F332739

General Info

Members Datasets Scaffolds Average Seq Length
220 158 440 208

Family's Representative Sequence

Representative Sequence 3300049823|Ga0501044_0130449|Ga0501044_0130449_1540_2328
Length 252
Sequence MADSATATAPGTGAATSRVVEIKDAIKVPVLNAAGTEVGSVSIDPADFGGKISKQLMHDVVKMYLANQRAGTHHTLRRGQVAGSTKKLFRQKGTGNARVGTTAKGPKPRDYEYHLPKKAVRAATRMAVLSKFVDGEAVVLDDLPETAFPEANGKRVPQTKVVAGVLKAIKVGKKTTEQGEKDVTLLDTTVLIGTDGLNQLVYRSARNIEGVKVLPAAEFNCYTVLKQKRLVLTKSALEALRKGGDKVQEGHG

Samples

Sample ID Description Type Environment
1 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
60 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
62 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
96 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
97 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
102 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
105 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
106 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
107 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
108 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
109 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
110 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
111 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
112 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
113 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
114 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
115 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
116 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
117 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
118 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
119 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
120 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
121 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
122 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
123 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
124 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
125 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
126 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
127 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
128 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
129 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
130 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
131 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
132 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
138 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
139 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
140 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
141 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
142 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
143 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
144 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
145 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
146 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
147 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
157 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified
158 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 90.91
Metatranscriptomes 8.18
Isolates 0.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.45
Nodule 0
Rhizoplane 0.91
Rhizosphere 95
Stem 0
Stem Tuber 0
Unclassified 10

