F332384

General Info

Members Datasets Scaffolds Average Seq Length
220 164 220 114

Family's Representative Sequence

Representative Sequence 3300028786|Ga0307517_10019146|Ga0307517_100191464
Length 123
Sequence MPRFLSTPGVCALFVAALAPALAPVHARADTTPTTSIAQLMVLEPGDASYRLFHGAVWLDSDKASWNYRWGGLQCKGRELSDTSVQLLFAAFRSEYQVNIEFVVTEYKGKSYRCLTGFTISKA

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
78 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
79 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
80 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
81 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
82 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
83 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
84 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
87 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
88 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
89 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
90 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
91 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
92 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
93 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
94 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
101 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
102 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
103 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
104 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
105 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
106 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
107 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
108 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
109 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
110 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
111 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
112 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
113 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
114 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
115 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
122 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
123 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
124 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
125 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
126 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
127 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
128 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
129 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
130 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
131 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
132 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
133 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
134 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
135 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
136 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
138 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
139 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
140 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
141 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
142 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
143 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
144 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
145 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
146 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
147 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
148 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
149 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
150 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
151 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
152 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
153 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
154 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
155 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
156 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
157 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
158 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
159 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
160 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
161 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
162 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
163 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
164 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.64
Nodule 0
Rhizoplane 1.36
Rhizosphere 77.73
Stem 0
Stem Tuber 0
Unclassified 7.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10511510 3300005327 Bacteria 1038
2 Ga0070683_100228183 3300005329 Bacteria 1770
3 Ga0070683_101130735 3300005329 Unclassified 752
4 Ga0070690_100140803 3300005330 Bacteria 1637
5 Ga0070670_100325951 3300005331 Unclassified 1346
6 Ga0070670_101245686 3300005331 Unclassified 680
7 Ga0068869_100048804 3300005334 Bacteria 3063
8 Ga0068869_100453066 3300005334 Unclassified 1064
9 Ga0068869_101200169 3300005334 Unclassified 667
10 Ga0070680_100460835 3300005336 Bacteria 1086
11 Ga0070680_100727577 3300005336 Bacteria 854
12 Ga0070689_100057742 3300005340 Bacteria 3013
13 Ga0070689_100059706 3300005340 Bacteria 2964
14 Ga0070689_102070116 3300005340 Archaea 521
15 Ga0070692_11431970 3300005345 Unclassified 500
16 Ga0070674_100059385 3300005356 Unclassified 2662
17 Ga0070673_101281422 3300005364 Unclassified 688
18 Ga0070688_100255285 3300005365 Bacteria 1250
19 Ga0070703_10221026 3300005406 Bacteria 754
20 Ga0070708_100039985 3300005445 Bacteria 4106
21 Ga0070678_100092697 3300005456 Unclassified 2321
22 Ga0070678_100908243 3300005456 Unclassified 805
23 Ga0070681_10271528 3300005458 Bacteria 1607
24 Ga0070685_10094878 3300005466 Bacteria 1812
25 Ga0070685_10734893 3300005466 Bacteria 722
26 Ga0070679_100023921 3300005530 Bacteria 5985
27 Ga0070679_100570733 3300005530 Bacteria 1075
28 Ga0070679_101136348 3300005530 Bacteria 726
29 Ga0070684_100189842 3300005535 Bacteria 1869
30 Ga0070684_100395870 3300005535 Archaea 1273
31 Ga0070684_100710702 3300005535 Bacteria 937
32 Ga0070697_101000165 3300005536 Unclassified 743
33 Ga0070695_100137139 3300005545 Bacteria 1692
34 Ga0070695_100398342 3300005545 Bacteria 1043
35 Ga0070665_100038581 3300005548 Bacteria 4802
36 Ga0070665_100451364 3300005548 Bacteria 1295
37 Ga0068855_100068801 3300005563 Bacteria 4121
38 Ga0068857_101095457 3300005577 Unclassified 769
39 Ga0068854_100569737 3300005578 Unclassified 963
40 Ga0068856_100026435 3300005614 Bacteria 5660
41 Ga0068864_100103330 3300005618 Bacteria 2530
42 Ga0068860_101595588 3300005843 Unclassified 674
43 Ga0081455_10075938 3300005937 Bacteria 2770
44 Ga0070717_10123511 3300006028 Bacteria 2220
45 Ga0097621_101584841 3300006237 Bacteria 622
46 Ga0068871_100403227 3300006358 Bacteria 1218
47 Ga0075428_101142286 3300006844 Bacteria 822
48 Ga0075430_100587096 3300006846 Bacteria 919
49 Ga0075429_100027549 3300006880 Bacteria 4933
50 Ga0075429_100308709 3300006880 Bacteria 1385
51 Ga0068865_101068868 3300006881 Bacteria 709
52 Ga0075435_100350855 3300007076 Bacteria 1265
53 Ga0105245_10000041 3300009098 Bacteria 142882
54 Ga0105245_11256806 3300009098 Bacteria 789
55 Ga0114129_11247925 3300009147 Bacteria 923
56 Ga0105243_11125629 3300009148 Bacteria 795
57 Ga0105241_10675778 3300009174 Unclassified 940
58 Ga0105242_11679658 3300009176 Bacteria 671
59 Ga0105248_11428216 3300009177 Bacteria 783
