986 Bacteria 2010
92 Ga0207677_10061372 3300026023 Bacteria 2603
93 Ga0207677_10061660 3300026023 Bacteria 2598
94 Ga0207703_10544142 3300026035 Bacteria 1094
95 Ga0207648_10232367 3300026089 Bacteria 1640
96 Ga0207675_100856043 3300026118 Bacteria 924
97 Ga0207683_10001689 3300026121 Bacteria 19754
98 Ga0207698_10371764 3300026142 Bacteria 1357
99 Ga0209970_1003020 3300027614 Bacteria 2837
100 Ga0209974_10008844 3300027876 Bacteria 3431
101 Ga0268266_10013258 3300028379 Bacteria 7105
102 Ga0268264_10198800 3300028381 Bacteria 1832
103 Ga0307517_10052422 3300028786 Bacteria 4089
104 Ga0307515_10000160 3300028794 Bacteria 164789
105 Ga0307515_10000484 3300028794 Bacteria 94947
106 Ga0307515_10000658 3300028794 Bacteria 79766
107 Ga0307515_10094791 3300028794 Bacteria 3682
108 Ga0265340_10012885 3300031247 Bacteria 4407
109 Ga0307513_10000038 3300031456 Bacteria 174780
110 Ga0307513_10024729 3300031456 Bacteria 6981
111 Ga0307408_100014417 3300031548 Bacteria 5250
112 Ga0307408_100085622 3300031548 Bacteria 2367
113 Ga0307408_100319749 3300031548 Bacteria 1307
114 Ga0265313_10004883 3300031595 Bacteria 10056
115 Ga0307508_10039482 3300031616 Bacteria 4240
116 Ga0307514_10000348 3300031649 Bacteria 107998
117 Ga0307514_10021130 3300031649 Bacteria 5306
118 Ga0307516_10001367 3300031730 Bacteria 33805
119 Ga0307405_10001234 3300031731 Bacteria 10638
120 Ga0307405_10005505 3300031731 Bacteria 6115
121 Ga0307413_10002493 3300031824 Bacteria 7503
122 Ga0307410_10000769 3300031852 Bacteria 13514
123 Ga0307410_10010279 3300031852 Bacteria 5291
124 Ga0307410_10050355 3300031852 Bacteria 2801
125 Ga0307406_10003439 3300031901 Bacteria 8615
126 Ga0307406_10296893 3300031901 Bacteria 1239
127 Ga0307407_10044508 3300031903 Bacteria 2502
128 Ga0307412_10017024 3300031911 Bacteria 4344
129 Ga0307409_100066238 3300031995 Bacteria 2847
130 Ga0307416_100005151 3300032002 Bacteria 7986
131 Ga0307416_100016980 3300032002 Bacteria 5077
132 Ga0307416_100470877 3300032002 Bacteria 1314
133 Ga0307416_100920292 3300032002 Bacteria 975
134 Ga0307414_10009478 3300032004 Bacteria 5596
135 Ga0307414_10082140 3300032004 Bacteria 2362
136 Ga0307411_10003401 3300032005 Bacteria 7374
137 Ga0307411_10023299 3300032005 Bacteria 3665
138 Ga0307411_10046774 3300032005 Bacteria 2792
139 Ga0307411_10641823 3300032005 Bacteria 918
140 Ga0307411_10682151 3300032005 Bacteria 893
141 Ga0307415_100062721 3300032126 Bacteria 2579
142 Ga0395900_0016357 3300037418 Bacteria 7561
143 Ga0395900_0901513 3300037418 Bacteria 807
144 Ga0395898_0042436 3300037466 Bacteria 4487
145 Ga0395905_0150896 3300037471 Bacteria 2186
146 Ga0395905_0459898 3300037471 Bacteria 1171
147 Ga0395901_0726056 3300038443 Bacteria 988
148 Ga0439461_0035786 3300041410 Bacteria 1054
149 Ga0450912_000584 3300042116 Bacteria 1878
150 Ga0450923_027067 3300042125 Bacteria 1151
151 Ga0450898_006368 3300042134 Bacteria 1810
152 Ga0450899_005592 3300042135 Bacteria 1352
153 Ga0439446_0028240 3300042156 Bacteria 1615
154 Ga0439434_0058608 3300042435 Bacteria 1202
155 Ga0450893_0005131 3300042532 Bacteria 2094
156 Ga0466961_0271145 3300044693 Bacteria 1040
157 Ga0466959_0178617 3300045049 Bacteria 1486
158 Ga0451576_0188279 3300045051 Bacteria 2155
159 Ga0495592_0203242 3300046454 Bacteria 1335
160 Ga0495603_0083755 3300046455 Bacteria 1867
161 Ga0495629_0110509 3300046459 Bacteria 1916
162 Ga0495641_0055228 3300046461 Bacteria 1803
163 Ga0495651_0175501 3300046462 Bacteria 1522
164 Ga0495653_0146852 3300046463 Bacteria 1651
165 Ga0495650_0001530 3300046471 Bacteria 21964
166 Ga0495662_0057624 3300046476 Bacteria 1876
167 Ga0495664_0002185 3300046477 Bacteria 10478
168 Ga0495606_0061714 3300046507 Bacteria 2396