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501044_0130449 3300049823 Bacteria 2508
2 JGI25406J46586_10087659 3300003203 Bacteria 944
3 Ga0070658_10590841 3300005327 Bacteria 962
4 Ga0070658_10715200 3300005327 Bacteria 870
5 Ga0070683_100325518 3300005329 Bacteria 1463
6 Ga0070683_100709249 3300005329 Bacteria 964
7 Ga0068869_100667781 3300005334 Bacteria 884
8 Ga0070660_100595821 3300005339 Bacteria 924
9 Ga0070668_100464389 3300005347 Bacteria 1090
10 Ga0070675_100014474 3300005354 Bacteria 6222
11 Ga0070675_100045940 3300005354 Bacteria 3575
12 Ga0070674_100045906 3300005356 Bacteria 2986
13 Ga0070688_100203025 3300005365 Bacteria 1388
14 Ga0070659_100506244 3300005366 Bacteria 1030
15 Ga0070667_100585249 3300005367 Bacteria 1028
16 Ga0070667_100720509 3300005367 Bacteria 924
17 Ga0070714_100028337 3300005435 Bacteria 4646
18 Ga0070714_100460724 3300005435 Bacteria 1209
19 Ga0070678_100463482 3300005456 Bacteria 1112
20 Ga0070678_100921380 3300005456 Bacteria 800
21 Ga0070681_10761367 3300005458 Bacteria 885
22 Ga0070706_100290328 3300005467 Unclassified 1526
23 Ga0070706_100369997 3300005467 Bacteria 1335
24 Ga0070679_101222555 3300005530 Unclassified 697
25 Ga0070684_101256989 3300005535 Bacteria 696
26 Ga0068853_100124312 3300005539 Bacteria 2304
27 Ga0070672_100003420 3300005543 Bacteria 10294
28 Ga0070672_100522234 3300005543 Bacteria 1029
29 Ga0070672_100615561 3300005543 Bacteria 947
30 Ga0070665_100186369 3300005548 Bacteria 2076
31 Ga0070665_100988746 3300005548 Bacteria 854
32 Ga0068855_100107890 3300005563 Bacteria 3199
33 Ga0068855_100136892 3300005563 Bacteria 2793
34 Ga0068855_100661850 3300005563 Bacteria 1121
35 Ga0068855_100727616 3300005563 Bacteria 1060
36 Ga0068855_100874610 3300005563 Bacteria 951
37 Ga0068857_100205784 3300005577 Bacteria 1795
38 Ga0068854_100393586 3300005578 Unclassified 1145
39 Ga0068852_100329179 3300005616 Bacteria 1486
40 Ga0068852_100423405 3300005616 Bacteria 1314
41 Ga0068864_100676510 3300005618 Bacteria 1006
42 Ga0068861_100722261 3300005719 Unclassified 928
43 Ga0068851_10120820 3300005834 Bacteria 1408
44 Ga0068863_100630913 3300005841 Bacteria 1062
45 Ga0068862_100076231 3300005844 Unclassified 2902
46 Ga0068862_100362042 3300005844 Bacteria 1348
47 Ga0081539_10009865 3300005985 Bacteria 7877
48 Ga0070717_10056982 3300006028 Bacteria 3230
49 Ga0070717_10604220 3300006028 Unclassified 995
50 Ga0097621_100529428 3300006237 Bacteria 1071
51 Ga0075428_100009144 3300006844 Bacteria 10996
52 Ga0075428_100176215 3300006844 Bacteria 2316
53 Ga0075430_100021518 3300006846 Bacteria 5481
54 Ga0075431_100632850 3300006847 Bacteria 1051
55 Ga0075434_100426026 3300006871 Bacteria 1348
56 Ga0075429_100169194 3300006880 Bacteria 1914
57 Ga0105240_10010542 3300009093 Bacteria 12980
58 Ga0105240_10362798 3300009093 Bacteria 1640
59 Ga0105240_10492462 3300009093 Bacteria 1364
60 Ga0105245_10034862 3300009098 Bacteria 4465
61 Ga0105245_10767890 3300009098 Bacteria 1000
62 Ga0114129_10952516 3300009147 Unclassified 1084
63 Ga0105243_10851174 3300009148 Bacteria 903
64 Ga0105241_10293896 3300009174 Bacteria 1392
65 Ga0105248_11004717 3300009177 Bacteria 942
66 Ga0105248_11870340 3300009177 Unclassified 681
67 Ga0105238_10067706 3300009551 Bacteria 3571
68 Ga0105239_10021847 3300010375 Bacteria 7054
69 Ga0105239_11129713 3300010375 Bacteria 902
70 Ga0157371_10150732 3300013102 Bacteria 1658
71 Ga0157370_10164701 3300013104 Bacteria 2062
72 Ga0157369_10065330 3300013105 Bacteria 3915
73 Ga0157369_10103308 3300013105 Bacteria 3036
74 Ga0157369_10128853 3300013105 Bacteria 2682
75 Ga0157369_10323946 3300013105 Unclassified 1602
76 Ga0157369_10900558 3300013105 Bacteria 907
77 Ga0157374_11149264 3300013296 Bacteria 797
78 Ga0163162_10347041 3300013306 Bacteria 1617
79 Ga0157372_10024618 3300013307 Bacteria 6543
80 Ga0157372_10029259 3300013307 Bacteria 6013
81 Ga0157375_11590346 3300013308 Bacteria 773