60 Ga0105237_11236308 3300009545 Unclassified 753
61 Ga0105239_10023798 3300010375 Bacteria 6745
62 Ga0157374_10003089 3300013296 Bacteria 13967
63 Ga0157372_11908802 3300013307 Bacteria 683
64 Ga0157379_11333339 3300014968 Bacteria 694
65 Ga0157376_10030118 3300014969 Unclassified 4329
66 Ga0157376_10185556 3300014969 Unclassified 1904
67 Ga0157376_12186553 3300014969 Unclassified 592
68 Ga0207680_10666421 3300025903 Unclassified 745
69 Ga0207705_10839552 3300025909 Bacteria 712
70 Ga0207684_10434456 3300025910 Unclassified 1128
71 Ga0207654_10341082 3300025911 Unclassified 1029
72 Ga0207707_10319124 3300025912 Bacteria 1342
73 Ga0207660_10725647 3300025917 Unclassified 811
74 Ga0207662_10220850 3300025918 Bacteria 1234
75 Ga0207662_10548641 3300025918 Bacteria 800
76 Ga0207652_10026531 3300025921 Bacteria 4826
77 Ga0207652_10230438 3300025921 Bacteria 1669
78 Ga0207652_11328507 3300025921 Bacteria 622
79 Ga0207652_11519764 3300025921 Unclassified 574
80 Ga0207646_11381743 3300025922 Unclassified 613
81 Ga0207650_11255795 3300025925 Unclassified 631
82 Ga0207687_10000067 3300025927 Bacteria 80150
83 Ga0207686_11194532 3300025934 Bacteria 622
84 Ga0207670_10184183 3300025936 Unclassified 1575
85 Ga0207670_10331553 3300025936 Bacteria 1200
86 Ga0207669_10013430 3300025937 Unclassified 4067
87 Ga0207704_10344604 3300025938 Unclassified 1158
88 Ga0207711_11050145 3300025941 Bacteria 755
89 Ga0207689_10045172 3300025942 Bacteria 3643
90 Ga0207689_10067804 3300025942 Bacteria 2932
91 Ga0207661_10192645 3300025944 Bacteria 1788
92 Ga0207661_11002049 3300025944 Unclassified 769
93 Ga0207661_11311897 3300025944 Bacteria 665
94 Ga0207667_10814406 3300025949 Bacteria 930
95 Ga0207640_10522993 3300025981 Unclassified 992
96 Ga0207677_10294126 3300026023 Bacteria 1339
97 Ga0207702_10208056 3300026078 Unclassified 1817
98 Ga0207676_10035928 3300026095 Bacteria 3766
99 Ga0207674_10979092 3300026116 Unclassified 815
100 Ga0207674_11518944 3300026116 Unclassified 639
101 Ga0207683_10126870 3300026121 Unclassified 2293
102 Ga0207683_11052113 3300026121 Unclassified 755
103 Ga0209966_1104358 3300027695 Bacteria 643
104 Ga0268266_10003623 3300028379 Bacteria 15280
105 Ga0268266_11240204 3300028379 Bacteria 721
106 Ga0268264_11793336 3300028381 Unclassified 624
107 Ga0307517_10019146 3300028786 Bacteria 8807
108 Ga0307515_10073926 3300028794 Bacteria 4570
109 Ga0307511_10147210 3300030521 Bacteria 1364
110 Ga0307513_10014250 3300031456 Bacteria 9722
111 Ga0307509_10000612 3300031507 Bacteria 60774
112 Ga0307509_10001192 3300031507 Bacteria 44255
113 Ga0307509_10030661 3300031507 Bacteria 5945
114 Ga0307509_10121247 3300031507 Bacteria 2592
115 Ga0265314_10202000 3300031711 Bacteria 1174
116 Ga0307516_10112396 3300031730 Bacteria 2524
117 Ga0307516_10465362 3300031730 Bacteria 920
118 Ga0307406_10495925 3300031901 Bacteria 989
119 Ga0307416_100018799 3300032002 Bacteria 4881
120 Ga0307415_100258071 3300032126 Bacteria 1420
121 Ga0373940_0229695 3300035088 Bacteria 619
122 Ga0373949_0000277 3300035090 Bacteria 18824
123 Ga0373936_0000039 3300035113 Bacteria 98144
124 Ga0373941_0014194 3300035115 Bacteria 2122
125 Ga0373960_0232490 3300035121 Bacteria 663
126 Ga0373931_1193247 3300035691 Unclassified 521
127 Ga0373937_1034380 3300036401 Unclassified 770
128 Ga0373925_0842793 3300037068 Bacteria 756
129 Ga0395899_0003956 3300037312 Bacteria 11676
130 Ga0395899_0395691 3300037312 Bacteria 915
131 Ga0395900_0036160 3300037418 Bacteria 5089
132 Ga0395898_0038149 3300037466 Bacteria 4764
133 Ga0395905_0432854 3300037471 Bacteria 1212
134 Ga0395905_1411034 3300037471 Unclassified 600
135 Ga0395901_0026855 3300038443 Bacteria 5911
136 Ga0395901_1026907 3300038443 Bacteria 799
137 Ga0436365_1129245 3300039437 Unclassified 1181