169 Ga0495618_0045181 3300046514 Bacteria 2778
170 Ga0495648_0005220 3300046524 Bacteria 10867
171 Ga0495648_0014899 3300046524 Bacteria 5664
172 Ga0495666_0024622 3300046526 Bacteria 2973
173 Ga0495652_0170954 3300046529 Bacteria 1677
174 Ga0495652_0330101 3300046529 Bacteria 1099
175 Ga0495586_0067539 3300046535 Bacteria 1949
176 Ga0495587_0120999 3300046536 Bacteria 1499
177 Ga0495621_0004012 3300046539 Bacteria 4097
178 Ga0495622_0000018 3300046557 Bacteria 173985
179 Ga0495634_0085145 3300046642 Bacteria 2060
180 Ga0495611_0204084 3300046648 Bacteria 921
181 Ga0495599_0030187 3300046678 Bacteria 3400
182 Ga0495646_0020719 3300046680 Bacteria 4158
183 Ga0495647_0068415 3300046681 Bacteria 1416
184 Ga0495624_0045036 3300046690 Bacteria 2810
185 Ga0495624_0255145 3300046690 Bacteria 1060
186 Ga0495581_0093684 3300047315 Bacteria 1743
187 Ga0495604_0167070 3300047317 Bacteria 1551
188 Ga0495672_0116424 3300047320 Bacteria 1427
189 Ga0495679_001977 3300047446 Bacteria 10906
190 Ga0495681_0164145 3300047470 Bacteria 923
191 Ga0495684_0086702 3300047471 Bacteria 2373
192 Ga0495593_0113212 3300047673 Bacteria 1384
193 Ga0495602_0014116 3300048088 Bacteria 8123
194 Ga0495614_0141679 3300048089 Bacteria 1068
195 Ga0496102_0029428 3300048905 Bacteria 4915
196 Ga0496103_0002389 3300048906 Bacteria 11824
197 Ga0496117_0008932 3300048920 Bacteria 9436
198 Ga0496118_0000674 3300048921 Bacteria 55552
199 Ga0501043_0423635 3300049579 Bacteria 1003
200 Ga0501073_0032946 3300049589 Bacteria 3692
201 Ga0501073_0054979 3300049589 Bacteria 2786
202 nmdc:mga03683_8370_c1 3300050489 Bacteria 3635
203 nmdc:mga0k408_264021_c1 3300050493 Bacteria 1028
204 nmdc:mga0k408_391762_c1 3300050493 Bacteria 827
205 nmdc:mga07m45_153750_c1 3300050496 Bacteria 1334
206 nmdc:mga08y16_421227_c1 3300050511 Bacteria 1364
207 Ga0500644_0009229 3300053088 Bacteria 2632
208 Ga0500634_0119218 3300053161 Bacteria 1287
209 2510247801 2510065045 Bacteria 7761063
210 2512350146 2512047030 Bacteria 9031815
211 2548500322 2547132374 Bacteria 5530232
212 2643864642 2643221570 Bacteria 5103772
213 2643992743 2643221596 Bacteria 5006805
214 2644073394 2643221611 Bacteria 6820941
215 2644296438 2643221652 Bacteria 5140275
216 2644647129 2643221717 Bacteria 5676132
217 2719643767 2718217991 Bacteria 7829542
218 2753569376 2751185846 Bacteria 7242164
219 2816469747 2816332133 Bacteria 7249298
220 2928117792 2928115317 Bacteria 6477646
221 2990715224 2990710928 Bacteria 5002431
222 rootH1_10176459
223 Ga0065165_1006811
224 Ga0070658_10000534
225 Ga0070658_10024424
226 Ga0070658_10037808
227 Ga0070683_100004088
228 Ga0070683_100005863
229 Ga0070683_100819452
230 Ga0070666_10297873
231 Ga0070682_100044738
232 Ga0068868_100082529
233 Ga0068868_100100831
234 Ga0070692_10131916
235 Ga0070675_100227139
236 Ga0070675_100408561
237 Ga0070674_100012896
238 Ga0070674_100133379
239 Ga0070674_100585552
240 Ga0070673_100016264
241 Ga0070673_100128664
242 Ga0070688_100037010
243 Ga0070688_100056573
244 Ga0070659_100168522
245 Ga0070659_100255556
246 Ga0070662_100103186
247 Ga0068867_100339698
248 Ga0070685_10034171
249 Ga0070684_100000578
250 Ga0070684_100004669
251 Ga0068853_100076004
252 Ga0070672_100011272
253 Ga0070665_100226155
254 Ga0068855_100010543
255 Ga0070664_100077578
256 Ga0068856_100252952
257 Ga0068852_100009549
258 Ga0068851_10032262
259 Ga0068858_100426477
260 Ga0068862_100633260
261 Ga0081539_10033135
262 Ga0075362_10024387
263 Ga0075366_10119640
264 Ga0068871_100652336
265 Ga0075429_100026775
266 Ga0105240_10000369
267 Ga0105240_10011173
268 Ga0111539_10514869
269 Ga0105243_10792584
270 Ga0105242_10034172
271 Ga0105237_10082720
272 Ga0105238_10001847
273 Ga0105238_10005281
274 Ga0105238_10008333
275 Ga0157371_10331773