82 Ga0163163_11229812 3300014325 Bacteria 811
83 Ga0182008_10291856 3300014497 Bacteria 851
84 Ga0157379_10069624 3300014968 Bacteria 3147
85 Ga0197907_10380889 3300020069 Bacteria 1201
86 Ga0197907_11185843 3300020069 Bacteria 1259
87 Ga0206349_1209078 3300020075 Bacteria 2609
88 Ga0206355_1609993 3300020076 Bacteria 1768
89 Ga0206352_10155047 3300020078 Bacteria 3531
90 Ga0154015_1310134 3300020610 Bacteria 2182
91 Ga0224712_10099833 3300022467 Bacteria 1229
92 Ga0207656_10097950 3300025321 Bacteria 1341
93 Ga0207688_10523791 3300025901 Bacteria 744
94 Ga0207680_10771210 3300025903 Unclassified 689
95 Ga0207684_10183717 3300025910 Unclassified 1803
96 Ga0207654_10025454 3300025911 Bacteria 3192
97 Ga0207695_10000534 3300025913 Bacteria 79293
98 Ga0207657_10463408 3300025919 Bacteria 994
99 Ga0207681_10743674 3300025923 Bacteria 817
100 Ga0207694_10197325 3300025924 Bacteria 1636
101 Ga0207694_10626605 3300025924 Bacteria 905
102 Ga0207650_10294131 3300025925 Bacteria 1325
103 Ga0207650_10305731 3300025925 Bacteria 1300
104 Ga0207650_10477660 3300025925 Bacteria 1040
105 Ga0207659_10222876 3300025926 Bacteria 1517
106 Ga0207687_10004724 3300025927 Bacteria 9061
107 Ga0207687_11038210 3300025927 Bacteria 703
108 Ga0207700_10412398 3300025928 Bacteria 1185
109 Ga0207644_10017799 3300025931 Bacteria 4805
110 Ga0207690_10222641 3300025932 Bacteria 1444
111 Ga0207691_10007825 3300025940 Bacteria 10293
112 Ga0207691_10318288 3300025940 Bacteria 1334
113 Ga0207711_10140972 3300025941 Bacteria 2169
114 Ga0207661_10205344 3300025944 Bacteria 1734
115 Ga0207667_10400722 3300025949 Bacteria 1397
116 Ga0207668_10146289 3300025972 Bacteria 1824
117 Ga0207658_10332580 3300025986 Bacteria 1318
118 Ga0207658_10364222 3300025986 Bacteria 1262
119 Ga0207677_10752832 3300026023 Bacteria 868
120 Ga0207639_10591658 3300026041 Bacteria 1022
121 Ga0207702_10488713 3300026078 Bacteria 1199
122 Ga0207648_10452333 3300026089 Unclassified 1169
123 Ga0207648_11013518 3300026089 Bacteria 778
124 Ga0207676_10070970 3300026095 Bacteria 2795
125 Ga0207676_10215714 3300026095 Bacteria 1706
126 Ga0207674_10004220 3300026116 Bacteria 17343
127 Ga0207674_10056029 3300026116 Bacteria 4004
128 Ga0207674_10358440 3300026116 Bacteria 1410
129 Ga0207683_10193244 3300026121 Bacteria 1848
130 Ga0207698_10073614 3300026142 Bacteria 2721
131 Ga0207698_10175589 3300026142 Bacteria 1891
132 Ga0207698_10225303 3300026142 Unclassified 1698
133 Ga0268266_11038948 3300028379 Bacteria 793
134 Ga0268265_10058653 3300028380 Unclassified 2940
135 Ga0268264_10184165 3300028381 Bacteria 1899
136 Ga0307408_100118939 3300031548 Bacteria 2044
137 Ga0307405_10931075 3300031731 Bacteria 737
138 Ga0307410_10205050 3300031852 Bacteria 1508
139 Ga0307416_101056828 3300032002 Unclassified 916
140 Ga0307416_101613847 3300032002 Bacteria 754
141 Ga0316586_1039099 3300033527 Bacteria 830
142 Ga0316588_1041404 3300033528 Bacteria 1102
143 Ga0373937_0049978 3300036401 Bacteria 3830
144 Ga0373937_1299152 3300036401 Bacteria 675
145 Ga0316584_0338375 3300036712 Bacteria 1082
146 Ga0395898_0773885 3300037466 Unclassified 901
147 Ga0395898_0865620 3300037466 Bacteria 843
148 Ga0436364_0996959 3300037853 Bacteria 738
149 Ga0436364_1210795 3300037853 Bacteria 762
150 Ga0395901_0504798 3300038443 Bacteria 1231
151 Ga0436365_0323265 3300039437 Bacteria 1341
152 Ga0436365_1577591 3300039437 Bacteria 744
153 Ga0436360_0899443 3300039438 Bacteria 902
154 Ga0436360_1100897 3300039438 Bacteria 1759
155 Ga0436363_1489186 3300039450 Bacteria 937
156 Ga0436363_1618588 3300039450 Bacteria 831
157 Ga0451577_0379246 3300042876 Bacteria 1283
158 Ga0453684_0978171 3300044712 Bacteria 901
159 Ga0451576_0017215 3300045051 Bacteria 7950
160 Ga0451576_0169894 3300045051 Bacteria 2276
161 Ga0495580_0110944 3300046472 Bacteria 1905
162 Ga0495662_0263807 3300046476 Unclassified 848