138 Ga0436365_1689771 3300039437 Bacteria 5505
139 Ga0436365_1845276 3300039437 Bacteria 526
140 Ga0436365_1862882 3300039437 Unclassified 677
141 Ga0451787_687157 3300041441 Unclassified 761
142 Ga0451802_2047893 3300041460 Archaea 510
143 Ga0451833_1158417 3300041491 Bacteria 568
144 Ga0451843_0407293 3300041509 Unclassified 770
145 Ga0466961_0327504 3300044693 Unclassified 934
146 Ga0466967_0642296 3300045976 Unclassified 1049
147 Ga0466967_2107538 3300045976 Unclassified 560
148 Ga0495632_0107458 3300046519 Bacteria 1312
149 Ga0495643_0378031 3300046522 Bacteria 629
150 Ga0495622_0149954 3300046557 Unclassified 1055
151 Ga0495669_0446236 3300046684 Bacteria 628
152 Ga0495649_0108093 3300046694 Bacteria 1476
153 Ga0496112_0909497 3300048915 Unclassified 802
154 Ga0501299_001398 3300049522 Bacteria 3090
155 Ga0501300_059361 3300049523 Unclassified 603
156 Ga0501034_0093588 3300049571 Bacteria 3002
157 Ga0501038_0529066 3300049574 Bacteria 899
158 Ga0501043_0774077 3300049579 Bacteria 696
159 Ga0501046_0267644 3300049580 Bacteria 1254
160 Ga0501047_0026491 3300049581 Bacteria 5577
161 Ga0501047_0259837 3300049581 Bacteria 1584
162 Ga0501048_0118461 3300049582 Bacteria 1871
163 Ga0501070_0231443 3300049586 Bacteria 1514
164 Ga0501070_0488970 3300049586 Bacteria 989
165 Ga0501071_0834908 3300049587 Unclassified 711
166 Ga0501074_0885035 3300049590 Unclassified 629
167 Ga0501077_0981882 3300049593 Unclassified 543
168 Ga0501216_002243 3300049660 Bacteria 2721
169 Ga0501217_012332 3300049661 Bacteria 1902
170 Ga0501227_000286 3300049665 Bacteria 10413
171 Ga0501227_017801 3300049665 Bacteria 1607
172 Ga0501228_021731 3300049666 Unclassified 731
173 Ga0501230_000141 3300049667 Bacteria 5778
174 Ga0501233_002233 3300049668 Bacteria 3394
175 Ga0501236_002400 3300049670 Unclassified 2150
176 Ga0501221_005321 3300049704 Unclassified 2148
177 Ga0501225_0004381 3300049705 Unclassified 4212
178 Ga0501234_003726 3300049707 Archaea 2396
179 Ga0501080_0315210 3300049742 Bacteria 1417
180 Ga0501035_0977758 3300049822 Unclassified 667
181 Ga0501044_0037373 3300049823 Bacteria 5075
182 Ga0501044_0111310 3300049823 Bacteria 2746
183 nmdc:mga05p37_1201643_c1 3300050507 Bacteria 783
184 nmdc:mga09592_25559_c1 3300050508 Bacteria 4889
185 nmdc:mga09592_332166_c1 3300050508 Unclassified 1316
186 nmdc:mga09592_376284_c1 3300050508 Bacteria 1228
187 nmdc:mga0qj67_955928_c1 3300050509 Unclassified 673
188 nmdc:mga06r32_148707_c1 3300050510 Bacteria 2320
189 nmdc:mga0n895_242205_c1 3300050512 Bacteria 1830
190 Ga0500635_0025315 3300053080 Bacteria 1869
191 Ga0500578_0098924 3300053086 Unclassified 1847
192 Ga0500583_0212661 3300053092 Unclassified 960
193 Ga0500583_0572171 3300053092 Bacteria 522
194 Ga0500566_0005854 3300053094 Bacteria 7304
195 Ga0500566_0009241 3300053094 Bacteria 5831
196 Ga0500566_0035813 3300053094 Bacteria 2883
197 Ga0500640_000073 3300053095 Bacteria 16592
198 Ga0500554_000131 3300053102 Bacteria 15007
199 Ga0500554_157451 3300053102 Bacteria 767
200 Ga0500572_000280 3300053111 Bacteria 18539
201 Ga0500595_000100 3300053119 Bacteria 58938
202 Ga0500597_001215 3300053120 Bacteria 6334
203 Ga0500597_162473 3300053120 Bacteria 955
204 Ga0500607_302362 3300053121 Unclassified 590
205 Ga0500608_197432 3300053122 Unclassified 835
206 Ga0500614_000480 3300053123 Bacteria 10398
207 Ga0500614_244577 3300053123 Bacteria 559
208 Ga0500614_286556 3300053123 Bacteria 516
209 Ga0500642_0159153 3300053130 Unclassified 1059
210 Ga0500642_0258349 3300053130 Bacteria 798
211 Ga0500559_0008125 3300053136 Bacteria 4616
212 Ga0500590_349822 3300053148 Bacteria 529
213 Ga0500603_004360 3300053150 Bacteria 3031
214 Ga0500622_0129714 3300053156 Unclassified 1213
215 Ga0500639_137616 3300053163 Bacteria 1147
216 Ga0500639_355655 3300053163 Bacteria 516