276 Ga0157369_10000908
277 Ga0157374_10241084
278 Ga0157372_10001580
279 Ga0157375_10017978
280 Ga0163163_10064050
281 Ga0157377_10265745
282 Ga0157377_10480645
283 Ga0157376_10027198
284 Ga0157376_10128942
285 Ga0183362_10002
286 Ga0207656_10029269
287 Ga0207705_10019376
288 Ga0207705_10026384
289 Ga0207705_10069924
290 Ga0207695_10000923
291 Ga0207695_10260991
292 Ga0207671_10006455
293 Ga0207662_10045145
294 Ga0207652_10032624
295 Ga0207694_10031689
296 Ga0207694_10040984
297 Ga0207650_10243087
298 Ga0207690_10217865
299 Ga0207686_10006318
300 Ga0207669_10080708
301 Ga0207691_10005602
302 Ga0207691_10035421
303 Ga0207711_10218836
304 Ga0207661_10000444
305 Ga0207661_10003085
306 Ga0207661_10670717
307 Ga0207667_10025544
308 Ga0207667_10214994
309 Ga0207651_10372208
310 Ga0207668_10613482
311 Ga0207658_10082650
312 Ga0207658_10131634
313 Ga0207677_10061372
314 Ga0207677_10061660
315 Ga0207703_10544142
316 Ga0207648_10232367
317 Ga0207675_100856043
318 Ga0207683_10001689
319 Ga0207698_10371764
320 Ga0209970_1003020
321 Ga0209974_10008844
322 Ga0268266_10013258
323 Ga0268264_10198800
324 Ga0307517_10052422
325 Ga0307515_10000160
326 Ga0307515_10000484
327 Ga0307515_10000658
328 Ga0307515_10094791
329 Ga0265340_10012885
330 Ga0307513_10000038
331 Ga0307513_10024729
332 Ga0307408_100014417
333 Ga0307408_100085622
334 Ga0307408_100319749
335 Ga0265313_10004883
336 Ga0307508_10039482
337 Ga0307514_10000348
338 Ga0307514_10021130
339 Ga0307516_10001367
340 Ga0307405_10001234
341 Ga0307405_10005505
342 Ga0307413_10002493
343 Ga0307410_10000769
344 Ga0307410_10010279
345 Ga0307410_10050355
346 Ga0307406_10003439
347 Ga0307406_10296893
348 Ga0307407_10044508
349 Ga0307412_10017024
350 Ga0307409_100066238
351 Ga0307416_100005151
352 Ga0307416_100016980
353 Ga0307416_100470877
354 Ga0307416_100920292
355 Ga0307414_10009478
356 Ga0307414_10082140
357 Ga0307411_10003401
358 Ga0307411_10023299
359 Ga0307411_10046774
360 Ga0307411_10641823
361 Ga0307411_10682151
362 Ga0307415_100062721
363 Ga0395900_0016357
364 Ga0395900_0901513
365 Ga0395898_0042436
366 Ga0395905_0150896
367 Ga0395905_0459898
368 Ga0395901_0726056
369 Ga0439461_0035786
370 Ga0450912_000584
371 Ga0450923_027067
372 Ga0450898_006368
373 Ga0450899_005592
374 Ga0439446_0028240
375 Ga0439434_0058608
376 Ga0450893_0005131
377 Ga0466961_0271145
378 Ga0466959_0178617
379 Ga0451576_0188279
380 Ga0495592_0203242
381 Ga0495603_0083755
382 Ga0495629_0110509
383 Ga0495641_0055228
384 Ga0495651_0175501
385 Ga0495653_0146852
386 Ga0495650_0001530
387 Ga0495662_0057624
388 Ga0495664_0002185
389 Ga0495606_0061714
390 Ga0495618_0045181
391 Ga0495648_0005220
392 Ga0495648_0014899
393 Ga0495666_0024622
394 Ga0495652_0170954
395 Ga0495652_0330101
396 Ga0495586_0067539
397 Ga0495587_0120999
398 Ga0495621_0004012
399 Ga0495622_0000018
400 Ga0495634_0085145
401 Ga0495611_0204084
402 Ga0495599_0030187
403 Ga0495646_0020719
404 Ga0495647_0068415
405 Ga0495624_0045036
406 Ga0495624_0255145
407 Ga0495581_0093684
408 Ga0495604_0167070
409 Ga0495672_0116424
410 Ga0495679_001977
411 Ga0495681_0164145
412 Ga0495684_0086702
413 Ga0495593_0113212
414 Ga0495602_0014116
415 Ga0495614_0141679
416 Ga0496102_0029428
417 Ga0496103_0002389
418 Ga0496117_0008932
419 Ga0496118_0000674
420 Ga0501043_0423635
421 Ga0501073_0032946
422 Ga0501073_0054979
423 nmdc:mga03683_8370_c1
424 nmdc:mga0k408_264021_c1
425 nmdc:mga0k408_391762_c1
426 nmdc:mga07m45_153750_c1
427 nmdc:mga08y16_421227_c1
428 Ga0500644_0009229
429 Ga0500634_0119218
430 2510247801
431 2512350146
432 2548500322
433 2643864642
434 2643992743
435 2644073394
436 2644296438
437 2644647129
438 2719643767
439 2753569376
440 2816469747
441 2928117792
442 2990715224