163 Ga0495664_0294449 3300046477 Bacteria 980
164 Ga0495608_0009221 3300046511 Bacteria 6901
165 Ga0495618_0008394 3300046514 Bacteria 6253
166 Ga0495630_0392259 3300046517 Bacteria 1063
167 Ga0495666_0202990 3300046526 Unclassified 911
168 Ga0495640_0153029 3300046533 Bacteria 1481
169 Ga0495586_0198698 3300046535 Bacteria 1136
170 Ga0495667_0149457 3300046559 Bacteria 1504
171 Ga0495667_0425836 3300046559 Unclassified 835
172 Ga0495634_0119873 3300046642 Bacteria 1685
173 Ga0495599_0178145 3300046678 Bacteria 1311
174 Ga0495613_0002834 3300046689 Bacteria 13005
175 Ga0495624_0004418 3300046690 Bacteria 10287
176 Ga0495674_0006291 3300047319 Bacteria 11385
177 Ga0495675_0185730 3300047444 Bacteria 1271
178 Ga0495684_0001118 3300047471 Bacteria 21619
179 Ga0495686_0017195 3300047472 Bacteria 4880
180 Ga0496104_0084161 3300048907 Bacteria 3035
181 Ga0496114_0552440 3300048917 Bacteria 1017
182 Ga0501034_0088667 3300049571 Bacteria 3091
183 Ga0501034_0564355 3300049571 Bacteria 1047
184 Ga0501034_0629704 3300049571 Bacteria 976
185 Ga0501034_0886200 3300049571 Bacteria 781
186 Ga0501037_0002193 3300049573 Bacteria 14112
187 Ga0501040_0126294 3300049576 Bacteria 1797
188 Ga0501046_0041665 3300049580 Bacteria 3663
189 Ga0501046_0276784 3300049580 Bacteria 1230
190 Ga0501047_0079762 3300049581 Bacteria 3147
191 Ga0501047_0157777 3300049581 Bacteria 2142
192 Ga0501047_0163216 3300049581 Bacteria 2099
193 Ga0501070_0058287 3300049586 Bacteria 3201
194 Ga0501074_0525878 3300049590 Bacteria 838
195 Ga0501080_0026397 3300049742 Bacteria 5397
196 Ga0501080_0961040 3300049742 Unclassified 742
197 Ga0501044_0002343 3300049823 Bacteria 21608
198 Ga0501044_0004670 3300049823 Bacteria 15326
199 nmdc:mga09592_473251_c1 3300050508 Bacteria 1080
200 nmdc:mga0qj67_179194_c1 3300050509 Bacteria 1721
201 nmdc:mga08y16_1058466_c1 3300050511 Unclassified 788
202 nmdc:mga08y16_535039_c1 3300050511 Bacteria 1187
203 nmdc:mga0n895_379619_c1 3300050512 Bacteria 1430
204 Ga0495601_0070238 3300053077 Bacteria 2235
205 Ga0495619_0019818 3300053085 Bacteria 4280
206 Ga0495619_0160603 3300053085 Bacteria 1552
207 Ga0495619_0633023 3300053085 Bacteria 730
208 Ga0500556_0065777 3300053104 Bacteria 1345
209 Ga0587077_000708 3300059493 Bacteria 3111
210 Ga0587080_015714 3300059503 Bacteria 1185
211 Ga0587082_033817 3300059504 Bacteria 905
212 Ga0587088_015719 3300059508 Bacteria 1196
213 Ga0587090_015082 3300059510 Bacteria 1138
214 Ga0587106_061939 3300059605 Bacteria 689
215 Ga0587101_012925 3300059623 Bacteria 1092
216 Ga0587128_018667 3300059630 Unclassified 1041
217 Ga0587114_001608 3300059655 Bacteria 1939
218 Ga0501082_0565201 3300060353 Bacteria 995
219 2673167481 2671180531 Bacteria 9045424
220 2687239266 2684623219 Bacteria 8442773
221 Ga0501044_0130449
222 JGI25406J46586_10087659
223 Ga0070658_10590841
224 Ga0070658_10715200
225 Ga0070683_100325518
226 Ga0070683_100709249
227 Ga0068869_100667781
228 Ga0070660_100595821
229 Ga0070668_100464389
230 Ga0070675_100014474
231 Ga0070675_100045940
232 Ga0070674_100045906
233 Ga0070688_100203025
234 Ga0070659_100506244
235 Ga0070667_100585249
236 Ga0070667_100720509
237 Ga0070714_100028337
238 Ga0070714_100460724
239 Ga0070678_100463482
240 Ga0070678_100921380
241 Ga0070681_10761367
242 Ga0070706_100290328
243 Ga0070706_100369997
244 Ga0070679_101222555
245 Ga0070684_101256989
246 Ga0068853_100124312
247 Ga0070672_100003420
248 Ga0070672_100522234
249 Ga0070672_100615561
250 Ga0070665_100186369
251 Ga0070665_100988746
252 Ga0068855_100107890
253 Ga0068855_100136892
254 Ga0068855_100661850
255 Ga0068855_100727616
256 Ga0068855_100874610
257 Ga0068857_100205784
258 Ga0068854_100393586
259 Ga0068852_100329179
260 Ga0068852_100423405
261 Ga0068864_100676510
262 Ga0068861_100722261
263 Ga0068851_10120820
264 Ga0068863_100630913
265 Ga0068862_100076231
266 Ga0068862_100362042
267 Ga0081539_10009865
268 Ga0070717_10056982