217 Ga0500636_0495415 3300053177 Unclassified 541
218 Ga0500637_0138896 3300053178 Bacteria 1407
219 Ga0500596_092294 3300053735 Bacteria 537
220 Ga0501084_1126149 3300054114 Bacteria 659

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005334 Ga0068869_100453066 Ga0068869_1004530662 98
2 3300005364 Ga0070673_101281422 Ga0070673_1012814222 98
3 3300025942 Ga0207689_10067804 Ga0207689_100678046 98
4 3300032126 Ga0307415_100258071 Ga0307415_1002580712 99
5 3300031901 Ga0307406_10495925 Ga0307406_104959252 101
6 3300050509 nmdc:mga0qj67_955928_c1 nmdc:mga0qj67_955928_c1_184_489 101
7 3300005456 Ga0070678_100908243 Ga0070678_1009082432 102
8 3300005548 Ga0070665_100038581 Ga0070665_1000385812 102
9 3300025903 Ga0207680_10666421 Ga0207680_106664212 102
10 3300026121 Ga0207683_11052113 Ga0207683_110521132 102
11 3300028379 Ga0268266_10003623 Ga0268266_1000362311 102
12 3300005334 Ga0068869_101200169 Ga0068869_1012001691 104
13 3300005340 Ga0070689_102070116 Ga0070689_1020701162 105
14 3300005536 Ga0070697_101000165 Ga0070697_1010001652 105
15 3300025936 Ga0207670_10184183 Ga0207670_101841831 105
16 3300049522 Ga0501299_001398 Ga0501299_001398_2682_3011 105
17 3300049523 Ga0501300_059361 Ga0501300_059361_39_368 105
18 3300049660 Ga0501216_002243 Ga0501216_002243_708_1037 105
19 3300049661 Ga0501217_012332 Ga0501217_012332_498_827 105
20 3300049665 Ga0501227_000286 Ga0501227_000286_3970_4299 105
21 3300049666 Ga0501228_021731 Ga0501228_021731_306_635 105
22 3300049667 Ga0501230_000141 Ga0501230_000141_1080_1409 105
23 3300049668 Ga0501233_002233 Ga0501233_002233_380_709 105
24 3300049670 Ga0501236_002400 Ga0501236_002400_335_664 105
25 3300049704 Ga0501221_005321 Ga0501221_005321_1397_1726 105
26 3300049705 Ga0501225_0004381 Ga0501225_0004381_2645_2974 105
27 3300049707 Ga0501234_003726 Ga0501234_003726_920_1249 105
28 3300053092 Ga0500583_0572171 Ga0500583_0572171_13_351 105
29 3300041491 Ga0451833_1158417 Ga0451833_1158417_109_441 106
30 3300045976 Ga0466967_2107538 Ga0466967_2107538_178_510 106
31 3300005329 Ga0070683_101130735 Ga0070683_1011307351 107
32 3300005535 Ga0070684_100395870 Ga0070684_1003958702 107
33 3300006237 Ga0097621_101584841 Ga0097621_1015848412 107
34 3300014969 Ga0157376_10185556 Ga0157376_101855562 107
35 3300025944 Ga0207661_11002049 Ga0207661_110020491 107
36 3300035088 Ga0373940_0229695 Ga0373940_0229695_203_538 107
37 3300039437 Ga0436365_1129245 Ga0436365_1129245_472_813 107
38 3300005445 Ga0070708_100039985 Ga0070708_1000399853 108
39 3300006881 Ga0068865_101068868 Ga0068865_1010688682 108
40 3300031730 Ga0307516_10465362 Ga0307516_104653622 108
41 3300041509 Ga0451843_0407293 Ga0451843_0407293_245_592 108
42 3300046557 Ga0495622_0149954 Ga0495622_0149954_126_476 108
43 3300050508 nmdc:mga09592_376284_c1 nmdc:mga09592_376284_c1_783_1124 108
44 3300053102 Ga0500554_157451 Ga0500554_157451_270_620 108
45 3300053120 Ga0500597_001215 Ga0500597_001215_2895_3245 108
46 3300053123 Ga0500614_286556 Ga0500614_286556_132_482 108
47 3300006844 Ga0075428_101142286 Ga0075428_1011422862 109
48 3300031507 Ga0307509_10121247 Ga0307509_101212473 109
49 3300005330 Ga0070690_100140803 Ga0070690_1001408032 110
50 3300005331 Ga0070670_100325951 Ga0070670_1003259511 110
51 3300005340 Ga0070689_100057742 Ga0070689_1000577422 110
52 3300005345 Ga0070692_11431970 Ga0070692_114319701 110
53 3300005535 Ga0070684_100710702 Ga0070684_1007107022 110
54 3300005563 Ga0068855_100068801 Ga0068855_1000688013 110
55 3300006358 Ga0068871_100403227 Ga0068871_1004032272 110
56 3300009174 Ga0105241_10675778 Ga0105241_106757782 110
57 3300014969 Ga0157376_12186553 Ga0157376_121865531 110
58 3300025911 Ga0207654_10341082 Ga0207654_103410822 110
59 3300025925 Ga0207650_11255795 Ga0207650_112557952 110