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13531

SBP_bac_11

Bacterial extracellular solute-binding protein

11

233

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3axf-assembly3.cif.gz_C perrhenate binding to a11c/r153c moda mutant 0.8708 10 233
7tav-assembly2.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8679 10 235
7tav-assembly5.cif.gz_E error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8639 10 235
7tav-assembly6.cif.gz_F error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.859 8 236
7tav-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8589 10 236
ID Description Score Start End Superfamily
1atgA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.932 11 232 3.40.190.10
af_P9WGU3_42_110_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9234 13 78 3.40.190.10
af_P37329_30_103_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9171 13 73 3.40.190.10
2h5yB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9148 9 233 3.40.190.10
4rxlA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9025 11 233 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A4V1R146-F1-model_v4 deleted 0.9798 59 235
AF-A0A520GGA9-F1-model_v4 ABC transporter substrate-binding protein 0.9775 41 235 GO:0015689
GO:0030973
AF-A0A4V1R146-F1-model_v4 deleted 0.9743 59 235
AF-A0A520GGA9-F1-model_v4 ABC transporter substrate-binding protein 0.9726 41 235 GO:0015689
GO:0030973
AF-A0A127EYM7-F1-model_v4 Molybdate ABC transporter periplasmic-binding protein 0.9686 10 233 GO:0015689
GO:0030973

Map