269 Ga0070717_10604220
270 Ga0097621_100529428
271 Ga0075428_100009144
272 Ga0075428_100176215
273 Ga0075430_100021518
274 Ga0075431_100632850
275 Ga0075434_100426026
276 Ga0075429_100169194
277 Ga0105240_10010542
278 Ga0105240_10362798
279 Ga0105240_10492462
280 Ga0105245_10034862
281 Ga0105245_10767890
282 Ga0114129_10952516
283 Ga0105243_10851174
284 Ga0105241_10293896
285 Ga0105248_11004717
286 Ga0105248_11870340
287 Ga0105238_10067706
288 Ga0105239_10021847
289 Ga0105239_11129713
290 Ga0157371_10150732
291 Ga0157370_10164701
292 Ga0157369_10065330
293 Ga0157369_10103308
294 Ga0157369_10128853
295 Ga0157369_10323946
296 Ga0157369_10900558
297 Ga0157374_11149264
298 Ga0163162_10347041
299 Ga0157372_10024618
300 Ga0157372_10029259
301 Ga0157375_11590346
302 Ga0163163_11229812
303 Ga0182008_10291856
304 Ga0157379_10069624
305 Ga0197907_10380889
306 Ga0197907_11185843
307 Ga0206349_1209078
308 Ga0206355_1609993
309 Ga0206352_10155047
310 Ga0154015_1310134
311 Ga0224712_10099833
312 Ga0207656_10097950
313 Ga0207688_10523791
314 Ga0207680_10771210
315 Ga0207684_10183717
316 Ga0207654_10025454
317 Ga0207695_10000534
318 Ga0207657_10463408
319 Ga0207681_10743674
320 Ga0207694_10197325
321 Ga0207694_10626605
322 Ga0207650_10294131
323 Ga0207650_10305731
324 Ga0207650_10477660
325 Ga0207659_10222876
326 Ga0207687_10004724
327 Ga0207687_11038210
328 Ga0207700_10412398
329 Ga0207644_10017799
330 Ga0207690_10222641
331 Ga0207691_10007825
332 Ga0207691_10318288
333 Ga0207711_10140972
334 Ga0207661_10205344
335 Ga0207667_10400722
336 Ga0207668_10146289
337 Ga0207658_10332580
338 Ga0207658_10364222
339 Ga0207677_10752832
340 Ga0207639_10591658
341 Ga0207702_10488713
342 Ga0207648_10452333
343 Ga0207648_11013518
344 Ga0207676_10070970
345 Ga0207676_10215714
346 Ga0207674_10004220
347 Ga0207674_10056029
348 Ga0207674_10358440
349 Ga0207683_10193244
350 Ga0207698_10073614
351 Ga0207698_10175589
352 Ga0207698_10225303
353 Ga0268266_11038948
354 Ga0268265_10058653
355 Ga0268264_10184165
356 Ga0307408_100118939
357 Ga0307405_10931075
358 Ga0307410_10205050
359 Ga0307416_101056828
360 Ga0307416_101613847
361 Ga0316586_1039099
362 Ga0316588_1041404
363 Ga0373937_0049978
364 Ga0373937_1299152
365 Ga0316584_0338375
366 Ga0395898_0773885
367 Ga0395898_0865620
368 Ga0436364_0996959
369 Ga0436364_1210795
370 Ga0395901_0504798
371 Ga0436365_0323265
372 Ga0436365_1577591
373 Ga0436360_0899443
374 Ga0436360_1100897
375 Ga0436363_1489186
376 Ga0436363_1618588
377 Ga0451577_0379246
378 Ga0453684_0978171
379 Ga0451576_0017215
380 Ga0451576_0169894
381 Ga0495580_0110944
382 Ga0495662_0263807
383 Ga0495664_0294449
384 Ga0495608_0009221
385 Ga0495618_0008394
386 Ga0495630_0392259
387 Ga0495666_0202990
388 Ga0495640_0153029
389 Ga0495586_0198698
390 Ga0495667_0149457
391 Ga0495667_0425836
392 Ga0495634_0119873
393 Ga0495599_0178145
394 Ga0495613_0002834
395 Ga0495624_0004418
396 Ga0495674_0006291
397 Ga0495675_0185730
398 Ga0495684_0001118
399 Ga0495686_0017195
400 Ga0496104_0084161
401 Ga0496114_0552440
402 Ga0501034_0088667
403 Ga0501034_0564355
404 Ga0501034_0629704
405 Ga0501034_0886200
406 Ga0501037_0002193
407 Ga0501040_0126294
408 Ga0501046_0041665
409 Ga0501046_0276784
410 Ga0501047_0079762
411 Ga0501047_0157777
412 Ga0501047_0163216
413 Ga0501070_0058287
414 Ga0501074_0525878
415 Ga0501080_0026397
416 Ga0501080_0961040
417 Ga0501044_0002343
418 Ga0501044_0004670
419 nmdc:mga09592_473251_c1
420 nmdc:mga0qj67_179194_c1
421 nmdc:mga08y16_1058466_c1
422 nmdc:mga08y16_535039_c1
423 nmdc:mga0n895_379619_c1
424 Ga0495601_0070238
425 Ga0495619_0019818
426 Ga0495619_0160603
427 Ga0495619_0633023
428 Ga0500556_0065777
429 Ga0587077_000708
430 Ga0587080_015714
431 Ga0587082_033817
432 Ga0587088_015719
433 Ga0587090_015082
434 Ga0587106_061939
435 Ga0587101_012925
436 Ga0587128_018667
437 Ga0587114_001608
438 Ga0501082_0565201
439 2673167481
440 2687239266