60 3300025944 Ga0207661_11311897 Ga0207661_113118971 110
61 3300025949 Ga0207667_10814406 Ga0207667_108144062 110
62 3300026023 Ga0207677_10294126 Ga0207677_102941261 110
63 3300026116 Ga0207674_11518944 Ga0207674_115189442 110
64 3300027695 Ga0209966_1104358 Ga0209966_11043582 110
65 3300028381 Ga0268264_11793336 Ga0268264_117933362 110
66 3300035090 Ga0373949_0000277 Ga0373949_0000277_14548_14895 110
67 3300035115 Ga0373941_0014194 Ga0373941_0014194_182_529 110
68 3300005334 Ga0068869_100048804 Ga0068869_1000488042 111
69 3300005340 Ga0070689_100059706 Ga0070689_1000597065 111
70 3300005365 Ga0070688_100255285 Ga0070688_1002552851 111
71 3300005406 Ga0070703_10221026 Ga0070703_102210262 111
72 3300005545 Ga0070695_100137139 Ga0070695_1001371392 111
73 3300005545 Ga0070695_100398342 Ga0070695_1003983422 111
74 3300005618 Ga0068864_100103330 Ga0068864_1001033302 111
75 3300005843 Ga0068860_101595588 Ga0068860_1015955881 111
76 3300005937 Ga0081455_10075938 Ga0081455_100759383 111
77 3300006846 Ga0075430_100587096 Ga0075430_1005870962 111
78 3300006880 Ga0075429_100027549 Ga0075429_1000275492 111
79 3300006880 Ga0075429_100308709 Ga0075429_1003087091 111
80 3300007076 Ga0075435_100350855 Ga0075435_1003508552 111
81 3300009098 Ga0105245_11256806 Ga0105245_112568062 111
82 3300009147 Ga0114129_11247925 Ga0114129_112479251 111
83 3300014968 Ga0157379_11333339 Ga0157379_113333391 111
84 3300025918 Ga0207662_10220850 Ga0207662_102208502 111
85 3300025918 Ga0207662_10548641 Ga0207662_105486412 111
86 3300025936 Ga0207670_10331553 Ga0207670_103315532 111
87 3300025942 Ga0207689_10045172 Ga0207689_100451722 111
88 3300026095 Ga0207676_10035928 Ga0207676_100359282 111
89 3300028786 Ga0307517_10019146 Ga0307517_100191464 111
90 3300028794 Ga0307515_10073926 Ga0307515_100739265 111
91 3300030521 Ga0307511_10147210 Ga0307511_101472101 111
92 3300031507 Ga0307509_10000612 Ga0307509_100006124 111
93 3300031507 Ga0307509_10030661 Ga0307509_100306614 111
94 3300031730 Ga0307516_10112396 Ga0307516_101123962 111
95 3300032002 Ga0307416_100018799 Ga0307416_1000187992 111
96 3300035113 Ga0373936_0000039 Ga0373936_0000039_43097_43453 111
97 3300035121 Ga0373960_0232490 Ga0373960_0232490_299_649 111
98 3300035691 Ga0373931_1193247 Ga0373931_1193247_80_418 111
99 3300039437 Ga0436365_1862882 Ga0436365_1862882_260_610 111
100 3300041441 Ga0451787_687157 Ga0451787_687157_30_386 111
101 3300046522 Ga0495643_0378031 Ga0495643_0378031_211_561 111
102 3300046694 Ga0495649_0108093 Ga0495649_0108093_481_852 111
103 3300050507 nmdc:mga05p37_1201643_c1 nmdc:mga05p37_1201643_c1_141_494 111
104 3300050508 nmdc:mga09592_25559_c1 nmdc:mga09592_25559_c1_2690_3043 111
105 3300050508 nmdc:mga09592_332166_c1 nmdc:mga09592_332166_c1_412_780 111
106 3300050510 nmdc:mga06r32_148707_c1 nmdc:mga06r32_148707_c1_543_896 111
107 3300050512 nmdc:mga0n895_242205_c1 nmdc:mga0n895_242205_c1_454_804 111
108 3300053080 Ga0500635_0025315 Ga0500635_0025315_13_369 111
109 3300053086 Ga0500578_0098924 Ga0500578_0098924_612_968 111
110 3300053092 Ga0500583_0212661 Ga0500583_0212661_436_807 111
111 3300053094 Ga0500566_0005854 Ga0500566_0005854_69_425 111
112 3300053094 Ga0500566_0009241 Ga0500566_0009241_3165_3530 111
113 3300053095 Ga0500640_000073 Ga0500640_000073_9876_10241 111
114 3300053102 Ga0500554_000131 Ga0500554_000131_1292_1657 111
115 3300053111 Ga0500572_000280 Ga0500572_000280_12981_13346 111
116 3300053119 Ga0500595_000100 Ga0500595_000100_21080_21445 111
117 3300053120 Ga0500597_162473 Ga0500597_162473_268_624 111
118 3300053121 Ga0500607_302362 Ga0500607_302362_122_487 111
119 3300053122 Ga0500608_197432 Ga0500608_197432_258_623 111
120 3300053123 Ga0500614_000480 Ga0500614_000480_352_717 111
121 3300053130 Ga0500642_0159153 Ga0500642_0159153_11_373 111
122 3300053130 Ga0500642_0258349 Ga0500642_0258349_383_742 111
123 3300053136 Ga0500559_0008125 Ga0500559_0008125_1398_1763 111
124 3300053148 Ga0500590_349822 Ga0500590_349822_88_444 111
125 3300053150 Ga0500603_004360 Ga0500603_004360_335_691 111
126 3300053156 Ga0500622_0129714 Ga0500622_0129714_296_667 111
127 3300053163 Ga0500639_137616 Ga0500639_137616_659_1009 111
128 3300053163 Ga0500639_355655 Ga0500639_355655_86_442 111
129 3300053177 Ga0500636_0495415 Ga0500636_0495415_136_498 111
130 3300053178 Ga0500637_0138896 Ga0500637_0138896_392_757 111
131 3300053735 Ga0500596_092294 Ga0500596_092294_79_429 111
132 3300005327 Ga0070658_10511510 Ga0070658_105115102 112
133 3300005329 Ga0070683_100228183 Ga0070683_1002281832 112
134 3300005331 Ga0070670_101245686 Ga0070670_1012456862 112
135 3300005336 Ga0070680_100460835 Ga0070680_1004608352 112
136 3300005336 Ga0070680_100727577 Ga0070680_1007275772 112
137 3300005356 Ga0070674_100059385 Ga0070674_1000593852 112
138 3300005456 Ga0070678_100092697 Ga0070678_1000926974 112
139 3300005458 Ga0070681_10271528 Ga0070681_102715282 112
140 3300005466 Ga0070685_10094878 Ga0070685_100948783 112
141 3300005466 Ga0070685_10734893 Ga0070685_107348931 112
142 3300005530 Ga0070679_100023921 Ga0070679_1000239215 112
143 3300005530 Ga0070679_100570733 Ga0070679_1005707332 112
144 3300005530 Ga0070679_101136348 Ga0070679_1011363482 112
145 3300005535 Ga0070684_100189842 Ga0070684_1001898423 112
146 3300005548 Ga0070665_100451364 Ga0070665_1004513642 112
147 3300005577 Ga0068857_101095457 Ga0068857_1010954572 112
148 3300005578 Ga0068854_100569737 Ga0068854_1005697372 112
149 3300005614 Ga0068856_100026435 Ga0068856_1000264355 112
150 3300006028 Ga0070717_10123511 Ga0070717_101235113 112
151 3300009098 Ga0105245_10000041 Ga0105245_10000041110 112
152 3300009148 Ga0105243_11125629 Ga0105243_111256292 112
153 3300009176 Ga0105242_11679658 Ga0105242_116796582 112
154 3300009177 Ga0105248_11428216 Ga0105248_114282162 112
155 3300009545 Ga0105237_11236308 Ga0105237_112363082 112
156 3300010375 Ga0105239_10023798 Ga0105239_100237987 112
157 3300013296 Ga0157374_10003089 Ga0157374_100030896 112
158 3300013307 Ga0157372_11908802 Ga0157372_119088022 112
159 3300014969 Ga0157376_10030118 Ga0157376_100301182 112
160 3300025909 Ga0207705_10839552 Ga0207705_108395522 112
161 3300025910 Ga0207684_10434456 Ga0207684_104344562 112
162 3300025912 Ga0207707_10319124 Ga0207707_103191242 112
163 3300025917 Ga0207660_10725647 Ga0207660_107256472 112
164 3300025921 Ga0207652_10026531 Ga0207652_100265312 112
165 3300025921 Ga0207652_10230438 Ga0207652_102304382 112
166 3300025921 Ga0207652_11328507 Ga0207652_113285072 112
167 3300025921 Ga0207652_11519764 Ga0207652_115197642 112
168 3300025922 Ga0207646_11381743 Ga0207646_113817431 112
169 3300025927 Ga0207687_10000067 Ga0207687_1000006714 112
170 3300025934 Ga0207686_11194532 Ga0207686_111945322 112
171 3300025937 Ga0207669_10013430 Ga0207669_100134303 112
172 3300025938 Ga0207704_10344604 Ga0207704_103446042 112
173 3300025941 Ga0207711_11050145 Ga0207711_110501452 112
174 3300025944 Ga0207661_10192645 Ga0207661_101926452 112
175 3300025981 Ga0207640_10522993 Ga0207640_105229932 112
176 3300026078 Ga0207702_10208056 Ga0207702_102080562 112
177 3300026116 Ga0207674_10979092 Ga0207674_109790922 112
178 3300026121 Ga0207683_10126870 Ga0207683_101268702 112
179 3300028379 Ga0268266_11240204 Ga0268266_112402041 112
180 3300031456 Ga0307513_10014250 Ga0307513_100142502 112
181 3300031507 Ga0307509_10001192 Ga0307509_1000119218 112
182 3300031711 Ga0265314_10202000 Ga0265314_102020002 112
183 3300036401 Ga0373937_1034380 Ga0373937_1034380_117_455 112
184 3300037068 Ga0373925_0842793 Ga0373925_0842793_391_729 112