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00573

Ribosomal_L4

Ribosomal protein L4/L1 family

41

243

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c9a-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.8786 15 206
7ode-assembly1.cif.gz_M e. coli 50s ribosome licl core particle 0.8536 2 204
8c9a-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.84 15 206
8c9b-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.8289 4 206
8c97-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.8255 4 206
ID Description Score Start End Superfamily
af_Q2FW07_2_206_3.40.1370.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.7463 3 204 3.40.1370.10
1dmgA00 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.7267 3 206 3.40.1370.10
af_Q2FW07_2_206_3.40.1370.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.7256 3 204 3.40.1370.10
af_K7MAT5_102_317_3.40.1370.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.7245 2 205 3.40.1370.10
af_P60723_1_201_3.40.1370.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.7219 2 205 3.40.1370.10
ID Description Score Start End GO Terms
AF-A0A660UKH6-F1-model_v4 Large ribosomal subunit protein uL4 (50S ribosomal protein L4) 0.9871 108 205 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A645JEY8-F1-model_v4 50S ribosomal protein L4 0.976 115 204 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A0F9EYT3-F1-model_v4 50S ribosomal protein L4 0.9598 101 204 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A1G0AZX1-F1-model_v4 Large ribosomal subunit protein uL4 (50S ribosomal protein L4) 0.9595 101 204 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A3D2KWG5-F1-model_v4 deleted 0.9588 113 204

Map