185 3300037312 Ga0395899_0003956 Ga0395899_0003956_8459_8806 112
186 3300037312 Ga0395899_0395691 Ga0395899_0395691_411_758 112
187 3300037418 Ga0395900_0036160 Ga0395900_0036160_2461_2808 112
188 3300037466 Ga0395898_0038149 Ga0395898_0038149_325_672 112
189 3300037471 Ga0395905_0432854 Ga0395905_0432854_637_975 112
190 3300037471 Ga0395905_1411034 Ga0395905_1411034_40_378 112
191 3300038443 Ga0395901_0026855 Ga0395901_0026855_2871_3218 112
192 3300038443 Ga0395901_1026907 Ga0395901_1026907_380_718 112
193 3300039437 Ga0436365_1689771 Ga0436365_1689771_4169_4507 112
194 3300039437 Ga0436365_1845276 Ga0436365_1845276_38_388 112
195 3300041460 Ga0451802_2047893 Ga0451802_2047893_82_435 112
196 3300044693 Ga0466961_0327504 Ga0466961_0327504_66_404 112
197 3300045976 Ga0466967_0642296 Ga0466967_0642296_604_942 112
198 3300046519 Ga0495632_0107458 Ga0495632_0107458_914_1267 112
199 3300046684 Ga0495669_0446236 Ga0495669_0446236_139_477 112
200 3300048915 Ga0496112_0909497 Ga0496112_0909497_296_634 112
201 3300049571 Ga0501034_0093588 Ga0501034_0093588_207_545 112
202 3300049574 Ga0501038_0529066 Ga0501038_0529066_244_582 112
203 3300049579 Ga0501043_0774077 Ga0501043_0774077_156_503 112
204 3300049580 Ga0501046_0267644 Ga0501046_0267644_537_875 112
205 3300049581 Ga0501047_0026491 Ga0501047_0026491_176_523 112
206 3300049581 Ga0501047_0259837 Ga0501047_0259837_940_1278 112
207 3300049582 Ga0501048_0118461 Ga0501048_0118461_1422_1769 112
208 3300049586 Ga0501070_0231443 Ga0501070_0231443_79_417 112
209 3300049586 Ga0501070_0488970 Ga0501070_0488970_468_806 112
210 3300049587 Ga0501071_0834908 Ga0501071_0834908_266_622 112
211 3300049590 Ga0501074_0885035 Ga0501074_0885035_64_420 112
212 3300049593 Ga0501077_0981882 Ga0501077_0981882_89_445 112
213 3300049665 Ga0501227_017801 Ga0501227_017801_96_455 112
214 3300049742 Ga0501080_0315210 Ga0501080_0315210_925_1272 112
215 3300049822 Ga0501035_0977758 Ga0501035_0977758_62_400 112
216 3300049823 Ga0501044_0037373 Ga0501044_0037373_863_1210 112
217 3300049823 Ga0501044_0111310 Ga0501044_0111310_1375_1713 112
218 3300053094 Ga0500566_0035813 Ga0500566_0035813_2337_2699 112
219 3300053123 Ga0500614_244577 Ga0500614_244577_99_461 112
220 3300054114 Ga0501084_1126149 Ga0501084_1126149_157_495 112

Structural Annotation

Top 5 Hits

ID Description Score Start End
2p0w-assembly2.cif.gz_B human histone acetyltransferase 1 (hat1) 0.8437 84 109
4qak-assembly2.cif.gz_B crystal structure of phosphoesterase 0.7987 87 112
3idh-assembly1.cif.gz_A human pancreatic glucokinase in complex with glucose 0.7737 83 112
1v4s-assembly1.cif.gz_A crystal structure of human glucokinase 0.7631 83 111
3qic-assembly1.cif.gz_A the structure of human glucokinase e339k mutation 0.7536 84 112
ID Description Score Start End Superfamily
af_D3Z945_1_513_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9225 86 107 3.30.470.20
af_A5YM72_1_389_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9103 86 108 3.30.470.20
af_Q9VDF8_25_248_3.15.10.30 Alpha Beta;Super Roll;Bactericidal permeability-increasing protein; domain 1;TULIP domain 0.9044 85 110 3.15.10.30
af_Q9Y143_38_260_3.15.10.30 Alpha Beta;Super Roll;Bactericidal permeability-increasing protein; domain 1;TULIP domain 0.8812 85 110 3.15.10.30
2p0wB02 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.802 81 109 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A6J1MG16-F1-model_v4 Uncharacterized protein LOC112043055 0.9412 85 110
AF-D2W573-F1-model_v4 Predicted protein 0.9118 85 110
AF-A0A7W0VJR5-F1-model_v4 Uncharacterized protein 0.9046 3 112
AF-A0A7W0Y535-F1-model_v4 Uncharacterized protein 0.875 1 112
AF-A0A7W0VJR5-F1-model_v4 Uncharacterized protein 0.873 3 112

Feature Viewer

pLDDT pTM Quality
89.44 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map